F455890

General Info

Members Datasets Scaffolds Average Seq Length
502 219 1004 363

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0001559|Ga0451577_0001559_11397_12599
Length 400
Sequence MDGVLRKSDKIRALVKMNETNLISLIFIELGLAVIGLALLARLASRWGFSAIPLYLLGGLSFGEGGLLPLNFSEDFIHVGAEIGVLLLLFMLGLEYTGSDLKQALRQGWLSGVVDFLLNFPPGFICGLLLGWTPLEALLLGGVTYISSSGVIAKVLSEIGRMNSLETPVILSILVIEDLAMAAYLPLVAVLLIGQSWSTGLASVLIALLTVGIVLFVAVRYGSDISRVIAHESNEIILLTTFGMILLVAGVAQRFQVSAAIGAFLVGIALSGPIAERTHHLISPLRDLFAATFFFFFGLQIDPSTLPPVLLLAVGLGLVTAITKILTGWWAARRAGIGNAGQLRAGSSLVARGEFSIVIAGLGVNAGLNPQIGSLATAYVLFLVILGPVLSRLASDRLER

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.79
Rhizosphere 96.41
Stem 0
Stem Tuber 0
Unclassified 8.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0001559 3300042876 Bacteria 30052
2 SwRhRL2b_contig_63288 2162886007 Bacteria 3022
3 JGI24743J22301_10001763 3300001991 Bacteria 3100
4 Ga0065704_10000323 3300005289 Bacteria 40015
5 Ga0065707_10000508 3300005295 Bacteria 28121
6 Ga0070658_10019552 3300005327 Bacteria 5423
7 Ga0070658_10026964 3300005327 Bacteria 4613
8 Ga0070658_10062068 3300005327 Bacteria 3046
9 Ga0070683_100052010 3300005329 Bacteria 3794
10 Ga0070683_100053965 3300005329 Bacteria 3725
11 Ga0070683_100071018 3300005329 Bacteria 3248
12 Ga0068869_100029502 3300005334 Bacteria 3844
13 Ga0068869_100086115 3300005334 Bacteria 2355
14 Ga0070666_10046674 3300005335 Bacteria 2906
15 Ga0070666_10054247 3300005335 Bacteria 2704
16 Ga0070680_100008641 3300005336 Bacteria 7807
17 Ga0068868_100000461 3300005338 Bacteria 27056
18 Ga0068868_100003784 3300005338 Bacteria 10565
19 Ga0070660_100107337 3300005339 Bacteria 2218
20 Ga0070660_100268472 3300005339 Bacteria 1394
21 Ga0070661_100032956 3300005344 Bacteria 3753
22 Ga0070668_100311602 3300005347 Bacteria 1323
23 Ga0070675_100045990 3300005354 Bacteria 3573
24 Ga0070671_100010327 3300005355 Bacteria 7491
25 Ga0070659_100106662 3300005366 Bacteria 2258
26 Ga0070667_100000697 3300005367 Bacteria 32386
27 Ga0070709_10004930 3300005434 Bacteria 7208
28 Ga0070709_10072002 3300005434 Unclassified 2233
29 Ga0070713_100000056 3300005436 Bacteria 70579
30 Ga0070713_100114209 3300005436 Bacteria 2359
31 Ga0070713_100368425 3300005436 Bacteria 1336
32 Ga0070710_10018241 3300005437 Bacteria 3607
33 Ga0070711_100052017 3300005439 Bacteria 2817
34 Ga0070708_100009807 3300005445 Bacteria 7732
35 Ga0070708_100099224 3300005445 Bacteria 2664
36 Ga0070708_100125893 3300005445 Bacteria 2368
37 Ga0070678_100013830 3300005456 Bacteria 5072
38 Ga0070662_100066627 3300005457 Bacteria 2642
39 Ga0070681_10010729 3300005458 Bacteria 9053
40 Ga0070681_10032266 3300005458 Bacteria 5256
41 Ga0070681_10153532 3300005458 Bacteria 2228
42 Ga0070685_10092163 3300005466 Bacteria 1836
43 Ga0070706_100000294 3300005467 Bacteria 60750
44 Ga0070706_100002676 3300005467 Bacteria 17847
45 Ga0070707_100004419 3300005468 Bacteria 13171
46 Ga0070707_100353367 3300005468 Bacteria 1427
47 Ga0070698_100004471 3300005471 Bacteria 15368
48 Ga0070698_100080087 3300005471 Bacteria 3261
49 Ga0070698_100290975 3300005471 Bacteria 1565
50 Ga0070699_100001253 3300005518 Bacteria 23411
51 Ga0070699_100306351 3300005518 Bacteria 1425
52 Ga0070679_100026301 3300005530 Bacteria 5715
53 Ga0070679_100100087 3300005530 Bacteria 2886
54 Ga0070684_100001033 3300005535 Bacteria 19861
55 Ga0070684_100082878 3300005535 Bacteria 2841
56 Ga0070684_100209670 3300005535 Unclassified 1776
57 Ga0070684_100286469 3300005535 Bacteria 1510
58 Ga0070697_100074375 3300005536 Bacteria 2791
59 Ga0070697_100088229 3300005536 Unclassified 2561
60 Ga0070697_100144024 3300005536 Unclassified 2005
61 Ga0068853_100000522 3300005539 Bacteria 26003
62 Ga0068853_100023674 3300005539 Bacteria 5144
63 Ga0068853_100033592 3300005539 Bacteria 4353
64 Ga0068853_100080268 3300005539 Bacteria 2854
65 Ga0070672_100021776 3300005543 Bacteria 4695
66 Ga0070695_100031967 3300005545 Bacteria 3288
67 Ga0070665_100000247 3300005548 Bacteria 89526
68 Ga0070665_100003636 3300005548 Bacteria 16336
69 Ga0070665_100027800 3300005548 Bacteria 5695
70 Ga0070665_100071604 3300005548 Bacteria 3473
71 Ga0070665_100124781 3300005548 Bacteria 2577
72 Ga0070704_100013895 3300005549 Bacteria 5015
73 Ga0068855_100022533 3300005563 Bacteria 7548
74 Ga0068855_100045496 3300005563 Bacteria 5192
75 Ga0068855_100046794 3300005563 Bacteria 5113
76 Ga0068855_100056905 3300005563 Bacteria 4585
77 Ga0068855_100068363 3300005563 Bacteria 4136
78 Ga0068855_100145322 3300005563 Bacteria 2700
79 Ga0068855_100194852 3300005563 Bacteria 2283
80 Ga0068855_100286913 3300005563 Bacteria 1826
81 Ga0070664_100112276 3300005564 Bacteria 2380
82 Ga0068857_100176090 3300005577 Bacteria 1946
83 Ga0068854_100077800 3300005578 Unclassified 2442
84 Ga0068854_100102942 3300005578 Bacteria 2143
85 Ga0068854_100135762 3300005578 Bacteria 1883
86 Ga0068856_100008209 3300005614 Bacteria 10179
87 Ga0068856_100025794 3300005614 Bacteria 5731
88 Ga0068856_100035027 3300005614 Bacteria 4919
89 Ga0068856_100038471 3300005614 Bacteria 4696
90 Ga0068856_100161006 3300005614 Bacteria 2255
91 Ga0068856_100168516 3300005614 Bacteria 2201
92 Ga0068852_100000196 3300005616 Bacteria 41295
93 Ga0068852_100000652 3300005616 Bacteria 22725
94 Ga0068852_100024079 3300005616 Unclassified 4914
95 Ga0068852_100054745 3300005616 Bacteria 3440
96 Ga0068852_100141632 3300005616 Bacteria 2226
97 Ga0068859_100002902 3300005617 Bacteria 17413
98 Ga0068864_100009376 3300005618 Bacteria 8075
99 Ga0068864_100400270 3300005618 Bacteria 1305
100 Ga0068851_10010417 3300005834 Bacteria 4341
101 Ga0068851_10013047 3300005834 Bacteria 3928
102 Ga0068851_10055072 3300005834 Bacteria 2026
103 Ga0068863_100002058 3300005841 Bacteria 19927
104 Ga0068863_100046439 3300005841 Unclassified 4122
105 Ga0068863_100254257 3300005841 Bacteria 1698
106 Ga0068858_100009230 3300005842 Bacteria 9416
107 Ga0068858_100147380 3300005842 Bacteria 2211
108 Ga0068860_100000799 3300005843 Bacteria 35326
109 Ga0068860_100133674 3300005843 Bacteria 2382
110 Ga0068862_100147878 3300005844 Bacteria 2089
111 Ga0081455_10028200 3300005937 Bacteria 5132
112 Ga0070717_10001697 3300006028 Bacteria 15333
113 Ga0070716_100005153 3300006173 Bacteria 6317
114 Ga0070716_100032595 3300006173 Bacteria 2843
115 Ga0070716_100035097 3300006173 Bacteria 2755
116 Ga0070716_100079747 3300006173 Bacteria 1950
117 Ga0070712_100007957 3300006175 Bacteria 6646
118 Ga0097621_100011717 3300006237 Bacteria 6473
119 Ga0097621_100025953 3300006237 Unclassified 4591
120 Ga0097621_100029169 3300006237 Bacteria 4356
121 Ga0097621_100034336 3300006237 Bacteria 4046
122 Ga0097621_100144692 3300006237 Bacteria 2034
123 Ga0097621_100170711 3300006237 Bacteria 1874
124 Ga0068871_100002720 3300006358 Bacteria 12065
125 Ga0068871_100082414 3300006358 Unclassified 2667
126 Ga0068871_100128133 3300006358 Unclassified 2150
127 Ga0068871_100219196 3300006358 Bacteria 1648
128 Ga0075433_10021757 3300006852 Bacteria 5380
129 Ga0075433_10041450 3300006852 Bacteria 3989
130 Ga0075434_100472861 3300006871 Bacteria 1275
131 Ga0068865_100031172 3300006881 Bacteria 3553
132 Ga0075436_100001746 3300006914 Bacteria 14889
133 Ga0075436_100005025 3300006914 Bacteria 9091
134 Ga0097620_100002902 3300006931 Bacteria 17413
135 Ga0075435_100110578 3300007076 Bacteria 2285
136 Ga0099794_10003659 3300007265 Bacteria 5909
137 Ga0105240_10000455 3300009093 Bacteria 75347
138 Ga0105240_10000999 3300009093 Bacteria 50504
139 Ga0105240_10005128 3300009093 Bacteria 19597
140 Ga0105240_10006218 3300009093 Bacteria 17560
141 Ga0105240_10018556 3300009093 Bacteria 9337
142 Ga0105240_10018977 3300009093 Bacteria 9208
143 Ga0105240_10044792 3300009093 Bacteria 5617
144 Ga0105240_10048562 3300009093 Bacteria 5363
145 Ga0105240_10055815 3300009093 Bacteria 4945
146 Ga0105240_10114303 3300009093 Bacteria 3261
147 Ga0105240_10132972 3300009093 Bacteria 2981
148 Ga0105245_10001817 3300009098 Bacteria 19412
149 Ga0105245_10002065 3300009098 Bacteria 18223
150 Ga0105245_10036709 3300009098 Unclassified 4354
151 Ga0105245_10047796 3300009098 Bacteria 3826
152 Ga0105245_10057120 3300009098 Bacteria 3509
153 Ga0105247_10057252 3300009101 Bacteria 2409
154 Ga0105247_10084677 3300009101 Bacteria 2003
155 Ga0114129_10033008 3300009147 Bacteria 7316
156 Ga0105243_10018884 3300009148 Bacteria 5227
157 Ga0105241_10000033 3300009174 Bacteria 118315
158 Ga0105241_10000754 3300009174 Bacteria 24666
159 Ga0105241_10000806 3300009174 Bacteria 23821
160 Ga0105241_10016788 3300009174 Bacteria 5373
161 Ga0105241_10043281 3300009174 Unclassified 3410
162 Ga0105241_10043484 3300009174 Unclassified 3403
163 Ga0105241_10140735 3300009174 Unclassified 1964
164 Ga0105241_10239630 3300009174 Bacteria 1533
165 Ga0105242_10019818 3300009176 Bacteria 5270
166 Ga0105242_10025337 3300009176 Bacteria 4694
167 Ga0105248_10007230 3300009177 Bacteria 12180
168 Ga0105248_10133256 3300009177 Bacteria 2803
169 Ga0105248_10171139 3300009177 Bacteria 2448
170 Ga0105237_10005153 3300009545 Bacteria 14792
171 Ga0105237_10012019 3300009545 Bacteria 9144
172 Ga0105237_10029746 3300009545 Bacteria 5550
173 Ga0105237_10082919 3300009545 Bacteria 3197
174 Ga0105237_10159691 3300009545 Bacteria 2252
175 Ga0105237_10160868 3300009545 Bacteria 2244
176 Ga0105237_10297174 3300009545 Bacteria 1618
177 Ga0105237_10387433 3300009545 Bacteria 1402
178 Ga0105238_10001397 3300009551 Bacteria 24222
179 Ga0105238_10002903 3300009551 Bacteria 17123
180 Ga0105238_10015728 3300009551 Bacteria 7660
181 Ga0105238_10017523 3300009551 Bacteria 7283
182 Ga0105238_10029474 3300009551 Bacteria 5590
183 Ga0105238_10075728 3300009551 Bacteria 3356
184 Ga0105238_10076000 3300009551 Bacteria 3350
185 Ga0105238_10102280 3300009551 Plasmid 2847
186 Ga0105238_10144898 3300009551 Bacteria 2352
187 Ga0105238_10171481 3300009551 Bacteria 2146
188 Ga0105249_10058506 3300009553 Bacteria 3532
189 Ga0105249_10147005 3300009553 Bacteria 2265
190 Ga0105239_10006901 3300010375 Bacteria 13098
191 Ga0105239_10019975 3300010375 Bacteria 7393
192 Ga0105239_10037584 3300010375 Bacteria 5305
193 Ga0105239_10088053 3300010375 Bacteria 3423
194 Ga0105239_10258077 3300010375 Bacteria 1958
195 Ga0105239_10449530 3300010375 Bacteria 1462
196 Ga0105239_10551941 3300010375 Bacteria 1312
197 Ga0105246_10001839 3300011119 Bacteria 12730
198 Ga0157373_10080326 3300013100 Bacteria 2300
199 Ga0157373_10141164 3300013100 Bacteria 1694
200 Ga0157371_10050408 3300013102 Bacteria 2958
201 Ga0157370_10000003 3300013104 Bacteria 367417
202 Ga0157370_10006070 3300013104 Bacteria 13408
203 Ga0157370_10015406 3300013104 Bacteria 7771
204 Ga0157370_10047830 3300013104 Bacteria 4099
205 Ga0157370_10108207 3300013104 Unclassified 2600
206 Ga0157370_10146744 3300013104 Unclassified 2196
207 Ga0157369_10000245 3300013105 Bacteria 75320
208 Ga0157369_10007547 3300013105 Bacteria 12515
209 Ga0157369_10016125 3300013105 Bacteria 8409
210 Ga0157369_10024479 3300013105 Bacteria 6715
211 Ga0157369_10064585 3300013105 Unclassified 3942
212 Ga0157369_10066130 3300013105 Unclassified 3889
213 Ga0157369_10128503 3300013105 Unclassified 2686
214 Ga0157369_10161683 3300013105 Bacteria 2364
215 Ga0157374_10003353 3300013296 Bacteria 13447
216 Ga0157374_10007187 3300013296 Bacteria 9486
217 Ga0157374_10015471 3300013296 Bacteria 6691
218 Ga0157374_10017130 3300013296 Bacteria 6377
219 Ga0157374_10031061 3300013296 Bacteria 4851
220 Ga0157374_10059536 3300013296 Bacteria 3572
221 Ga0157374_10140930 3300013296 Bacteria 2340
222 Ga0157374_10254338 3300013296 Unclassified 1729
223 Ga0157378_10022753 3300013297 Bacteria 5515
224 Ga0157378_10024894 3300013297 Bacteria 5272
225 Ga0157378_10032886 3300013297 Bacteria 4584
226 Ga0163162_10064283 3300013306 Bacteria 3714
227 Ga0163162_10111682 3300013306 Unclassified 2831
228 Ga0163162_10117985 3300013306 Bacteria 2755
229 Ga0157372_10002286 3300013307 Bacteria 20767
230 Ga0157372_10028656 3300013307 Bacteria 6079
231 Ga0157372_10058456 3300013307 Bacteria 4311
232 Ga0157372_10062659 3300013307 Bacteria 4167
233 Ga0157372_10083411 3300013307 Bacteria 3620
234 Ga0157372_10163307 3300013307 Bacteria 2574
235 Ga0157372_10221636 3300013307 Bacteria 2192
236 Ga0157372_10352601 3300013307 Unclassified 1714
237 Ga0157372_10379981 3300013307 Bacteria 1646
238 Ga0157375_10040969 3300013308 Bacteria 4469
239 Ga0157375_10074922 3300013308 Bacteria 3407
240 Ga0157375_10525137 3300013308 Bacteria 1347
241 Ga0163163_10005806 3300014325 Bacteria 10723
242 Ga0163163_10052661 3300014325 Bacteria 4016
243 Ga0163163_10075264 3300014325 Bacteria 3370
244 Ga0157379_10001970 3300014968 Bacteria 16995
245 Ga0157379_10159386 3300014968 Bacteria 2037
246 Ga0157379_10166455 3300014968 Bacteria 1990
247 Ga0157376_10030303 3300014969 Bacteria 4319
248 Ga0157376_10078814 3300014969 Bacteria 2822
249 Ga0157376_10091333 3300014969 Bacteria 2637
250 Ga0157376_10203991 3300014969 Bacteria 1821
251 Ga0157376_10379718 3300014969 Bacteria 1361
252 Ga0182006_1049325 3300015261 Bacteria 1625
253 Ga0213872_10001140 3300021361 Bacteria 18158
254 Ga0213872_10003814 3300021361 Bacteria 8212
255 Ga0213872_10022239 3300021361 Bacteria 2920
256 Ga0213872_10043363 3300021361 Unclassified 2050
257 Ga0213876_10036427 3300021384 Unclassified 2594
258 Ga0213876_10075695 3300021384 Bacteria 1778
259 Ga0213871_10012469 3300021441 Bacteria 1976
260 Ga0224572_1001023 3300024225 Bacteria 3880
261 Ga0228598_1000041 3300024227 Bacteria 18143
262 Ga0207656_10021514 3300025321 Bacteria 2579
263 Ga0207656_10094808 3300025321 Unclassified 1360
264 Ga0207692_10044496 3300025898 Bacteria 2215
265 Ga0207710_10006457 3300025900 Bacteria 5006
266 Ga0207647_10022492 3300025904 Bacteria 4185
267 Ga0207647_10027843 3300025904 Bacteria 3680
268 Ga0207685_10036279 3300025905 Bacteria 1806
269 Ga0207699_10005656 3300025906 Bacteria 6001
270 Ga0207705_10012031 3300025909 Bacteria 6252
271 Ga0207705_10073849 3300025909 Bacteria 2475
272 Ga0207684_10000050 3300025910 Bacteria 239602
273 Ga0207684_10002245 3300025910 Bacteria 19691
274 Ga0207684_10028457 3300025910 Bacteria 4762
275 Ga0207654_10000162 3300025911 Bacteria 42927
276 Ga0207654_10000415 3300025911 Bacteria 24454
277 Ga0207654_10002528 3300025911 Bacteria 9285
278 Ga0207654_10096861 3300025911 Unclassified 1810
279 Ga0207707_10009835 3300025912 Bacteria 8294
280 Ga0207707_10140262 3300025912 Bacteria 2114
281 Ga0207695_10000030 3300025913 Bacteria 533735
282 Ga0207695_10000129 3300025913 Bacteria 225939
283 Ga0207695_10000537 3300025913 Bacteria 79113
284 Ga0207695_10000656 3300025913 Bacteria 68421
285 Ga0207695_10005442 3300025913 Bacteria 16885
286 Ga0207695_10026033 3300025913 Bacteria 6535
287 Ga0207695_10033309 3300025913 Bacteria 5621
288 Ga0207695_10072169 3300025913 Bacteria 3524
289 Ga0207695_10079137 3300025913 Bacteria 3333
290 Ga0207695_10128980 3300025913 Bacteria 2488
291 Ga0207695_10148461 3300025913 Bacteria 2285
292 Ga0207671_10001457 3300025914 Bacteria 27329
293 Ga0207671_10001529 3300025914 Bacteria 26530
294 Ga0207671_10007391 3300025914 Bacteria 9540
295 Ga0207671_10052418 3300025914 Bacteria 3023
296 Ga0207671_10145198 3300025914 Bacteria 1830
297 Ga0207693_10000029 3300025915 Bacteria 118724
298 Ga0207663_10038987 3300025916 Bacteria 2876
299 Ga0207660_10004632 3300025917 Bacteria 8963
300 Ga0207657_10001275 3300025919 Bacteria 26846
301 Ga0207657_10113476 3300025919 Bacteria 2236
302 Ga0207649_10016758 3300025920 Bacteria 4142
303 Ga0207649_10026207 3300025920 Bacteria 3408
304 Ga0207652_10069927 3300025921 Bacteria 3048
305 Ga0207652_10089486 3300025921 Bacteria 2703
306 Ga0207652_10116604 3300025921 Bacteria 2372
307 Ga0207646_10003135 3300025922 Bacteria 18953
308 Ga0207646_10170464 3300025922 Bacteria 1965
309 Ga0207646_10214700 3300025922 Bacteria 1737
310 Ga0207694_10000137 3300025924 Bacteria 74746
311 Ga0207694_10000326 3300025924 Bacteria 44764
312 Ga0207694_10000639 3300025924 Bacteria 31608
313 Ga0207694_10029038 3300025924 Unclassified 4218
314 Ga0207694_10044969 3300025924 Bacteria 3410
315 Ga0207694_10089994 3300025924 Bacteria 2421
316 Ga0207694_10190412 3300025924 Bacteria 1666
317 Ga0207687_10003796 3300025927 Bacteria 10154
318 Ga0207687_10006151 3300025927 Bacteria 7941
319 Ga0207687_10029811 3300025927 Bacteria 3672
320 Ga0207687_10034971 3300025927 Bacteria 3415
321 Ga0207687_10036585 3300025927 Unclassified 3344
322 Ga0207687_10059398 3300025927 Bacteria 2694
323 Ga0207700_10000826 3300025928 Bacteria 17905
324 Ga0207700_10013634 3300025928 Bacteria 5296
325 Ga0207706_10093207 3300025933 Bacteria 2649
326 Ga0207686_10015624 3300025934 Bacteria 4247
327 Ga0207686_10058531 3300025934 Bacteria 2430
328 Ga0207665_10003788 3300025939 Bacteria 10104
329 Ga0207665_10008065 3300025939 Bacteria 6950
330 Ga0207665_10024333 3300025939 Bacteria 3992
331 Ga0207691_10092177 3300025940 Bacteria 2713
332 Ga0207711_10010249 3300025941 Bacteria 7781
333 Ga0207711_10229388 3300025941 Bacteria 1700
334 Ga0207689_10073917 3300025942 Bacteria 2801
335 Ga0207661_10017410 3300025944 Bacteria 5318
336 Ga0207661_10019747 3300025944 Bacteria 5029
337 Ga0207661_10200055 3300025944 Bacteria 1756
338 Ga0207679_10104797 3300025945 Bacteria 2220
339 Ga0207679_10300024 3300025945 Bacteria 1384
340 Ga0207667_10004248 3300025949 Bacteria 17580
341 Ga0207667_10006140 3300025949 Bacteria 14594
342 Ga0207667_10042186 3300025949 Bacteria 4851
343 Ga0207667_10073525 3300025949 Bacteria 3552
344 Ga0207667_10320758 3300025949 Bacteria 1582
345 Ga0207667_10341716 3300025949 Bacteria 1527
346 Ga0207640_10021630 3300025981 Unclassified 3837
347 Ga0207640_10121316 3300025981 Bacteria 1873
348 Ga0207640_10153202 3300025981 Bacteria 1696
349 Ga0207640_10236041 3300025981 Bacteria 1410
350 Ga0207658_10000602 3300025986 Bacteria 32058
351 Ga0207658_10146618 3300025986 Unclassified 1918
352 Ga0207677_10000348 3300026023 Bacteria 32440
353 Ga0207703_10011291 3300026035 Bacteria 6946
354 Ga0207703_10013275 3300026035 Bacteria 6417
355 Ga0207703_10019097 3300026035 Bacteria 5355
356 Ga0207639_10000474 3300026041 Bacteria 27758
357 Ga0207639_10012341 3300026041 Bacteria 5949
358 Ga0207639_10079791 3300026041 Bacteria 2587
359 Ga0207639_10205760 3300026041 Bacteria 1691
360 Ga0207678_10046071 3300026067 Bacteria 3771
361 Ga0207678_10118786 3300026067 Bacteria 2256
362 Ga0207702_10004138 3300026078 Bacteria 13004
363 Ga0207702_10007762 3300026078 Bacteria 9108
364 Ga0207702_10058204 3300026078 Bacteria 3288
365 Ga0207702_10133319 3300026078 Bacteria 2238
366 Ga0207702_10209275 3300026078 Bacteria 1812
367 Ga0207702_10252170 3300026078 Unclassified 1658
368 Ga0207648_10186989 3300026089 Bacteria 1835
369 Ga0207676_10006805 3300026095 Bacteria 8092
370 Ga0207674_10003648 3300026116 Bacteria 18770
371 Ga0207675_100414886 3300026118 Bacteria 1329
372 Ga0207683_10007557 3300026121 Bacteria 9314
373 Ga0207698_10000027 3300026142 Bacteria 119295
374 Ga0207698_10000306 3300026142 Bacteria 29445
375 Ga0207698_10006084 3300026142 Bacteria 7508
376 Ga0207698_10084901 3300026142 Bacteria 2568
377 Ga0265354_1003578 3300028016 Bacteria 1725
378 Ga0268266_10004043 3300028379 Bacteria 14175
379 Ga0268266_10007328 3300028379 Bacteria 9968
380 Ga0268266_10057413 3300028379 Bacteria 3349
381 Ga0268266_10129654 3300028379 Unclassified 2254
382 Ga0268264_10000575 3300028381 Bacteria 44492
383 Ga0268264_10097327 3300028381 Bacteria 2550
384 Ga0265314_10001523 3300031711 Bacteria 25583
385 Ga0265342_10089761 3300031712 Unclassified 1763
386 Ga0373926_0003217 3300035083 Bacteria 5244
387 Ga0373929_0000025 3300035085 Bacteria 72734
388 Ga0373943_0000658 3300035170 Bacteria 14980
389 Ga0373943_0030325 3300035170 Bacteria 2558
390 Ga0373946_0006173 3300035171 Bacteria 4341
391 Ga0373955_0003476 3300035172 Bacteria 6924
392 Ga0373955_0045806 3300035172 Unclassified 2362
393 Ga0373924_0079085 3300035410 Bacteria 1397
394 Ga0373935_0001816 3300035692 Bacteria 11990
395 Ga0373935_0021896 3300035692 Bacteria 3914
396 Ga0373927_0000784 3300035695 Bacteria 24262
397 Ga0373927_0073792 3300035695 Bacteria 2209
398 Ga0373927_0077490 3300035695 Bacteria 2153
399 Ga0373947_0001753 3300035725 Bacteria 13269
400 Ga0373947_0003736 3300035725 Bacteria 8987
401 Ga0373947_0038217 3300035725 Bacteria 2850
402 Ga0373947_0052392 3300035725 Unclassified 2458
403 Ga0373937_0007694 3300036401 Bacteria 9341
404 Ga0373925_0005080 3300037068 Bacteria 9848
405 Ga0373925_0010823 3300037068 Bacteria 6615
406 Ga0373925_0086210 3300037068 Bacteria 2395
407 Ga0373925_0223385 3300037068 Unclassified 1504
408 Ga0436365_0285255 3300039437 Bacteria 3016
409 Ga0436365_0765748 3300039437 Bacteria 2607
410 Ga0436360_0830507 3300039438 Bacteria 2690
411 Ga0436360_1216469 3300039438 Bacteria 24173
412 Ga0436361_0012737 3300039447 Bacteria 1840
413 Ga0436361_0144520 3300039447 Bacteria 9102
414 Ga0436361_0381832 3300039447 Bacteria 88698
415 Ga0436361_0634719 3300039447 Bacteria 33284
416 Ga0436361_0977944 3300039447 Bacteria 6442
417 Ga0436362_0178958 3300039453 Bacteria 2513
418 Ga0453683_0014698 3300044673 Bacteria 5080
419 Ga0466966_0123287 3300044684 Bacteria 1591
420 Ga0466963_0007620 3300044694 Bacteria 6459
421 Ga0466963_0039074 3300044694 Bacteria 3107
422 Ga0453684_0004778 3300044712 Bacteria 27943
423 Ga0453684_0022678 3300044712 Bacteria 9301
424 Ga0453684_0069269 3300044712 Bacteria 4476
425 Ga0453684_0105693 3300044712 Bacteria 3433
426 Ga0453684_0124115 3300044712 Bacteria 3111
427 Ga0453684_0181470 3300044712 Bacteria 2471
428 Ga0453684_0240400 3300044712 Unclassified 2085
429 Ga0466959_0063444 3300045049 Bacteria 2683
430 Ga0466967_0050047 3300045976 Bacteria 3657
431 Ga0466967_0290778 3300045976 Bacteria 1570
432 Ga0495580_0030160 3300046472 Bacteria 3929
433 Ga0495580_0041826 3300046472 Unclassified 3267
434 Ga0495580_0067483 3300046472 Bacteria 2503
435 Ga0495580_0081033 3300046472 Bacteria 2262
436 Ga0495580_0137795 3300046472 Bacteria 1692
437 Ga0495580_0142633 3300046472 Bacteria 1660
438 Ga0495582_0019048 3300046473 Unclassified 3756
439 Ga0495582_0038216 3300046473 Bacteria 2641
440 Ga0495662_0088705 3300046476 Bacteria 1507
441 Ga0495594_0024122 3300046499 Bacteria 3265
442 Ga0495630_0011761 3300046517 Bacteria 6343
443 Ga0495666_0101280 3300046526 Bacteria 1357
444 Ga0495652_0088699 3300046529 Bacteria 2534
445 Ga0495665_0091465 3300046531 Bacteria 1599
446 Ga0495665_0108915 3300046531 Bacteria 1453
447 Ga0495640_0029212 3300046533 Bacteria 3962
448 Ga0495587_0071244 3300046536 Bacteria 2022
449 Ga0495667_0138250 3300046559 Bacteria 1570
450 Ga0495635_0073824 3300046663 Bacteria 2337
451 Ga0495635_0221583 3300046663 Bacteria 1279
452 Ga0495657_0074575 3300046675 Bacteria 2208
453 Ga0495657_0240730 3300046675 Unclassified 1092
454 Ga0495623_0018613 3300046679 Bacteria 4485
455 Ga0495658_0108931 3300046683 Bacteria 1663
456 Ga0495613_0127425 3300046689 Bacteria 1824
457 Ga0495581_0021313 3300047315 Bacteria 3758
458 Ga0495604_0085721 3300047317 Bacteria 2350
459 Ga0495604_0202207 3300047317 Bacteria 1377
460 Ga0495674_0015176 3300047319 Bacteria 7205
461 Ga0495675_0004623 3300047444 Bacteria 8359
462 Ga0495602_0137264 3300048088 Bacteria 1941
463 Ga0496101_0160632 3300048904 Bacteria 1723
464 Ga0496103_0187677 3300048906 Bacteria 1329
465 Ga0496104_0064363 3300048907 Unclassified 3478
466 Ga0496105_0015725 3300048908 Bacteria 6038
467 Ga0496106_0084979 3300048909 Bacteria 2436
468 Ga0496108_0000018 3300048911 Bacteria 234917
469 Ga0496108_0013941 3300048911 Bacteria 6555
470 Ga0496109_0276138 3300048912 Bacteria 1583
471 Ga0496112_0100099 3300048915 Bacteria 2868
472 Ga0496112_0339132 3300048915 Bacteria 1446
473 Ga0496113_0000819 3300048916 Bacteria 16211
474 Ga0496113_0132573 3300048916 Bacteria 1956
475 Ga0496115_0110243 3300048918 Bacteria 2261
476 Ga0496115_0205819 3300048918 Bacteria 1625
477 Ga0501031_0082450 3300049568 Bacteria 2096
478 Ga0501032_0004512 3300049569 Bacteria 10477
479 Ga0501033_0004613 3300049570 Bacteria 11032
480 Ga0501036_0000169 3300049572 Bacteria 43136
481 Ga0501046_0002817 3300049580 Bacteria 16196
482 Ga0501047_0419498 3300049581 Bacteria 1170
483 Ga0501048_0009961 3300049582 Bacteria 7115
484 Ga0501068_0000613 3300049584 Bacteria 18149
485 Ga0501069_0008973 3300049585 Bacteria 5276
486 Ga0501072_0000228 3300049588 Bacteria 41400
487 Ga0501074_0002579 3300049590 Bacteria 12651
488 Ga0501077_0030632 3300049593 Bacteria 3423
489 Ga0501083_0025022 3300049744 Bacteria 4134
490 Ga0501035_0007956 3300049822 Bacteria 9891
491 Ga0501035_0303640 3300049822 Bacteria 1344
492 Ga0501044_0000766 3300049823 Bacteria 38886
493 Ga0501044_0040276 3300049823 Bacteria 4870
494 nmdc:mga05p37_22646_c1 3300050507 Bacteria 7619
495 nmdc:mga05p37_26745_c1 3300050507 Bacteria 7016
496 nmdc:mga06r32_91838_c1 3300050510 Bacteria 2967
497 nmdc:mga0n895_33256_c1 3300050512 Bacteria 4954
498 nmdc:mga08x19_9197_c1 3300050514 Bacteria 5900
499 nmdc:mga0a205_24786_c1 3300050515 Bacteria 5707
500 nmdc:mga0a205_32333_c1 3300050515 Bacteria 5017
501 Ga0501084_0028228 3300054114 Bacteria 4689
502 Ga0466962_0047751 3300061719 Bacteria 2046
503 Ga0451577_0001559
504 SwRhRL2b_contig_63288
505 JGI24743J22301_10001763
506 Ga0065704_10000323
507 Ga0065707_10000508
508 Ga0070658_10019552
509 Ga0070658_10026964
510 Ga0070658_10062068
511 Ga0070683_100052010
512 Ga0070683_100053965
513 Ga0070683_100071018
514 Ga0068869_100029502
515 Ga0068869_100086115
516 Ga0070666_10046674
517 Ga0070666_10054247
518 Ga0070680_100008641
519 Ga0068868_100000461
520 Ga0068868_100003784
521 Ga0070660_100107337
522 Ga0070660_100268472
523 Ga0070661_100032956
524 Ga0070668_100311602
525 Ga0070675_100045990
526 Ga0070671_100010327
527 Ga0070659_100106662
528 Ga0070667_100000697
529 Ga0070709_10004930
530 Ga0070709_10072002
531 Ga0070713_100000056
532 Ga0070713_100114209
533 Ga0070713_100368425
534 Ga0070710_10018241
535 Ga0070711_100052017
536 Ga0070708_100009807
537 Ga0070708_100099224
538 Ga0070708_100125893
539 Ga0070678_100013830
540 Ga0070662_100066627
541 Ga0070681_10010729
542 Ga0070681_10032266
543 Ga0070681_10153532
544 Ga0070685_10092163
545 Ga0070706_100000294
546 Ga0070706_100002676
547 Ga0070707_100004419
548 Ga0070707_100353367
549 Ga0070698_100004471
550 Ga0070698_100080087
551 Ga0070698_100290975
552 Ga0070699_100001253
553 Ga0070699_100306351
554 Ga0070679_100026301
555 Ga0070679_100100087
556 Ga0070684_100001033
557 Ga0070684_100082878
558 Ga0070684_100209670
559 Ga0070684_100286469
560 Ga0070697_100074375
561 Ga0070697_100088229
562 Ga0070697_100144024
563 Ga0068853_100000522
564 Ga0068853_100023674
565 Ga0068853_100033592
566 Ga0068853_100080268
567 Ga0070672_100021776
568 Ga0070695_100031967
569 Ga0070665_100000247
570 Ga0070665_100003636
571 Ga0070665_100027800
572 Ga0070665_100071604
573 Ga0070665_100124781
574 Ga0070704_100013895
575 Ga0068855_100022533
576 Ga0068855_100045496
577 Ga0068855_100046794
578 Ga0068855_100056905
579 Ga0068855_100068363
580 Ga0068855_100145322
581 Ga0068855_100194852
582 Ga0068855_100286913
583 Ga0070664_100112276
584 Ga0068857_100176090
585 Ga0068854_100077800
586 Ga0068854_100102942
587 Ga0068854_100135762
588 Ga0068856_100008209
589 Ga0068856_100025794
590 Ga0068856_100035027
591 Ga0068856_100038471
592 Ga0068856_100161006
593 Ga0068856_100168516
594 Ga0068852_100000196
595 Ga0068852_100000652
596 Ga0068852_100024079
597 Ga0068852_100054745
598 Ga0068852_100141632
599 Ga0068859_100002902
600 Ga0068864_100009376
601 Ga0068864_100400270
602 Ga0068851_10010417
603 Ga0068851_10013047
604 Ga0068851_10055072
605 Ga0068863_100002058
606 Ga0068863_100046439
607 Ga0068863_100254257
608 Ga0068858_100009230
609 Ga0068858_100147380
610 Ga0068860_100000799
611 Ga0068860_100133674
612 Ga0068862_100147878
613 Ga0081455_10028200
614 Ga0070717_10001697
615 Ga0070716_100005153
616 Ga0070716_100032595
617 Ga0070716_100035097
618 Ga0070716_100079747
619 Ga0070712_100007957
620 Ga0097621_100011717
621 Ga0097621_100025953
622 Ga0097621_100029169
623 Ga0097621_100034336
624 Ga0097621_100144692
625 Ga0097621_100170711
626 Ga0068871_100002720
627 Ga0068871_100082414
628 Ga0068871_100128133
629 Ga0068871_100219196
630 Ga0075433_10021757
631 Ga0075433_10041450
632 Ga0075434_100472861
633 Ga0068865_100031172
634 Ga0075436_100001746
635 Ga0075436_100005025
636 Ga0097620_100002902
637 Ga0075435_100110578
638 Ga0099794_10003659
639 Ga0105240_10000455
640 Ga0105240_10000999
641 Ga0105240_10005128
642 Ga0105240_10006218
643 Ga0105240_10018556
644 Ga0105240_10018977
645 Ga0105240_10044792
646 Ga0105240_10048562
647 Ga0105240_10055815
648 Ga0105240_10114303
649 Ga0105240_10132972
650 Ga0105245_10001817
651 Ga0105245_10002065
652 Ga0105245_10036709
653 Ga0105245_10047796
654 Ga0105245_10057120
655 Ga0105247_10057252
656 Ga0105247_10084677
657 Ga0114129_10033008
658 Ga0105243_10018884
659 Ga0105241_10000033
660 Ga0105241_10000754
661 Ga0105241_10000806
662 Ga0105241_10016788
663 Ga0105241_10043281
664 Ga0105241_10043484
665 Ga0105241_10140735
666 Ga0105241_10239630
667 Ga0105242_10019818
668 Ga0105242_10025337
669 Ga0105248_10007230
670 Ga0105248_10133256
671 Ga0105248_10171139
672 Ga0105237_10005153
673 Ga0105237_10012019
674 Ga0105237_10029746
675 Ga0105237_10082919
676 Ga0105237_10159691
677 Ga0105237_10160868
678 Ga0105237_10297174
679 Ga0105237_10387433
680 Ga0105238_10001397
681 Ga0105238_10002903
682 Ga0105238_10015728
683 Ga0105238_10017523
684 Ga0105238_10029474
685 Ga0105238_10075728
686 Ga0105238_10076000
687 Ga0105238_10102280
688 Ga0105238_10144898
689 Ga0105238_10171481
690 Ga0105249_10058506
691 Ga0105249_10147005
692 Ga0105239_10006901
693 Ga0105239_10019975
694 Ga0105239_10037584
695 Ga0105239_10088053
696 Ga0105239_10258077
697 Ga0105239_10449530
698 Ga0105239_10551941
699 Ga0105246_10001839
700 Ga0157373_10080326
701 Ga0157373_10141164
702 Ga0157371_10050408
703 Ga0157370_10000003
704 Ga0157370_10006070
705 Ga0157370_10015406
706 Ga0157370_10047830
707 Ga0157370_10108207
708 Ga0157370_10146744
709 Ga0157369_10000245
710 Ga0157369_10007547
711 Ga0157369_10016125
712 Ga0157369_10024479
713 Ga0157369_10064585
714 Ga0157369_10066130
715 Ga0157369_10128503
716 Ga0157369_10161683
717 Ga0157374_10003353
718 Ga0157374_10007187
719 Ga0157374_10015471
720 Ga0157374_10017130
721 Ga0157374_10031061
722 Ga0157374_10059536
723 Ga0157374_10140930
724 Ga0157374_10254338
725 Ga0157378_10022753
726 Ga0157378_10024894
727 Ga0157378_10032886
728 Ga0163162_10064283
729 Ga0163162_10111682
730 Ga0163162_10117985
731 Ga0157372_10002286
732 Ga0157372_10028656
733 Ga0157372_10058456
734 Ga0157372_10062659
735 Ga0157372_10083411
736 Ga0157372_10163307
737 Ga0157372_10221636
738 Ga0157372_10352601
739 Ga0157372_10379981
740 Ga0157375_10040969
741 Ga0157375_10074922
742 Ga0157375_10525137
743 Ga0163163_10005806
744 Ga0163163_10052661
745 Ga0163163_10075264
746 Ga0157379_10001970
747 Ga0157379_10159386
748 Ga0157379_10166455
749 Ga0157376_10030303
750 Ga0157376_10078814
751 Ga0157376_10091333
752 Ga0157376_10203991
753 Ga0157376_10379718
754 Ga0182006_1049325
755 Ga0213872_10001140
756 Ga0213872_10003814
757 Ga0213872_10022239
758 Ga0213872_10043363
759 Ga0213876_10036427
760 Ga0213876_10075695
761 Ga0213871_10012469
762 Ga0224572_1001023
763 Ga0228598_1000041
764 Ga0207656_10021514
765 Ga0207656_10094808
766 Ga0207692_10044496
767 Ga0207710_10006457
768 Ga0207647_10022492
769 Ga0207647_10027843
770 Ga0207685_10036279
771 Ga0207699_10005656
772 Ga0207705_10012031
773 Ga0207705_10073849
774 Ga0207684_10000050
775 Ga0207684_10002245
776 Ga0207684_10028457
777 Ga0207654_10000162
778 Ga0207654_10000415
779 Ga0207654_10002528
780 Ga0207654_10096861
781 Ga0207707_10009835
782 Ga0207707_10140262
783 Ga0207695_10000030
784 Ga0207695_10000129
785 Ga0207695_10000537
786 Ga0207695_10000656
787 Ga0207695_10005442
788 Ga0207695_10026033
789 Ga0207695_10033309
790 Ga0207695_10072169
791 Ga0207695_10079137
792 Ga0207695_10128980
793 Ga0207695_10148461
794 Ga0207671_10001457
795 Ga0207671_10001529
796 Ga0207671_10007391
797 Ga0207671_10052418
798 Ga0207671_10145198
799 Ga0207693_10000029
800 Ga0207663_10038987
801 Ga0207660_10004632
802 Ga0207657_10001275
803 Ga0207657_10113476
804 Ga0207649_10016758
805 Ga0207649_10026207
806 Ga0207652_10069927
807 Ga0207652_10089486
808 Ga0207652_10116604
809 Ga0207646_10003135
810 Ga0207646_10170464
811 Ga0207646_10214700
812 Ga0207694_10000137
813 Ga0207694_10000326
814 Ga0207694_10000639
815 Ga0207694_10029038
816 Ga0207694_10044969
817 Ga0207694_10089994
818 Ga0207694_10190412
819 Ga0207687_10003796
820 Ga0207687_10006151
821 Ga0207687_10029811
822 Ga0207687_10034971
823 Ga0207687_10036585
824 Ga0207687_10059398
825 Ga0207700_10000826
826 Ga0207700_10013634
827 Ga0207706_10093207
828 Ga0207686_10015624
829 Ga0207686_10058531
830 Ga0207665_10003788
831 Ga0207665_10008065
832 Ga0207665_10024333
833 Ga0207691_10092177
834 Ga0207711_10010249
835 Ga0207711_10229388
836 Ga0207689_10073917
837 Ga0207661_10017410
838 Ga0207661_10019747
839 Ga0207661_10200055
840 Ga0207679_10104797
841 Ga0207679_10300024
842 Ga0207667_10004248
843 Ga0207667_10006140
844 Ga0207667_10042186
845 Ga0207667_10073525
846 Ga0207667_10320758
847 Ga0207667_10341716
848 Ga0207640_10021630
849 Ga0207640_10121316
850 Ga0207640_10153202
851 Ga0207640_10236041
852 Ga0207658_10000602
853 Ga0207658_10146618
854 Ga0207677_10000348
855 Ga0207703_10011291
856 Ga0207703_10013275
857 Ga0207703_10019097
858 Ga0207639_10000474
859 Ga0207639_10012341
860 Ga0207639_10079791
861 Ga0207639_10205760
862 Ga0207678_10046071
863 Ga0207678_10118786
864 Ga0207702_10004138
865 Ga0207702_10007762
866 Ga0207702_10058204
867 Ga0207702_10133319
868 Ga0207702_10209275
869 Ga0207702_10252170
870 Ga0207648_10186989
871 Ga0207676_10006805
872 Ga0207674_10003648
873 Ga0207675_100414886
874 Ga0207683_10007557
875 Ga0207698_10000027
876 Ga0207698_10000306
877 Ga0207698_10006084
878 Ga0207698_10084901
879 Ga0265354_1003578
880 Ga0268266_10004043
881 Ga0268266_10007328
882 Ga0268266_10057413
883 Ga0268266_10129654
884 Ga0268264_10000575
885 Ga0268264_10097327
886 Ga0265314_10001523
887 Ga0265342_10089761
888 Ga0373926_0003217
889 Ga0373929_0000025
890 Ga0373943_0000658
891 Ga0373943_0030325
892 Ga0373946_0006173
893 Ga0373955_0003476
894 Ga0373955_0045806
895 Ga0373924_0079085
896 Ga0373935_0001816
897 Ga0373935_0021896
898 Ga0373927_0000784
899 Ga0373927_0073792
900 Ga0373927_0077490
901 Ga0373947_0001753
902 Ga0373947_0003736
903 Ga0373947_0038217
904 Ga0373947_0052392
905 Ga0373937_0007694
906 Ga0373925_0005080
907 Ga0373925_0010823
908 Ga0373925_0086210
909 Ga0373925_0223385
910 Ga0436365_0285255
911 Ga0436365_0765748
912 Ga0436360_0830507
913 Ga0436360_1216469
914 Ga0436361_0012737
915 Ga0436361_0144520
916 Ga0436361_0381832
917 Ga0436361_0634719
918 Ga0436361_0977944
919 Ga0436362_0178958
920 Ga0453683_0014698
921 Ga0466966_0123287
922 Ga0466963_0007620
923 Ga0466963_0039074
924 Ga0453684_0004778
925 Ga0453684_0022678
926 Ga0453684_0069269
927 Ga0453684_0105693
928 Ga0453684_0124115
929 Ga0453684_0181470
930 Ga0453684_0240400
931 Ga0466959_0063444
932 Ga0466967_0050047
933 Ga0466967_0290778
934 Ga0495580_0030160
935 Ga0495580_0041826
936 Ga0495580_0067483
937 Ga0495580_0081033
938 Ga0495580_0137795
939 Ga0495580_0142633
940 Ga0495582_0019048
941 Ga0495582_0038216
942 Ga0495662_0088705
943 Ga0495594_0024122
944 Ga0495630_0011761
945 Ga0495666_0101280
946 Ga0495652_0088699
947 Ga0495665_0091465
948 Ga0495665_0108915
949 Ga0495640_0029212
950 Ga0495587_0071244
951 Ga0495667_0138250
952 Ga0495635_0073824
953 Ga0495635_0221583
954 Ga0495657_0074575
955 Ga0495657_0240730
956 Ga0495623_0018613
957 Ga0495658_0108931
958 Ga0495613_0127425
959 Ga0495581_0021313
960 Ga0495604_0085721
961 Ga0495604_0202207
962 Ga0495674_0015176
963 Ga0495675_0004623
964 Ga0495602_0137264
965 Ga0496101_0160632
966 Ga0496103_0187677
967 Ga0496104_0064363
968 Ga0496105_0015725
969 Ga0496106_0084979
970 Ga0496108_0000018
971 Ga0496108_0013941
972 Ga0496109_0276138
973 Ga0496112_0100099
974 Ga0496112_0339132
975 Ga0496113_0000819
976 Ga0496113_0132573
977 Ga0496115_0110243
978 Ga0496115_0205819
979 Ga0501031_0082450
980 Ga0501032_0004512
981 Ga0501033_0004613
982 Ga0501036_0000169
983 Ga0501046_0002817
984 Ga0501047_0419498
985 Ga0501048_0009961
986 Ga0501068_0000613
987 Ga0501069_0008973
988 Ga0501072_0000228
989 Ga0501074_0002579
990 Ga0501077_0030632
991 Ga0501083_0025022
992 Ga0501035_0007956
993 Ga0501035_0303640
994 Ga0501044_0000766
995 Ga0501044_0040276
996 nmdc:mga05p37_22646_c1
997 nmdc:mga05p37_26745_c1
998 nmdc:mga06r32_91838_c1
999 nmdc:mga0n895_33256_c1
1000 nmdc:mga08x19_9197_c1
1001 nmdc:mga0a205_24786_c1
1002 nmdc:mga0a205_32333_c1
1003 Ga0501084_0028228
1004 Ga0466962_0047751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

31

393

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8by2-assembly1.cif.gz_A structure of the k+/h+ exchanger kefc with gsh. 0.8192 21 379
8bxg-assembly1.cif.gz_B structure of the k/h exchanger kefc. 0.7854 16 387
8bxg-assembly1.cif.gz_A structure of the k/h exchanger kefc. 0.7717 21 387
8by2-assembly1.cif.gz_A structure of the k+/h+ exchanger kefc with gsh. 0.7637 21 379
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.7618 26 387
ID Description Score Start End Superfamily
af_I1LYU2_28_437_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.84 24 375 1.20.1530.20
af_Q9ZTZ7_585_971_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.837 30 376 1.20.1530.20
af_I1ME88_42_441_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8251 24 375 1.20.1530.20
af_Q54GC7_13_418_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8159 24 374 1.20.1530.20
af_Q58671_3_387_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8156 24 384 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A1G9HRQ2-F1-model_v4 Monovalent cation:H+ antiporter-2, CPA2 family 0.9172 24 386 GO:0015297
GO:0016020
GO:1902600
AF-A0A850JBK2-F1-model_v4 Cation:proton antiporter 0.9169 21 386 GO:0015297
GO:0016020
GO:1902600
AF-A0A7V8STJ1-F1-model_v4 Cation/H(+) antiporter 0.9133 28 376 GO:0015297
GO:0016020
GO:1902600
AF-A0A6A0BLS8-F1-model_v4 deleted 0.9106 28 376
AF-A0A852ZS77-F1-model_v4 CPA2 family monovalent cation:H+ antiporter-2 0.9087 16 378 GO:0015297
GO:0016020
GO:1902600

Map