F455900

General Info

Members Datasets Scaffolds Average Seq Length
502 299 1004 102

Family's Representative Sequence

Representative Sequence 3300046458|Ga0495591_124782|Ga0495591_124782_180_536
Length 118
Sequence MDALALRRRRGKLFKVADDFCSHLGTIQKVTPGTKGCEECLKLGWEWVHLRVCRTCGHVGCCDQSRGKHATKHFHRSQHPIIEGYDPAEGWGWCYIDEVMFDLAGNVTPQVGPIPRYY

Samples

Sample ID Description Type Environment
1 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
88 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
288 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
289 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
293 2738541277 Variovorax sp. GV051 Isolate Unclassified
294 2738543019 Variovorax sp. GV040 Isolate Unclassified
295 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
296 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
297 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
298 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
299 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0.6
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.78
Nodule 0.2
Rhizoplane 2.79
Rhizosphere 86.85
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495591_124782 3300046458 Bacteria 627
2 JGI24742J22300_10052704 3300002244 Bacteria 739
3 JGI25153J46596_10003598 3300003215 Bacteria 8605
4 JGI25153J46596_10004900 3300003215 Bacteria 7115
5 JGI25404J52841_10147252 3300003659 Bacteria 500
6 Ga0055530_10121698 3300003791 Bacteria 505
7 Ga0065165_1001444 3300005262 Bacteria 25757
8 Ga0065707_10032608 3300005295 Bacteria 1460
9 Ga0070658_10241173 3300005327 Bacteria 1532
10 Ga0070658_11153686 3300005327 Bacteria 674
11 Ga0070676_10067127 3300005328 Bacteria 2144
12 Ga0070683_100226795 3300005329 Bacteria 1776
13 Ga0070690_100022871 3300005330 Bacteria 3828
14 Ga0070690_101008481 3300005330 Bacteria 656
15 Ga0070670_100493576 3300005331 Bacteria 1088
16 Ga0068869_100050971 3300005334 Bacteria 3002
17 Ga0068869_100258387 3300005334 Bacteria 1394
18 Ga0070666_10196655 3300005335 Bacteria 1418
19 Ga0070666_10262863 3300005335 Bacteria 1224
20 Ga0070680_101996363 3300005336 Bacteria 503
21 Ga0068868_100895321 3300005338 Bacteria 806
22 Ga0070660_100162391 3300005339 Bacteria 1801
23 Ga0070660_100278551 3300005339 Bacteria 1368
24 Ga0070689_100383556 3300005340 Bacteria 1185
25 Ga0070689_101835725 3300005340 Bacteria 553
26 Ga0070691_10374729 3300005341 Bacteria 796
27 Ga0070691_10377176 3300005341 Bacteria 794
28 Ga0070661_100164881 3300005344 Bacteria 1680
29 Ga0070661_101437211 3300005344 Bacteria 581
30 Ga0070668_100010579 3300005347 Bacteria 6863
31 Ga0070668_100594183 3300005347 Bacteria 968
32 Ga0070671_100430252 3300005355 Bacteria 1131
33 Ga0070674_100042281 3300005356 Bacteria 3094
34 Ga0070674_100422774 3300005356 Bacteria 1094
35 Ga0070674_100671110 3300005356 Bacteria 883
36 Ga0070674_100936444 3300005356 Bacteria 757
37 Ga0070673_100064347 3300005364 Bacteria 2922
38 Ga0070659_100119778 3300005366 Bacteria 2130
39 Ga0070659_100905529 3300005366 Bacteria 771
40 Ga0070667_100042589 3300005367 Bacteria 3809
41 Ga0070667_100052303 3300005367 Bacteria 3446
42 Ga0070709_11340625 3300005434 Bacteria 578
43 Ga0070713_101409192 3300005436 Bacteria 676
44 Ga0070710_10071836 3300005437 Bacteria 1997
45 Ga0070711_100004274 3300005439 Bacteria 8401
46 Ga0070700_100122988 3300005441 Bacteria 1741
47 Ga0070700_100537788 3300005441 Bacteria 905
48 Ga0070694_100693415 3300005444 Bacteria 827
49 Ga0070663_100032070 3300005455 Bacteria 3618
50 Ga0070663_100289149 3300005455 Bacteria 1308
51 Ga0070663_101308212 3300005455 Bacteria 640
52 Ga0070678_100151042 3300005456 Bacteria 1871
53 Ga0070678_100261559 3300005456 Bacteria 1455
54 Ga0070678_100679080 3300005456 Bacteria 926
55 Ga0070678_100683935 3300005456 Bacteria 923
56 Ga0070662_100254937 3300005457 Bacteria 1412
57 Ga0070662_100712525 3300005457 Bacteria 849
58 Ga0070681_10248870 3300005458 Bacteria 1690
59 Ga0070681_10697637 3300005458 Bacteria 931
60 Ga0068867_100030826 3300005459 Bacteria 3869
61 Ga0070685_10672585 3300005466 Unclassified 752
62 Ga0070698_100439013 3300005471 Bacteria 1240
63 Ga0070699_100258322 3300005518 Bacteria 1558
64 Ga0070679_100158723 3300005530 Bacteria 2236
65 Ga0070679_101380591 3300005530 Bacteria 650
66 Ga0068853_100522758 3300005539 Bacteria 1122
67 Ga0068853_101995306 3300005539 Bacteria 563
68 Ga0070672_100270121 3300005543 Bacteria 1436
69 Ga0070672_100560371 3300005543 Bacteria 993
70 Ga0070686_100393955 3300005544 Bacteria 1051
71 Ga0070695_100476377 3300005545 Bacteria 961
72 Ga0070696_100882171 3300005546 Bacteria 741
73 Ga0070693_100243099 3300005547 Bacteria 1190
74 Ga0070665_100005951 3300005548 Bacteria 12492
75 Ga0070665_100013916 3300005548 Bacteria 8091
76 Ga0070665_100046850 3300005548 Bacteria 4340
77 Ga0070665_100106444 3300005548 Bacteria 2807
78 Ga0070665_100439655 3300005548 Bacteria 1314
79 Ga0070665_100532642 3300005548 Bacteria 1186
80 Ga0070665_102084718 3300005548 Bacteria 572
81 Ga0068855_100061574 3300005563 Bacteria 4385
82 Ga0068857_100300177 3300005577 Bacteria 1480
83 Ga0068857_101915283 3300005577 Bacteria 581
84 Ga0068854_100600311 3300005578 Bacteria 940
85 Ga0068854_101575625 3300005578 Bacteria 598
86 Ga0070702_100064818 3300005615 Bacteria 2138
87 Ga0068852_101288857 3300005616 Bacteria 752
88 Ga0068859_100162974 3300005617 Bacteria 2309
89 Ga0068866_10382323 3300005718 Bacteria 903
90 Ga0068866_10964697 3300005718 Bacteria 604
91 Ga0068861_100000936 3300005719 Bacteria 17736
92 Ga0068861_100084241 3300005719 Bacteria 2496
93 Ga0068861_100312653 3300005719 Bacteria 1365
94 Ga0068861_100434506 3300005719 Bacteria 1172
95 Ga0068870_10903754 3300005840 Bacteria 624
96 Ga0068863_100207824 3300005841 Bacteria 1884
97 Ga0068858_100121465 3300005842 Bacteria 2443
98 Ga0068858_100180436 3300005842 Bacteria 1993
99 Ga0068858_100665928 3300005842 Bacteria 1012
100 Ga0068860_100454759 3300005843 Bacteria 1273
101 Ga0068862_100169244 3300005844 Bacteria 1955
102 Ga0068862_100314093 3300005844 Bacteria 1445
103 Ga0068862_101098972 3300005844 Bacteria 790
104 Ga0068862_101262349 3300005844 Bacteria 739
105 Ga0068862_101379963 3300005844 Bacteria 707
106 Ga0068862_101911465 3300005844 Bacteria 603
107 Ga0081540_1327463 3300005983 Bacteria 525
108 Ga0075363_100004743 3300006048 Bacteria 5989
109 Ga0075363_100217821 3300006048 Bacteria 1094
110 Ga0075364_10101576 3300006051 Bacteria 1914
111 Ga0075362_10025848 3300006177 Bacteria 2503
112 Ga0075369_10010473 3300006186 Bacteria 3626
113 Ga0075366_10040937 3300006195 Bacteria 2741
114 Ga0075366_10148313 3300006195 Bacteria 1420
115 Ga0097621_100173761 3300006237 Bacteria 1858
116 Ga0075370_10047192 3300006353 Bacteria 2439
117 Ga0068871_100151930 3300006358 Bacteria 1975
118 Ga0075428_100116174 3300006844 Bacteria 2914
119 Ga0075434_100435897 3300006871 Bacteria 1332
120 Ga0075429_100505977 3300006880 Bacteria 1058
121 Ga0068865_100042079 3300006881 Bacteria 3113
122 Ga0068865_100092183 3300006881 Bacteria 2200
123 Ga0068865_100168938 3300006881 Bacteria 1675
124 Ga0068865_100729750 3300006881 Bacteria 849
125 Ga0068865_101778015 3300006881 Bacteria 557
126 Ga0097620_100162979 3300006931 Bacteria 2309
127 Ga0105240_10029338 3300009093 Bacteria 7169
128 Ga0105240_10075030 3300009093 Bacteria 4172
129 Ga0105240_10229899 3300009093 Bacteria 2156
130 Ga0105240_10250138 3300009093 Bacteria 2050
131 Ga0105240_10572563 3300009093 Bacteria 1247
132 Ga0105240_11257358 3300009093 Bacteria 782
133 Ga0111539_10054719 3300009094 Bacteria 4747
134 Ga0105245_10221911 3300009098 Bacteria 1824
135 Ga0114129_10088436 3300009147 Bacteria 4294
136 Ga0105243_10014664 3300009148 Bacteria 5931
137 Ga0105243_10191331 3300009148 Bacteria 1787
138 Ga0105243_11089800 3300009148 Bacteria 806
139 Ga0105241_10030879 3300009174 Bacteria 4007
140 Ga0105241_10045846 3300009174 Bacteria 3319
141 Ga0105241_10278502 3300009174 Bacteria 1427
142 Ga0105242_10045533 3300009176 Bacteria 3556
143 Ga0105242_10241908 3300009176 Bacteria 1623
144 Ga0105242_10383408 3300009176 Bacteria 1307
145 Ga0105242_12395245 3300009176 Bacteria 575
146 Ga0105248_10127215 3300009177 Bacteria 2874
147 Ga0105237_10037548 3300009545 Bacteria 4895
148 Ga0105237_11686613 3300009545 Bacteria 641
149 Ga0105237_12787059 3300009545 Bacteria 500
150 Ga0105238_10005677 3300009551 Bacteria 12332
151 Ga0105238_10231206 3300009551 Bacteria 1826
152 Ga0105238_10584315 3300009551 Bacteria 1124
153 Ga0105238_11337620 3300009551 Bacteria 743
154 Ga0105249_10109013 3300009553 Bacteria 2614
155 Ga0105249_10148248 3300009553 Bacteria 2256
156 Ga0105249_11012882 3300009553 Bacteria 899
157 Ga0105249_13325941 3300009553 Bacteria 517
158 Ga0105032_112950 3300009979 Bacteria 667
159 Ga0105147_118416 3300009982 Bacteria 593
160 Ga0105239_10042734 3300010375 Bacteria 4966
161 Ga0105239_10112214 3300010375 Bacteria 3023
162 Ga0105239_10556712 3300010375 Bacteria 1306
163 Ga0105246_10143551 3300011119 Bacteria 1798
164 Ga0157323_1040051 3300012495 Bacteria 534
165 Ga0157373_10631182 3300013100 Bacteria 781
166 Ga0157373_10775209 3300013100 Bacteria 706
167 Ga0157371_10623361 3300013102 Bacteria 803
168 Ga0157370_10129722 3300013104 Bacteria 2352
169 Ga0157370_10357030 3300013104 Bacteria 1347
170 Ga0157369_10266830 3300013105 Bacteria 1785
171 Ga0157374_10116706 3300013296 Bacteria 2572
172 Ga0157374_10584970 3300013296 Bacteria 1126
173 Ga0157374_10844679 3300013296 Bacteria 932
174 Ga0157374_12804181 3300013296 Bacteria 515
175 Ga0157378_10057235 3300013297 Bacteria 3474
176 Ga0157378_10108212 3300013297 Bacteria 2545
177 Ga0163162_10121255 3300013306 Bacteria 2719
178 Ga0163162_10278456 3300013306 Bacteria 1805
179 Ga0163162_10485455 3300013306 Bacteria 1367
180 Ga0157372_11653570 3300013307 Bacteria 737
181 Ga0157372_11911020 3300013307 Bacteria 682
182 Ga0157375_10537161 3300013308 Bacteria 1332
183 Ga0163163_10201310 3300014325 Bacteria 2039
184 Ga0157380_10032288 3300014326 Bacteria 4026
185 Ga0157380_10249483 3300014326 Bacteria 1606
186 Ga0157380_10580580 3300014326 Bacteria 1105
187 Ga0157380_11684510 3300014326 Bacteria 691
188 Ga0182008_10337280 3300014497 Bacteria 797
189 Ga0157377_10189297 3300014745 Bacteria 1299
190 Ga0157379_10596889 3300014968 Bacteria 1030
191 Ga0157376_10012401 3300014969 Bacteria 6326
192 Ga0157376_10735642 3300014969 Bacteria 994
193 Ga0157376_11817275 3300014969 Bacteria 646
194 Ga0182006_1137225 3300015261 Bacteria 838
195 Ga0182007_10015599 3300015262 Bacteria 2828
196 Ga0163161_10220992 3300017792 Bacteria 1467
197 Ga0163161_10947222 3300017792 Bacteria 732
198 Ga0209758_1002075 3300025297 Bacteria 21325
199 Ga0209758_1058436 3300025297 Bacteria 1290
200 Ga0209050_1027819 3300025298 Bacteria 1852
201 Ga0207682_10464194 3300025893 Bacteria 600
202 Ga0207692_10394426 3300025898 Bacteria 862
203 Ga0207642_10006366 3300025899 Bacteria 3920
204 Ga0207642_10321997 3300025899 Bacteria 903
205 Ga0207642_10687368 3300025899 Bacteria 644
206 Ga0207688_10070385 3300025901 Bacteria 1984
207 Ga0207680_10560711 3300025903 Bacteria 816
208 Ga0207645_10205961 3300025907 Bacteria 1295
209 Ga0207643_10813042 3300025908 Bacteria 606
210 Ga0207705_10531063 3300025909 Bacteria 914
211 Ga0207654_10089468 3300025911 Bacteria 1873
212 Ga0207654_10916250 3300025911 Bacteria 636
213 Ga0207695_10021093 3300025913 Bacteria 7441
214 Ga0207695_10126406 3300025913 Bacteria 2518
215 Ga0207695_10852897 3300025913 Bacteria 791
216 Ga0207695_11373592 3300025913 Bacteria 587
217 Ga0207671_10184227 3300025914 Bacteria 1626
218 Ga0207671_10450838 3300025914 Bacteria 1025
219 Ga0207671_10498357 3300025914 Bacteria 971
220 Ga0207671_10523760 3300025914 Bacteria 945
221 Ga0207693_10046491 3300025915 Bacteria 3409
222 Ga0207663_10007792 3300025916 Bacteria 5579
223 Ga0207660_10947245 3300025917 Bacteria 702
224 Ga0207662_10053240 3300025918 Bacteria 2410
225 Ga0207657_10047455 3300025919 Bacteria 3755
226 Ga0207657_10244494 3300025919 Bacteria 1432
227 Ga0207657_10711008 3300025919 Bacteria 780
228 Ga0207652_11885312 3300025921 Bacteria 503
229 Ga0207694_10002086 3300025924 Bacteria 16503
230 Ga0207694_10078737 3300025924 Bacteria 2584
231 Ga0207694_10216853 3300025924 Bacteria 1560
232 Ga0207694_10396313 3300025924 Bacteria 1147
233 Ga0207694_10397259 3300025924 Bacteria 1146
234 Ga0207659_10899197 3300025926 Bacteria 761
235 Ga0207687_10067976 3300025927 Bacteria 2537
236 Ga0207644_10485175 3300025931 Bacteria 1018
237 Ga0207644_10591695 3300025931 Bacteria 921
238 Ga0207644_11131467 3300025931 Bacteria 658
239 Ga0207690_10118756 3300025932 Bacteria 1917
240 Ga0207690_10287267 3300025932 Bacteria 1283
241 Ga0207706_10107095 3300025933 Bacteria 2460
242 Ga0207706_10423026 3300025933 Bacteria 1154
243 Ga0207686_10092595 3300025934 Bacteria 1999
244 Ga0207686_10136040 3300025934 Bacteria 1692
245 Ga0207686_11298849 3300025934 Bacteria 597
246 Ga0207709_10004629 3300025935 Bacteria 7913
247 Ga0207709_10119692 3300025935 Bacteria 1776
248 Ga0207709_10568892 3300025935 Bacteria 893
249 Ga0207670_10780790 3300025936 Bacteria 795
250 Ga0207670_11287876 3300025936 Bacteria 620
251 Ga0207669_10223853 3300025937 Bacteria 1383
252 Ga0207669_10258704 3300025937 Bacteria 1300
253 Ga0207704_10150726 3300025938 Bacteria 1640
254 Ga0207704_10277882 3300025938 Bacteria 1271
255 Ga0207704_10384468 3300025938 Bacteria 1103
256 Ga0207665_10250061 3300025939 Bacteria 1309
257 Ga0207691_10277528 3300025940 Bacteria 1442
258 Ga0207711_10031436 3300025941 Bacteria 4481
259 Ga0207689_10044043 3300025942 Bacteria 3689
260 Ga0207689_10284253 3300025942 Bacteria 1370
261 Ga0207661_10524333 3300025944 Bacteria 1084
262 Ga0207667_10313479 3300025949 Bacteria 1602
263 Ga0207651_10164868 3300025960 Bacteria 1741
264 Ga0207712_10043150 3300025961 Bacteria 3109
265 Ga0207712_10077322 3300025961 Bacteria 2412
266 Ga0207668_10164439 3300025972 Bacteria 1733
267 Ga0207668_10870783 3300025972 Bacteria 800
268 Ga0207668_12101076 3300025972 Bacteria 508
269 Ga0207640_11629811 3300025981 Bacteria 582
270 Ga0207658_10145152 3300025986 Bacteria 1926
271 Ga0207658_10579501 3300025986 Bacteria 1006
272 Ga0207677_10404264 3300026023 Bacteria 1159
273 Ga0207677_11937300 3300026023 Bacteria 548
274 Ga0207703_10155191 3300026035 Bacteria 2000
275 Ga0207703_10377836 3300026035 Bacteria 1310
276 Ga0207639_10238826 3300026041 Bacteria 1579
277 Ga0207639_11467974 3300026041 Bacteria 640
278 Ga0207678_10064783 3300026067 Bacteria 3140
279 Ga0207678_10108090 3300026067 Bacteria 2373
280 Ga0207708_10035930 3300026075 Bacteria 3770
281 Ga0207708_10336795 3300026075 Bacteria 1235
282 Ga0207641_10251637 3300026088 Bacteria 1650
283 Ga0207648_10046951 3300026089 Bacteria 3786
284 Ga0207648_10070724 3300026089 Bacteria 3041
285 Ga0207648_10925441 3300026089 Bacteria 815
286 Ga0207674_10116129 3300026116 Bacteria 2648
287 Ga0207674_11041653 3300026116 Bacteria 787
288 Ga0207674_11414429 3300026116 Bacteria 665
289 Ga0207674_11416719 3300026116 Bacteria 664
290 Ga0207675_100013762 3300026118 Bacteria 7546
291 Ga0207675_100065880 3300026118 Bacteria 3385
292 Ga0207675_100288294 3300026118 Bacteria 1597
293 Ga0207675_102749366 3300026118 Bacteria 500
294 Ga0207683_10343453 3300026121 Bacteria 1369
295 Ga0207698_10259838 3300026142 Bacteria 1595
296 Ga0268266_10006419 3300028379 Bacteria 10775
297 Ga0268266_10020976 3300028379 Bacteria 5569
298 Ga0268266_10129399 3300028379 Bacteria 2256
299 Ga0268266_10140151 3300028379 Bacteria 2169
300 Ga0268266_10210379 3300028379 Bacteria 1783
301 Ga0268266_10825754 3300028379 Bacteria 895
302 Ga0268266_11911591 3300028379 Bacteria 567
303 Ga0268265_10187052 3300028380 Bacteria 1785
304 Ga0268265_10558833 3300028380 Bacteria 1087
305 Ga0268265_11014828 3300028380 Bacteria 820
306 Ga0268265_11078818 3300028380 Bacteria 796
307 Ga0268265_11707964 3300028380 Bacteria 635
308 Ga0268264_10058271 3300028381 Bacteria 3234
309 Ga0307515_10343602 3300028794 Bacteria 1143
310 Ga0265762_1012640 3300030760 Bacteria 1516
311 Ga0265767_101030 3300030836 Bacteria 1300
312 Ga0265769_101344 3300030888 Bacteria 1162
313 Ga0265327_10342821 3300031251 Bacteria 653
314 Ga0307513_10759978 3300031456 Bacteria 675
315 Ga0307508_10292923 3300031616 Bacteria 1220
316 Ga0307413_10537799 3300031824 Bacteria 945
317 Ga0307410_10766022 3300031852 Bacteria 818
318 Ga0307410_10897356 3300031852 Bacteria 759
319 Ga0307407_10101472 3300031903 Bacteria 1787
320 Ga0307412_12117609 3300031911 Bacteria 522
321 Ga0307409_100077558 3300031995 Bacteria 2669
322 Ga0307416_101445737 3300032002 Bacteria 793
323 Ga0307411_10434371 3300032005 Bacteria 1094
324 Ga0307415_100057100 3300032126 Bacteria 2680
325 Ga0307415_100094396 3300032126 Bacteria 2175
326 Ga0373928_0124362 3300035084 Bacteria 694
327 Ga0373946_0027302 3300035171 Bacteria 2257
328 Ga0373955_0663130 3300035172 Bacteria 640
329 Ga0373927_0028529 3300035695 Bacteria 3641
330 Ga0373927_0071145 3300035695 Bacteria 2251
331 Ga0373927_0271301 3300035695 Bacteria 1116
332 Ga0373947_0359214 3300035725 Bacteria 978
333 Ga0373937_1210502 3300036401 Bacteria 704
334 Ga0373925_0061369 3300037068 Bacteria 2824
335 Ga0395899_0006167 3300037312 Bacteria 9292
336 Ga0395898_0347218 3300037466 Bacteria 1415
337 Ga0395905_0178248 3300037471 Bacteria 1995
338 Ga0395905_0543896 3300037471 Bacteria 1062
339 Ga0395905_0949619 3300037471 Bacteria 763
340 Ga0436365_0745075 3300039437 Bacteria 1517
341 Ga0436365_1582635 3300039437 Bacteria 906
342 Ga0451791_0708923 3300041451 Bacteria 915
343 Ga0451807_1399357 3300041486 Bacteria 1015
344 Ga0451807_2208103 3300041486 Bacteria 513
345 Ga0451839_0720008 3300041496 Bacteria 640
346 Ga0451839_1403038 3300041496 Bacteria 620
347 Ga0439448_0000483 3300042005 Bacteria 9204
348 Ga0439448_0027417 3300042005 Bacteria 1795
349 Ga0439455_0000132 3300042012 Bacteria 7937
350 Ga0439455_0128893 3300042012 Bacteria 712
351 Ga0439458_0000070 3300042157 Bacteria 18659
352 Ga0439458_0001316 3300042157 Bacteria 6274
353 Ga0451576_1804878 3300045051 Bacteria 632
354 Ga0495603_0017379 3300046455 Bacteria 4352
355 Ga0495603_0369330 3300046455 Bacteria 823
356 Ga0495638_0112248 3300046460 Bacteria 1618
357 Ga0495641_0074480 3300046461 Bacteria 1523
358 Ga0495641_0188973 3300046461 Bacteria 923
359 Ga0495580_0304147 3300046472 Bacteria 1086
360 Ga0495662_0250864 3300046476 Bacteria 872
361 Ga0495584_0305801 3300046491 Bacteria 808
362 Ga0495585_0122797 3300046492 Bacteria 1372
363 Ga0495594_0612759 3300046499 Bacteria 617
364 Ga0495606_0043493 3300046507 Bacteria 2995
365 Ga0495608_0328377 3300046511 Bacteria 944
366 Ga0495628_0534000 3300046516 Bacteria 844
367 Ga0495631_0110916 3300046518 Bacteria 1180
368 Ga0495644_0347431 3300046523 Bacteria 584
369 Ga0495652_1058371 3300046529 Bacteria 528
370 Ga0495621_0069103 3300046539 Bacteria 1297
371 Ga0495622_0009564 3300046557 Bacteria 4486
372 Ga0495622_0169880 3300046557 Bacteria 981
373 Ga0495633_0086970 3300046558 Bacteria 1453
374 Ga0495656_0015482 3300046615 Bacteria 2879
375 Ga0495656_0058263 3300046615 Bacteria 1675
376 Ga0495634_0152498 3300046642 Bacteria 1461
377 Ga0495634_0428123 3300046642 Bacteria 783
378 Ga0495611_0318009 3300046648 Bacteria 716
379 Ga0495625_0359052 3300046660 Bacteria 919
380 Ga0495635_0131543 3300046663 Bacteria 1706
381 Ga0495659_0009877 3300046664 Bacteria 3052
382 Ga0495588_0031165 3300046674 Bacteria 2682
383 Ga0495588_0247459 3300046674 Bacteria 940
384 Ga0495588_0609965 3300046674 Bacteria 571
385 Ga0495599_0191142 3300046678 Bacteria 1259
386 Ga0495623_0586715 3300046679 Bacteria 580
387 Ga0495647_0048040 3300046681 Bacteria 1649
388 Ga0495669_0020349 3300046684 Bacteria 2871
389 Ga0495670_0032088 3300046691 Bacteria 2611
390 Ga0495671_0060724 3300046692 Bacteria 1866
391 Ga0495671_0605353 3300046692 Bacteria 521
392 Ga0495649_0092101 3300046694 Bacteria 1615
393 Ga0495649_0643011 3300046694 Bacteria 522
394 Ga0495589_0545077 3300046794 Bacteria 529
395 Ga0495600_0085826 3300046809 Bacteria 2054
396 Ga0495600_0718225 3300046809 Bacteria 600
397 Ga0495636_0059154 3300047318 Bacteria 1617
398 Ga0495636_0096106 3300047318 Bacteria 1291
399 Ga0495674_0727293 3300047319 Bacteria 777
400 Ga0495676_0218594 3300047321 Bacteria 1314
401 Ga0495686_0069718 3300047472 Bacteria 2167
402 Ga0495602_0229601 3300048088 Bacteria 1395
403 Ga0495615_0051144 3300048090 Bacteria 1064
404 Ga0495615_0253667 3300048090 Bacteria 558
405 Ga0496100_0021161 3300048903 Bacteria 3913
406 Ga0496101_0185491 3300048904 Bacteria 1603
407 Ga0496106_0079672 3300048909 Bacteria 2515
408 Ga0496107_0163706 3300048910 Bacteria 1649
409 Ga0496107_0232491 3300048910 Bacteria 1372
410 Ga0496109_1516795 3300048912 Bacteria 605
411 Ga0496110_1539390 3300048913 Bacteria 575
412 Ga0496114_0742918 3300048917 Bacteria 858
413 Ga0496115_0034410 3300048918 Bacteria 4004
414 Ga0496115_0466052 3300048918 Bacteria 1019
415 Ga0496115_0643351 3300048918 Bacteria 839
416 Ga0496121_0001026 3300048924 Bacteria 49755
417 Ga0496121_0133051 3300048924 Bacteria 1857
418 Ga0496123_0040309 3300048926 Bacteria 3255
419 Ga0496126_0008559 3300048929 Bacteria 11023
420 Ga0496126_0012135 3300048929 Bacteria 8845
421 Ga0496126_0061289 3300048929 Bacteria 3380
422 Ga0496126_0456806 3300048929 Bacteria 1027
423 Ga0496126_1078077 3300048929 Bacteria 598
424 Ga0501032_0002111 3300049569 Bacteria 15684
425 Ga0501032_0830269 3300049569 Bacteria 583
426 Ga0501033_0004856 3300049570 Bacteria 10709
427 Ga0501033_0011028 3300049570 Bacteria 6921
428 Ga0501033_0064089 3300049570 Bacteria 2704
429 Ga0501033_0757495 3300049570 Bacteria 658
430 Ga0501034_0023239 3300049571 Bacteria 6317
431 Ga0501034_0153805 3300049571 Bacteria 2275
432 Ga0501034_0600022 3300049571 Bacteria 1007
433 Ga0501036_0001296 3300049572 Bacteria 19151
434 Ga0501036_0644409 3300049572 Bacteria 877
435 Ga0501037_0026800 3300049573 Bacteria 4258
436 Ga0501037_0110985 3300049573 Bacteria 1976
437 Ga0501038_0049173 3300049574 Bacteria 3647
438 Ga0501038_0107431 3300049574 Bacteria 2315
439 Ga0501038_0216155 3300049574 Bacteria 1531
440 Ga0501038_1121971 3300049574 Bacteria 573
441 Ga0501039_0034057 3300049575 Bacteria 3930
442 Ga0501040_0662234 3300049576 Bacteria 755
443 Ga0501042_0056436 3300049578 Bacteria 2802
444 Ga0501043_0034562 3300049579 Bacteria 3975
445 Ga0501043_0105808 3300049579 Bacteria 2210
446 Ga0501046_0349147 3300049580 Bacteria 1074
447 Ga0501047_0014662 3300049581 Bacteria 7458
448 Ga0501047_0324190 3300049581 Bacteria 1380
449 Ga0501047_0998907 3300049581 Bacteria 650
450 Ga0501048_0013508 3300049582 Bacteria 6059
451 Ga0501067_0004265 3300049583 Bacteria 7885
452 Ga0501068_0042539 3300049584 Bacteria 2732
453 Ga0501069_0060993 3300049585 Bacteria 2105
454 Ga0501070_0037463 3300049586 Bacteria 4048
455 Ga0501070_0335521 3300049586 Bacteria 1228
456 Ga0501072_0224750 3300049588 Bacteria 1496
457 Ga0501073_0011915 3300049589 Bacteria 6347
458 Ga0501073_0076204 3300049589 Bacteria 2334
459 Ga0501074_0001757 3300049590 Bacteria 14801
460 Ga0501080_0024486 3300049742 Bacteria 5594
461 Ga0501080_0308805 3300049742 Bacteria 1434
462 Ga0501083_0020020 3300049744 Bacteria 4657
463 Ga0501083_0047050 3300049744 Bacteria 2916
464 Ga0501035_0056060 3300049822 Bacteria 3518
465 Ga0501035_0169545 3300049822 Bacteria 1886
466 Ga0501035_0712395 3300049822 Bacteria 808
467 Ga0501044_0077031 3300049823 Bacteria 3382
468 Ga0501044_0099561 3300049823 Bacteria 2925
469 Ga0501044_1482916 3300049823 Bacteria 543
470 Ga0501045_0517538 3300049824 Bacteria 886
471 nmdc:mga03683_30552_c1 3300050489 Bacteria 2156
472 nmdc:mga03n38_193970_c1 3300050490 Bacteria 1048
473 nmdc:mga00v17_33007_c1 3300050491 Bacteria 3064
474 nmdc:mga00v17_999501_c1 3300050491 Unclassified 527
475 nmdc:mga0yw44_45368_c1 3300050492 Bacteria 2635
476 nmdc:mga0k408_130823_c1 3300050493 Bacteria 1490
477 nmdc:mga0k408_940371_c1 3300050493 Bacteria 501
478 nmdc:mga06z11_130940_c1 3300050494 Bacteria 1409
479 nmdc:mga07m45_296716_c1 3300050496 Bacteria 648
480 nmdc:mga05p37_176084_c1 3300050507 Bacteria 2606
481 nmdc:mga09592_189412_c1 3300050508 Bacteria 1780
482 nmdc:mga0qj67_1356607_c1 3300050509 Bacteria 550
483 nmdc:mga08y16_1700964_c1 3300050511 Bacteria 586
484 nmdc:mga0n895_1802345_c1 3300050512 Bacteria 573
485 nmdc:mga0n895_481743_c1 3300050512 Bacteria 1251
486 Ga0495619_0928055 3300053085 Bacteria 585
487 Ga0500643_037546 3300053087 Bacteria 1442
488 Ga0500562_065561 3300053108 Bacteria 978
489 Ga0500595_024686 3300053119 Bacteria 2095
490 Ga0500595_083735 3300053119 Bacteria 930
491 Ga0500573_0000004 3300053140 Bacteria 341236
492 Ga0501084_0002143 3300054114 Bacteria 15776
493 Ga0501084_0452620 3300054114 Bacteria 1085
494 Ga0501082_0074577 3300060353 Bacteria 2922
495 2644126294 2643221622 Bacteria 4212502
496 2738720520 2738541277 Bacteria 7458140
497 2739279719 2738543019 Bacteria 7459457
498 2824765000 2824763712 Bacteria 9792355
499 2842776704 2842775625 Bacteria 5587290
500 2879117099 2879110137 Bacteria 8907982
501 2895399014 2895395659 Bacteria 3983269
502 2904715999 2904711408 Bacteria 9771557
503 Ga0495591_124782
504 JGI24742J22300_10052704
505 JGI25153J46596_10003598
506 JGI25153J46596_10004900
507 JGI25404J52841_10147252
508 Ga0055530_10121698
509 Ga0065165_1001444
510 Ga0065707_10032608
511 Ga0070658_10241173
512 Ga0070658_11153686
513 Ga0070676_10067127
514 Ga0070683_100226795
515 Ga0070690_100022871
516 Ga0070690_101008481
517 Ga0070670_100493576
518 Ga0068869_100050971
519 Ga0068869_100258387
520 Ga0070666_10196655
521 Ga0070666_10262863
522 Ga0070680_101996363
523 Ga0068868_100895321
524 Ga0070660_100162391
525 Ga0070660_100278551
526 Ga0070689_100383556
527 Ga0070689_101835725
528 Ga0070691_10374729
529 Ga0070691_10377176
530 Ga0070661_100164881
531 Ga0070661_101437211
532 Ga0070668_100010579
533 Ga0070668_100594183
534 Ga0070671_100430252
535 Ga0070674_100042281
536 Ga0070674_100422774
537 Ga0070674_100671110
538 Ga0070674_100936444
539 Ga0070673_100064347
540 Ga0070659_100119778
541 Ga0070659_100905529
542 Ga0070667_100042589
543 Ga0070667_100052303
544 Ga0070709_11340625
545 Ga0070713_101409192
546 Ga0070710_10071836
547 Ga0070711_100004274
548 Ga0070700_100122988
549 Ga0070700_100537788
550 Ga0070694_100693415
551 Ga0070663_100032070
552 Ga0070663_100289149
553 Ga0070663_101308212
554 Ga0070678_100151042
555 Ga0070678_100261559
556 Ga0070678_100679080
557 Ga0070678_100683935
558 Ga0070662_100254937
559 Ga0070662_100712525
560 Ga0070681_10248870
561 Ga0070681_10697637
562 Ga0068867_100030826
563 Ga0070685_10672585
564 Ga0070698_100439013
565 Ga0070699_100258322
566 Ga0070679_100158723
567 Ga0070679_101380591
568 Ga0068853_100522758
569 Ga0068853_101995306
570 Ga0070672_100270121
571 Ga0070672_100560371
572 Ga0070686_100393955
573 Ga0070695_100476377
574 Ga0070696_100882171
575 Ga0070693_100243099
576 Ga0070665_100005951
577 Ga0070665_100013916
578 Ga0070665_100046850
579 Ga0070665_100106444
580 Ga0070665_100439655
581 Ga0070665_100532642
582 Ga0070665_102084718
583 Ga0068855_100061574
584 Ga0068857_100300177
585 Ga0068857_101915283
586 Ga0068854_100600311
587 Ga0068854_101575625
588 Ga0070702_100064818
589 Ga0068852_101288857
590 Ga0068859_100162974
591 Ga0068866_10382323
592 Ga0068866_10964697
593 Ga0068861_100000936
594 Ga0068861_100084241
595 Ga0068861_100312653
596 Ga0068861_100434506
597 Ga0068870_10903754
598 Ga0068863_100207824
599 Ga0068858_100121465
600 Ga0068858_100180436
601 Ga0068858_100665928
602 Ga0068860_100454759
603 Ga0068862_100169244
604 Ga0068862_100314093
605 Ga0068862_101098972
606 Ga0068862_101262349
607 Ga0068862_101379963
608 Ga0068862_101911465
609 Ga0081540_1327463
610 Ga0075363_100004743
611 Ga0075363_100217821
612 Ga0075364_10101576
613 Ga0075362_10025848
614 Ga0075369_10010473
615 Ga0075366_10040937
616 Ga0075366_10148313
617 Ga0097621_100173761
618 Ga0075370_10047192
619 Ga0068871_100151930
620 Ga0075428_100116174
621 Ga0075434_100435897
622 Ga0075429_100505977
623 Ga0068865_100042079
624 Ga0068865_100092183
625 Ga0068865_100168938
626 Ga0068865_100729750
627 Ga0068865_101778015
628 Ga0097620_100162979
629 Ga0105240_10029338
630 Ga0105240_10075030
631 Ga0105240_10229899
632 Ga0105240_10250138
633 Ga0105240_10572563
634 Ga0105240_11257358
635 Ga0111539_10054719
636 Ga0105245_10221911
637 Ga0114129_10088436
638 Ga0105243_10014664
639 Ga0105243_10191331
640 Ga0105243_11089800
641 Ga0105241_10030879
642 Ga0105241_10045846
643 Ga0105241_10278502
644 Ga0105242_10045533
645 Ga0105242_10241908
646 Ga0105242_10383408
647 Ga0105242_12395245
648 Ga0105248_10127215
649 Ga0105237_10037548
650 Ga0105237_11686613
651 Ga0105237_12787059
652 Ga0105238_10005677
653 Ga0105238_10231206
654 Ga0105238_10584315
655 Ga0105238_11337620
656 Ga0105249_10109013
657 Ga0105249_10148248
658 Ga0105249_11012882
659 Ga0105249_13325941
660 Ga0105032_112950
661 Ga0105147_118416
662 Ga0105239_10042734
663 Ga0105239_10112214
664 Ga0105239_10556712
665 Ga0105246_10143551
666 Ga0157323_1040051
667 Ga0157373_10631182
668 Ga0157373_10775209
669 Ga0157371_10623361
670 Ga0157370_10129722
671 Ga0157370_10357030
672 Ga0157369_10266830
673 Ga0157374_10116706
674 Ga0157374_10584970
675 Ga0157374_10844679
676 Ga0157374_12804181
677 Ga0157378_10057235
678 Ga0157378_10108212
679 Ga0163162_10121255
680 Ga0163162_10278456
681 Ga0163162_10485455
682 Ga0157372_11653570
683 Ga0157372_11911020
684 Ga0157375_10537161
685 Ga0163163_10201310
686 Ga0157380_10032288
687 Ga0157380_10249483
688 Ga0157380_10580580
689 Ga0157380_11684510
690 Ga0182008_10337280
691 Ga0157377_10189297
692 Ga0157379_10596889
693 Ga0157376_10012401
694 Ga0157376_10735642
695 Ga0157376_11817275
696 Ga0182006_1137225
697 Ga0182007_10015599
698 Ga0163161_10220992
699 Ga0163161_10947222
700 Ga0209758_1002075
701 Ga0209758_1058436
702 Ga0209050_1027819
703 Ga0207682_10464194
704 Ga0207692_10394426
705 Ga0207642_10006366
706 Ga0207642_10321997
707 Ga0207642_10687368
708 Ga0207688_10070385
709 Ga0207680_10560711
710 Ga0207645_10205961
711 Ga0207643_10813042
712 Ga0207705_10531063
713 Ga0207654_10089468
714 Ga0207654_10916250
715 Ga0207695_10021093
716 Ga0207695_10126406
717 Ga0207695_10852897
718 Ga0207695_11373592
719 Ga0207671_10184227
720 Ga0207671_10450838
721 Ga0207671_10498357
722 Ga0207671_10523760
723 Ga0207693_10046491
724 Ga0207663_10007792
725 Ga0207660_10947245
726 Ga0207662_10053240
727 Ga0207657_10047455
728 Ga0207657_10244494
729 Ga0207657_10711008
730 Ga0207652_11885312
731 Ga0207694_10002086
732 Ga0207694_10078737
733 Ga0207694_10216853
734 Ga0207694_10396313
735 Ga0207694_10397259
736 Ga0207659_10899197
737 Ga0207687_10067976
738 Ga0207644_10485175
739 Ga0207644_10591695
740 Ga0207644_11131467
741 Ga0207690_10118756
742 Ga0207690_10287267
743 Ga0207706_10107095
744 Ga0207706_10423026
745 Ga0207686_10092595
746 Ga0207686_10136040
747 Ga0207686_11298849
748 Ga0207709_10004629
749 Ga0207709_10119692
750 Ga0207709_10568892
751 Ga0207670_10780790
752 Ga0207670_11287876
753 Ga0207669_10223853
754 Ga0207669_10258704
755 Ga0207704_10150726
756 Ga0207704_10277882
757 Ga0207704_10384468
758 Ga0207665_10250061
759 Ga0207691_10277528
760 Ga0207711_10031436
761 Ga0207689_10044043
762 Ga0207689_10284253
763 Ga0207661_10524333
764 Ga0207667_10313479
765 Ga0207651_10164868
766 Ga0207712_10043150
767 Ga0207712_10077322
768 Ga0207668_10164439
769 Ga0207668_10870783
770 Ga0207668_12101076
771 Ga0207640_11629811
772 Ga0207658_10145152
773 Ga0207658_10579501
774 Ga0207677_10404264
775 Ga0207677_11937300
776 Ga0207703_10155191
777 Ga0207703_10377836
778 Ga0207639_10238826
779 Ga0207639_11467974
780 Ga0207678_10064783
781 Ga0207678_10108090
782 Ga0207708_10035930
783 Ga0207708_10336795
784 Ga0207641_10251637
785 Ga0207648_10046951
786 Ga0207648_10070724
787 Ga0207648_10925441
788 Ga0207674_10116129
789 Ga0207674_11041653
790 Ga0207674_11414429
791 Ga0207674_11416719
792 Ga0207675_100013762
793 Ga0207675_100065880
794 Ga0207675_100288294
795 Ga0207675_102749366
796 Ga0207683_10343453
797 Ga0207698_10259838
798 Ga0268266_10006419
799 Ga0268266_10020976
800 Ga0268266_10129399
801 Ga0268266_10140151
802 Ga0268266_10210379
803 Ga0268266_10825754
804 Ga0268266_11911591
805 Ga0268265_10187052
806 Ga0268265_10558833
807 Ga0268265_11014828
808 Ga0268265_11078818
809 Ga0268265_11707964
810 Ga0268264_10058271
811 Ga0307515_10343602
812 Ga0265762_1012640
813 Ga0265767_101030
814 Ga0265769_101344
815 Ga0265327_10342821
816 Ga0307513_10759978
817 Ga0307508_10292923
818 Ga0307413_10537799
819 Ga0307410_10766022
820 Ga0307410_10897356
821 Ga0307407_10101472
822 Ga0307412_12117609
823 Ga0307409_100077558
824 Ga0307416_101445737
825 Ga0307411_10434371
826 Ga0307415_100057100
827 Ga0307415_100094396
828 Ga0373928_0124362
829 Ga0373946_0027302
830 Ga0373955_0663130
831 Ga0373927_0028529
832 Ga0373927_0071145
833 Ga0373927_0271301
834 Ga0373947_0359214
835 Ga0373937_1210502
836 Ga0373925_0061369
837 Ga0395899_0006167
838 Ga0395898_0347218
839 Ga0395905_0178248
840 Ga0395905_0543896
841 Ga0395905_0949619
842 Ga0436365_0745075
843 Ga0436365_1582635
844 Ga0451791_0708923
845 Ga0451807_1399357
846 Ga0451807_2208103
847 Ga0451839_0720008
848 Ga0451839_1403038
849 Ga0439448_0000483
850 Ga0439448_0027417
851 Ga0439455_0000132
852 Ga0439455_0128893
853 Ga0439458_0000070
854 Ga0439458_0001316
855 Ga0451576_1804878
856 Ga0495603_0017379
857 Ga0495603_0369330
858 Ga0495638_0112248
859 Ga0495641_0074480
860 Ga0495641_0188973
861 Ga0495580_0304147
862 Ga0495662_0250864
863 Ga0495584_0305801
864 Ga0495585_0122797
865 Ga0495594_0612759
866 Ga0495606_0043493
867 Ga0495608_0328377
868 Ga0495628_0534000
869 Ga0495631_0110916
870 Ga0495644_0347431
871 Ga0495652_1058371
872 Ga0495621_0069103
873 Ga0495622_0009564
874 Ga0495622_0169880
875 Ga0495633_0086970
876 Ga0495656_0015482
877 Ga0495656_0058263
878 Ga0495634_0152498
879 Ga0495634_0428123
880 Ga0495611_0318009
881 Ga0495625_0359052
882 Ga0495635_0131543
883 Ga0495659_0009877
884 Ga0495588_0031165
885 Ga0495588_0247459
886 Ga0495588_0609965
887 Ga0495599_0191142
888 Ga0495623_0586715
889 Ga0495647_0048040
890 Ga0495669_0020349
891 Ga0495670_0032088
892 Ga0495671_0060724
893 Ga0495671_0605353
894 Ga0495649_0092101
895 Ga0495649_0643011
896 Ga0495589_0545077
897 Ga0495600_0085826
898 Ga0495600_0718225
899 Ga0495636_0059154
900 Ga0495636_0096106
901 Ga0495674_0727293
902 Ga0495676_0218594
903 Ga0495686_0069718
904 Ga0495602_0229601
905 Ga0495615_0051144
906 Ga0495615_0253667
907 Ga0496100_0021161
908 Ga0496101_0185491
909 Ga0496106_0079672
910 Ga0496107_0163706
911 Ga0496107_0232491
912 Ga0496109_1516795
913 Ga0496110_1539390
914 Ga0496114_0742918
915 Ga0496115_0034410
916 Ga0496115_0466052
917 Ga0496115_0643351
918 Ga0496121_0001026
919 Ga0496121_0133051
920 Ga0496123_0040309
921 Ga0496126_0008559
922 Ga0496126_0012135
923 Ga0496126_0061289
924 Ga0496126_0456806
925 Ga0496126_1078077
926 Ga0501032_0002111
927 Ga0501032_0830269
928 Ga0501033_0004856
929 Ga0501033_0011028
930 Ga0501033_0064089
931 Ga0501033_0757495
932 Ga0501034_0023239
933 Ga0501034_0153805
934 Ga0501034_0600022
935 Ga0501036_0001296
936 Ga0501036_0644409
937 Ga0501037_0026800
938 Ga0501037_0110985
939 Ga0501038_0049173
940 Ga0501038_0107431
941 Ga0501038_0216155
942 Ga0501038_1121971
943 Ga0501039_0034057
944 Ga0501040_0662234
945 Ga0501042_0056436
946 Ga0501043_0034562
947 Ga0501043_0105808
948 Ga0501046_0349147
949 Ga0501047_0014662
950 Ga0501047_0324190
951 Ga0501047_0998907
952 Ga0501048_0013508
953 Ga0501067_0004265
954 Ga0501068_0042539
955 Ga0501069_0060993
956 Ga0501070_0037463
957 Ga0501070_0335521
958 Ga0501072_0224750
959 Ga0501073_0011915
960 Ga0501073_0076204
961 Ga0501074_0001757
962 Ga0501080_0024486
963 Ga0501080_0308805
964 Ga0501083_0020020
965 Ga0501083_0047050
966 Ga0501035_0056060
967 Ga0501035_0169545
968 Ga0501035_0712395
969 Ga0501044_0077031
970 Ga0501044_0099561
971 Ga0501044_1482916
972 Ga0501045_0517538
973 nmdc:mga03683_30552_c1
974 nmdc:mga03n38_193970_c1
975 nmdc:mga00v17_33007_c1
976 nmdc:mga00v17_999501_c1
977 nmdc:mga0yw44_45368_c1
978 nmdc:mga0k408_130823_c1
979 nmdc:mga0k408_940371_c1
980 nmdc:mga06z11_130940_c1
981 nmdc:mga07m45_296716_c1
982 nmdc:mga05p37_176084_c1
983 nmdc:mga09592_189412_c1
984 nmdc:mga0qj67_1356607_c1
985 nmdc:mga08y16_1700964_c1
986 nmdc:mga0n895_1802345_c1
987 nmdc:mga0n895_481743_c1
988 Ga0495619_0928055
989 Ga0500643_037546
990 Ga0500562_065561
991 Ga0500595_024686
992 Ga0500595_083735
993 Ga0500573_0000004
994 Ga0501084_0002143
995 Ga0501084_0452620
996 Ga0501082_0074577
997 2644126294
998 2738720520
999 2739279719
1000 2824765000
1001 2842776704
1002 2879117099
1003 2895399014
1004 2904715999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

37

104

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9161 3 103
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8992 3 103
6tbm-assembly1.cif.gz_Q structure of saga bound to tbp, including spt8 and dub 0.7718 19 85
4zux-assembly1.cif.gz_Z saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome 0.7644 19 86
4zux-assembly2.cif.gz_j saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome 0.7603 34 90
ID Description Score Start End Superfamily
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9161 34 86 3.30.40.10
af_Q7Z569_302_376_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.911 34 86 3.30.40.10
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9086 34 86 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9043 3 88 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8895 34 85 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A536AU09-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9719 37 88 GO:0008270
AF-A0A7W0S772-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9694 33 88 GO:0008270
AF-A0A1H3IX77-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9687 33 86 GO:0008270
GO:0016787
AF-A0A829QKN3-F1-model_v4 Zn-finger in ubiquitin-hydrolases and other family protein 0.9668 32 86 GO:0008270
GO:0016787
AF-A0A529SVC8-F1-model_v4 UBP-type domain-containing protein 0.9642 34 103 GO:0008270

Map