F455869

General Info

Members Datasets Scaffolds Average Seq Length
502 265 1004 200

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10301318|Ga0307405_103013182
Length 212
Sequence VSFHAKMDYAPAKFHKSERKLADPGEPVAFTPENQTKFDEVVRHYPPERRKSAILYALYLVQNQQGYVSRAGMRHVAQQIGCTPAEVEDVVSYYTMFYTKPVGKYVLNVCRTLSCALRGAERVTEELSAKLGIQPGQTDPTGTFTLMEIECLGACDRAPVVMVNDEWHESLAPEQVGPFVDDLRIKGHAALTGCHLNVETRAGSRTPDPGPR

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
183 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
184 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
187 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
188 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
189 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
218 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
219 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
220 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
259 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.38
Nodule 0
Rhizoplane 1.99
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10301318 3300031731 Bacteria 1216
2 JGI24751J29686_10080072 3300002459 Unclassified 677
3 Ga0058863_11782842 3300004799 Bacteria 1631
4 Ga0065704_10201113 3300005289 Bacteria 1144
5 Ga0065712_10082125 3300005290 Bacteria 2946
6 Ga0065712_10120471 3300005290 Bacteria 1678
7 Ga0065712_10477147 3300005290 Bacteria 666
8 Ga0065715_10032908 3300005293 Bacteria 1271
9 Ga0065715_10033396 3300005293 Bacteria 1667
10 Ga0065715_10102931 3300005293 Bacteria 3074
11 Ga0065715_10121481 3300005293 Bacteria 2228
12 Ga0065715_10222821 3300005293 Bacteria 1265
13 Ga0065707_10007275 3300005295 Bacteria 3783
14 Ga0070676_10067915 3300005328 Bacteria 2133
15 Ga0070676_10140147 3300005328 Bacteria 1538
16 Ga0070676_10165393 3300005328 Bacteria 1427
17 Ga0070683_100000094 3300005329 Bacteria 58242
18 Ga0070683_100420558 3300005329 Bacteria 1275
19 Ga0070690_100005931 3300005330 Bacteria 6897
20 Ga0070690_100120624 3300005330 Bacteria 1759
21 Ga0070670_100004554 3300005331 Bacteria 11624
22 Ga0070670_100021571 3300005331 Bacteria 5539
23 Ga0070670_100187175 3300005331 Bacteria 1798
24 Ga0070677_10016501 3300005333 Bacteria 2631
25 Ga0070666_10247021 3300005335 Bacteria 1263
26 Ga0070666_10346043 3300005335 Bacteria 1063
27 Ga0070680_100220316 3300005336 Bacteria 1602
28 Ga0070680_100643536 3300005336 Unclassified 911
29 Ga0070689_100014041 3300005340 Bacteria 5812
30 Ga0070689_100440100 3300005340 Bacteria 1108
31 Ga0070691_10067804 3300005341 Bacteria 1727
32 Ga0070687_100003238 3300005343 Bacteria 6291
33 Ga0070661_100007500 3300005344 Bacteria 7528
34 Ga0070661_100226119 3300005344 Bacteria 1437
35 Ga0070661_100356535 3300005344 Bacteria 1149
36 Ga0070661_100430685 3300005344 Bacteria 1047
37 Ga0070692_10002464 3300005345 Bacteria 7196
38 Ga0070668_100118919 3300005347 Bacteria 2110
39 Ga0070668_100448615 3300005347 Bacteria 1108
40 Ga0070669_100000356 3300005353 Bacteria 35464
41 Ga0070669_100012399 3300005353 Bacteria 6046
42 Ga0070669_100017163 3300005353 Bacteria 5165
43 Ga0070669_100180784 3300005353 Bacteria 1650
44 Ga0070669_100182907 3300005353 Bacteria 1641
45 Ga0070669_100214607 3300005353 Bacteria 1519
46 Ga0070675_100333144 3300005354 Bacteria 1343
47 Ga0070675_100678438 3300005354 Bacteria 938
48 Ga0070671_100528175 3300005355 Bacteria 1016
49 Ga0070674_100037405 3300005356 Bacteria 3264
50 Ga0070674_100086254 3300005356 Bacteria 2255
51 Ga0070674_100331872 3300005356 Bacteria 1223
52 Ga0070673_100000690 3300005364 Bacteria 18661
53 Ga0070688_100042989 3300005365 Bacteria 2782
54 Ga0070688_100388942 3300005365 Bacteria 1030
55 Ga0070659_100123891 3300005366 Bacteria 2096
56 Ga0070659_100416379 3300005366 Bacteria 1136
57 Ga0070667_100380527 3300005367 Bacteria 1282
58 Ga0070713_100087397 3300005436 Bacteria 2674
59 Ga0070701_10076921 3300005438 Bacteria 1797
60 Ga0070711_100480178 3300005439 Bacteria 1021
61 Ga0070705_100182837 3300005440 Bacteria 1421
62 Ga0070700_100012184 3300005441 Bacteria 4789
63 Ga0070700_100453050 3300005441 Bacteria 977
64 Ga0070700_100721172 3300005441 Bacteria 795
65 Ga0070694_100026712 3300005444 Bacteria 3743
66 Ga0070694_100329721 3300005444 Bacteria 1177
67 Ga0070694_100341478 3300005444 Bacteria 1158
68 Ga0070694_100468194 3300005444 Bacteria 998
69 Ga0070663_100009234 3300005455 Bacteria 6099
70 Ga0070678_100327604 3300005456 Bacteria 1310
71 Ga0070662_100563380 3300005457 Bacteria 956
72 Ga0070681_10105985 3300005458 Bacteria 2753
73 Ga0070681_10256410 3300005458 Bacteria 1661
74 Ga0070681_10314215 3300005458 Bacteria 1476
75 Ga0070681_10351201 3300005458 Bacteria 1385
76 Ga0068867_100013785 3300005459 Bacteria 5723
77 Ga0068867_100072160 3300005459 Bacteria 2584
78 Ga0070706_100279906 3300005467 Bacteria 1557
79 Ga0070706_100533478 3300005467 Bacteria 1092
80 Ga0070707_100102292 3300005468 Bacteria 2776
81 Ga0070707_100458863 3300005468 Bacteria 1235
82 Ga0070698_100175273 3300005471 Bacteria 2084
83 Ga0070699_100050675 3300005518 Bacteria 3595
84 Ga0070679_100882580 3300005530 Bacteria 838
85 Ga0070684_100014324 3300005535 Bacteria 6419
86 Ga0070684_100302874 3300005535 Bacteria 1467
87 Ga0070672_100078370 3300005543 Bacteria 2644
88 Ga0070672_100124222 3300005543 Bacteria 2115
89 Ga0070672_100137888 3300005543 Bacteria 2010
90 Ga0070672_100300005 3300005543 Bacteria 1362
91 Ga0070686_100195424 3300005544 Bacteria 1447
92 Ga0070686_100379622 3300005544 Bacteria 1069
93 Ga0070686_100438448 3300005544 Bacteria 1001
94 Ga0070695_100717809 3300005545 Bacteria 795
95 Ga0070696_100084766 3300005546 Bacteria 2249
96 Ga0070696_100189281 3300005546 Bacteria 1531
97 Ga0070693_100263361 3300005547 Bacteria 1148
98 Ga0070704_100003975 3300005549 Bacteria 8524
99 Ga0070704_100279393 3300005549 Bacteria 1383
100 Ga0068855_100031676 3300005563 Bacteria 6314
101 Ga0070664_100142001 3300005564 Bacteria 2115
102 Ga0070664_100152418 3300005564 Bacteria 2041
103 Ga0070664_100466359 3300005564 Bacteria 1161
104 Ga0068857_100029044 3300005577 Bacteria 4879
105 Ga0068857_100179709 3300005577 Bacteria 1925
106 Ga0068857_100339603 3300005577 Bacteria 1389
107 Ga0068857_100367149 3300005577 Bacteria 1335
108 Ga0068854_100134965 3300005578 Bacteria 1888
109 Ga0068854_100495515 3300005578 Bacteria 1028
110 Ga0068856_100490344 3300005614 Bacteria 1250
111 Ga0070702_100005168 3300005615 Bacteria 6043
112 Ga0068859_100002556 3300005617 Bacteria 18468
113 Ga0068859_100386853 3300005617 Bacteria 1494
114 Ga0068864_100049157 3300005618 Bacteria 3628
115 Ga0068864_100165008 3300005618 Bacteria 2016
116 Ga0068861_100073501 3300005719 Bacteria 2656
117 Ga0068861_100347063 3300005719 Bacteria 1301
118 Ga0068861_100921187 3300005719 Bacteria 829
119 Ga0068870_10070700 3300005840 Bacteria 1903
120 Ga0068860_100031570 3300005843 Bacteria 5092
121 Ga0068860_100596399 3300005843 Bacteria 1110
122 Ga0068862_100000604 3300005844 Bacteria 37343
123 Ga0068862_100166489 3300005844 Bacteria 1971
124 Ga0068862_100525487 3300005844 Bacteria 1126
125 Ga0070717_10417494 3300006028 Bacteria 1207
126 Ga0075368_10010875 3300006042 Bacteria 3299
127 Ga0075364_10017344 3300006051 Bacteria 4497
128 Ga0075364_10022732 3300006051 Bacteria 3964
129 Ga0075362_10000746 3300006177 Bacteria 9684
130 Ga0075367_10024219 3300006178 Bacteria 3423
131 Ga0075367_10165891 3300006178 Bacteria 1374
132 Ga0075367_10382371 3300006178 Bacteria 889
133 Ga0075367_10484974 3300006178 Bacteria 784
134 Ga0075366_10107266 3300006195 Bacteria 1679
135 Ga0075366_10107387 3300006195 Bacteria 1678
136 Ga0075366_10301958 3300006195 Bacteria 979
137 Ga0097621_100099499 3300006237 Bacteria 2444
138 Ga0097621_100438543 3300006237 Bacteria 1175
139 Ga0075428_100000295 3300006844 Bacteria 48665
140 Ga0075428_100008555 3300006844 Bacteria 11351
141 Ga0075428_100062788 3300006844 Bacteria 4066
142 Ga0075428_100313373 3300006844 Bacteria 1686
143 Ga0075428_100364677 3300006844 Bacteria 1549
144 Ga0075430_100003248 3300006846 Bacteria 13620
145 Ga0075430_100033466 3300006846 Bacteria 4362
146 Ga0075430_100041554 3300006846 Bacteria 3890
147 Ga0075430_100051781 3300006846 Bacteria 3459
148 Ga0075430_100595972 3300006846 Bacteria 912
149 Ga0075431_100004098 3300006847 Bacteria 14230
150 Ga0075431_100007716 3300006847 Bacteria 10715
151 Ga0075431_100052700 3300006847 Bacteria 4195
152 Ga0075431_100074677 3300006847 Bacteria 3498
153 Ga0075431_100102887 3300006847 Bacteria 2948
154 Ga0075431_100228015 3300006847 Bacteria 1899
155 Ga0075431_100428608 3300006847 Unclassified 1321
156 Ga0075434_100274826 3300006871 Bacteria 1704
157 Ga0075434_100503724 3300006871 Bacteria 1232
158 Ga0075434_100612523 3300006871 Bacteria 1108
159 Ga0075429_100187454 3300006880 Bacteria 1813
160 Ga0075429_100408976 3300006880 Bacteria 1188
161 Ga0075429_100532022 3300006880 Unclassified 1030
162 Ga0068865_100635100 3300006881 Bacteria 906
163 Ga0068865_101294839 3300006881 Bacteria 648
164 Ga0097620_100002556 3300006931 Bacteria 18468
165 Ga0097620_100386838 3300006931 Bacteria 1494
166 Ga0075435_100009689 3300007076 Bacteria 6997
167 Ga0075435_100435613 3300007076 Bacteria 1130
168 Ga0105240_10455038 3300009093 Bacteria 1431
169 Ga0111539_10000037 3300009094 Bacteria 143023
170 Ga0111539_10008348 3300009094 Bacteria 13180
171 Ga0111539_10019538 3300009094 Bacteria 8358
172 Ga0111539_10251814 3300009094 Bacteria 2056
173 Ga0111539_10471170 3300009094 Bacteria 1462
174 Ga0105245_10281346 3300009098 Bacteria 1626
175 Ga0105247_10191396 3300009101 Bacteria 1370
176 Ga0114129_10009195 3300009147 Bacteria 14088
177 Ga0114129_10014093 3300009147 Bacteria 11388
178 Ga0114129_10058076 3300009147 Bacteria 5412
179 Ga0114129_10145415 3300009147 Bacteria 3248
180 Ga0114129_10197054 3300009147 Bacteria 2730
181 Ga0114129_10207811 3300009147 Bacteria 2648
182 Ga0105243_10088135 3300009148 Bacteria 2549
183 Ga0105243_10367687 3300009148 Bacteria 1326
184 Ga0105242_10317879 3300009176 Bacteria 1427
185 Ga0105248_10210153 3300009177 Bacteria 2193
186 Ga0105249_10004031 3300009553 Bacteria 12674
187 Ga0105249_10017055 3300009553 Bacteria 6445
188 Ga0105239_11053248 3300010375 Bacteria 936
189 Ga0157378_10512992 3300013297 Bacteria 1199
190 Ga0163162_10042458 3300013306 Bacteria 4551
191 Ga0163162_10690366 3300013306 Bacteria 1143
192 Ga0157372_10359414 3300013307 Bacteria 1697
193 Ga0157375_10027167 3300013308 Bacteria 5346
194 Ga0163163_10285433 3300014325 Bacteria 1703
195 Ga0157380_10024377 3300014326 Bacteria 4579
196 Ga0157380_10228430 3300014326 Bacteria 1670
197 Ga0157380_10853576 3300014326 Bacteria 932
198 Ga0157380_11374767 3300014326 Unclassified 756
199 Ga0157377_10203830 3300014745 Bacteria 1257
200 Ga0157377_10607562 3300014745 Bacteria 781
201 Ga0163161_10298066 3300017792 Bacteria 1269
202 Ga0206356_10312201 3300020070 Bacteria 1358
203 Ga0207666_1016912 3300025271 Bacteria 1049
204 Ga0207697_10105959 3300025315 Bacteria 1201
205 Ga0207656_10018438 3300025321 Bacteria 2749
206 Ga0207653_10185701 3300025885 Bacteria 779
207 Ga0207682_10015662 3300025893 Bacteria 2953
208 Ga0207682_10064420 3300025893 Bacteria 1540
209 Ga0207710_10087927 3300025900 Bacteria 1450
210 Ga0207688_10110614 3300025901 Bacteria 1594
211 Ga0207688_10184338 3300025901 Bacteria 1246
212 Ga0207688_10388397 3300025901 Bacteria 864
213 Ga0207680_10081028 3300025903 Bacteria 2039
214 Ga0207647_10116762 3300025904 Bacteria 1575
215 Ga0207645_10010770 3300025907 Bacteria 6269
216 Ga0207645_10043815 3300025907 Bacteria 2863
217 Ga0207643_10004952 3300025908 Bacteria 7128
218 Ga0207643_10011395 3300025908 Bacteria 4800
219 Ga0207643_10110111 3300025908 Bacteria 1622
220 Ga0207684_10439037 3300025910 Bacteria 1121
221 Ga0207654_10367241 3300025911 Bacteria 994
222 Ga0207707_10169388 3300025912 Bacteria 1909
223 Ga0207707_10570596 3300025912 Bacteria 960
224 Ga0207695_10509525 3300025913 Unclassified 1085
225 Ga0207693_10097658 3300025915 Bacteria 2303
226 Ga0207663_10518055 3300025916 Bacteria 928
227 Ga0207660_10252300 3300025917 Bacteria 1393
228 Ga0207660_10310176 3300025917 Bacteria 1258
229 Ga0207662_10018021 3300025918 Bacteria 4000
230 Ga0207657_10183374 3300025919 Bacteria 1691
231 Ga0207649_10108850 3300025920 Bacteria 1848
232 Ga0207652_10463131 3300025921 Bacteria 1142
233 Ga0207646_10084225 3300025922 Bacteria 2845
234 Ga0207681_10001518 3300025923 Bacteria 14965
235 Ga0207681_10003863 3300025923 Bacteria 9307
236 Ga0207681_10045407 3300025923 Bacteria 2950
237 Ga0207681_10056971 3300025923 Bacteria 2668
238 Ga0207681_10156408 3300025923 Bacteria 1713
239 Ga0207681_11129681 3300025923 Bacteria 658
240 Ga0207694_10003652 3300025924 Bacteria 12184
241 Ga0207650_10014078 3300025925 Bacteria 5554
242 Ga0207650_10281986 3300025925 Bacteria 1353
243 Ga0207650_10571945 3300025925 Bacteria 948
244 Ga0207659_10036103 3300025926 Bacteria 3421
245 Ga0207659_10335296 3300025926 Bacteria 1251
246 Ga0207659_10410987 3300025926 Bacteria 1133
247 Ga0207659_10529213 3300025926 Bacteria 1000
248 Ga0207687_10151384 3300025927 Bacteria 1771
249 Ga0207700_10123603 3300025928 Bacteria 2101
250 Ga0207706_10383870 3300025933 Bacteria 1219
251 Ga0207706_10392355 3300025933 Bacteria 1204
252 Ga0207670_10017490 3300025936 Bacteria 4333
253 Ga0207670_10212110 3300025936 Bacteria 1477
254 Ga0207669_10008736 3300025937 Bacteria 4777
255 Ga0207691_10035782 3300025940 Bacteria 4604
256 Ga0207691_10230747 3300025940 Bacteria 1603
257 Ga0207691_10278348 3300025940 Bacteria 1440
258 Ga0207691_10476085 3300025940 Unclassified 1061
259 Ga0207711_10072487 3300025941 Bacteria 2992
260 Ga0207689_10231638 3300025942 Bacteria 1527
261 Ga0207661_10002320 3300025944 Bacteria 13112
262 Ga0207679_10141518 3300025945 Bacteria 1945
263 Ga0207667_10152726 3300025949 Bacteria 2376
264 Ga0207651_10015537 3300025960 Bacteria 4427
265 Ga0207651_10044555 3300025960 Bacteria 2970
266 Ga0207651_10618131 3300025960 Bacteria 949
267 Ga0207712_10001123 3300025961 Bacteria 18659
268 Ga0207712_10019497 3300025961 Bacteria 4430
269 Ga0207668_10125318 3300025972 Bacteria 1952
270 Ga0207668_10675511 3300025972 Bacteria 906
271 Ga0207640_10088128 3300025981 Bacteria 2142
272 Ga0207658_10019031 3300025986 Bacteria 4750
273 Ga0207658_10199844 3300025986 Bacteria 1668
274 Ga0207677_10258420 3300026023 Bacteria 1418
275 Ga0207677_10393200 3300026023 Bacteria 1174
276 Ga0207677_10818896 3300026023 Unclassified 835
277 Ga0207703_10058739 3300026035 Bacteria 3140
278 Ga0207678_10024459 3300026067 Bacteria 5275
279 Ga0207678_10914961 3300026067 Bacteria 776
280 Ga0207708_10004966 3300026075 Bacteria 9797
281 Ga0207708_10032560 3300026075 Bacteria 3958
282 Ga0207708_10333922 3300026075 Bacteria 1240
283 Ga0207702_10147506 3300026078 Bacteria 2136
284 Ga0207648_10005858 3300026089 Bacteria 12302
285 Ga0207648_10044696 3300026089 Bacteria 3887
286 Ga0207676_10033860 3300026095 Bacteria 3864
287 Ga0207676_10087023 3300026095 Bacteria 2554
288 Ga0207676_10232775 3300026095 Bacteria 1648
289 Ga0207674_10004709 3300026116 Bacteria 16358
290 Ga0207675_100020098 3300026118 Bacteria 6228
291 Ga0207675_100069721 3300026118 Bacteria 3286
292 Ga0207675_100311991 3300026118 Bacteria 1534
293 Ga0207675_100718365 3300026118 Bacteria 1009
294 Ga0207683_10300323 3300026121 Bacteria 1469
295 Ga0207698_10047178 3300026142 Bacteria 3260
296 Ga0207428_10000482 3300027907 Bacteria 48138
297 Ga0207428_10001068 3300027907 Bacteria 30064
298 Ga0207428_10008407 3300027907 Bacteria 9322
299 Ga0268265_10000160 3300028380 Bacteria 81960
300 Ga0268265_10142192 3300028380 Bacteria 2010
301 Ga0268265_10191689 3300028380 Bacteria 1766
302 Ga0268265_10647530 3300028380 Bacteria 1015
303 Ga0268264_10204203 3300028381 Bacteria 1810
304 Ga0268264_10272308 3300028381 Bacteria 1582
305 Ga0268264_11173950 3300028381 Bacteria 777
306 Ga0307408_100090780 3300031548 Bacteria 2306
307 Ga0307408_100738674 3300031548 Bacteria 888
308 Ga0307405_10037656 3300031731 Bacteria 2909
309 Ga0307405_10052089 3300031731 Bacteria 2543
310 Ga0307405_10053135 3300031731 Bacteria 2522
311 Ga0307405_10058313 3300031731 Bacteria 2429
312 Ga0307413_10431089 3300031824 Bacteria 1041
313 Ga0307410_10001166 3300031852 Bacteria 11585
314 Ga0307410_10033653 3300031852 Bacteria 3311
315 Ga0307410_10077342 3300031852 Bacteria 2326
316 Ga0307410_10196294 3300031852 Bacteria 1538
317 Ga0307410_10365063 3300031852 Bacteria 1157
318 Ga0307406_10043369 3300031901 Bacteria 2813
319 Ga0307407_10022564 3300031903 Bacteria 3268
320 Ga0307407_10251837 3300031903 Bacteria 1210
321 Ga0307407_10697191 3300031903 Unclassified 764
322 Ga0307412_10011011 3300031911 Bacteria 5225
323 Ga0307412_10266529 3300031911 Bacteria 1338
324 Ga0307412_11083363 3300031911 Bacteria 712
325 Ga0307409_100002826 3300031995 Bacteria 9180
326 Ga0307409_100006688 3300031995 Bacteria 6812
327 Ga0307409_100121478 3300031995 Bacteria 2213
328 Ga0307409_100201242 3300031995 Bacteria 1782
329 Ga0307409_100587131 3300031995 Bacteria 1099
330 Ga0307409_100980311 3300031995 Bacteria 862
331 Ga0307416_100027049 3300032002 Bacteria 4239
332 Ga0307416_100136201 3300032002 Bacteria 2222
333 Ga0307416_100177206 3300032002 Bacteria 1993
334 Ga0307416_100803844 3300032002 Bacteria 1036
335 Ga0307416_101276063 3300032002 Bacteria 840
336 Ga0307414_10031676 3300032004 Bacteria 3472
337 Ga0307414_10054605 3300032004 Bacteria 2793
338 Ga0307414_10156317 3300032004 Bacteria 1806
339 Ga0307411_10069091 3300032005 Bacteria 2384
340 Ga0307411_10938889 3300032005 Bacteria 771
341 Ga0307415_100116323 3300032126 Bacteria 1995
342 Ga0373949_0029331 3300035090 Bacteria 1303
343 Ga0373952_0109917 3300035092 Bacteria 737
344 Ga0373941_0046343 3300035115 Bacteria 1365
345 Ga0373945_0264558 3300035116 Unclassified 729
346 Ga0373943_0021404 3300035170 Bacteria 2987
347 Ga0373943_0482605 3300035170 Bacteria 723
348 Ga0373946_0068247 3300035171 Unclassified 1529
349 Ga0373942_0064802 3300035207 Bacteria 1054
350 Ga0373931_0071033 3300035691 Bacteria 1901
351 Ga0373935_0393342 3300035692 Bacteria 994
352 Ga0373933_0041416 3300035724 Bacteria 2719
353 Ga0373947_0547871 3300035725 Bacteria 787
354 Ga0373937_0025518 3300036401 Bacteria 5335
355 Ga0373937_1151371 3300036401 Bacteria 724
356 Ga0373925_0015082 3300037068 Bacteria 5585
357 Ga0395905_0667404 3300037471 Bacteria 942
358 Ga0436365_1190535 3300039437 Unclassified 794
359 Ga0439439_0028663 3300041406 Bacteria 1411
360 Ga0439453_0021296 3300041408 Bacteria 1168
361 Ga0439461_0012392 3300041410 Bacteria 1595
362 Ga0451804_0655138 3300041463 Unclassified 681
363 Ga0439431_0013869 3300041997 Bacteria 1863
364 Ga0439449_0049305 3300042007 Bacteria 1558
365 Ga0439450_004241 3300042008 Bacteria 2435
366 Ga0439462_0040331 3300042015 Bacteria 1245
367 Ga0439462_0084348 3300042015 Bacteria 869
368 Ga0439462_0147791 3300042015 Bacteria 660
369 Ga0450923_055649 3300042125 Bacteria 856
370 Ga0439446_0069408 3300042156 Bacteria 1076
371 Ga0439446_0146756 3300042156 Bacteria 773
372 Ga0439444_0007460 3300042437 Bacteria 1680
373 Ga0439444_0023493 3300042437 Bacteria 1107
374 Ga0439464_0005716 3300042439 Bacteria 3225
375 Ga0451577_0024791 3300042876 Bacteria 5451
376 Ga0453684_0355712 3300044712 Bacteria 1650
377 Ga0451576_0120416 3300045051 Bacteria 2732
378 Ga0495603_0046807 3300046455 Bacteria 2577
379 Ga0495629_0002703 3300046459 Bacteria 13584
380 Ga0495594_0102909 3300046499 Bacteria 1607
381 Ga0495642_0300624 3300046528 Unclassified 703
382 Ga0495598_0079973 3300046537 Bacteria 1047
383 Ga0495621_0002895 3300046539 Bacteria 4677
384 Ga0495659_0013950 3300046664 Bacteria 2622
385 Ga0495646_0350247 3300046680 Bacteria 774
386 Ga0495658_0256015 3300046683 Bacteria 1101
387 Ga0495613_0063708 3300046689 Bacteria 2697
388 Ga0495636_0054709 3300047318 Unclassified 1677
389 Ga0495676_0139514 3300047321 Bacteria 1739
390 Ga0496102_0909010 3300048905 Bacteria 802
391 Ga0496104_0041711 3300048907 Bacteria 4304
392 Ga0496105_0205593 3300048908 Bacteria 1606
393 Ga0496107_0206916 3300048910 Bacteria 1459
394 Ga0496108_0023614 3300048911 Bacteria 5061
395 Ga0496109_0018373 3300048912 Bacteria 6143
396 Ga0496110_0087790 3300048913 Bacteria 2777
397 Ga0496111_0012097 3300048914 Bacteria 5836
398 Ga0496112_0003634 3300048915 Bacteria 12846
399 Ga0501292_030741 3300049515 Bacteria 902
400 Ga0501299_005500 3300049522 Bacteria 1950
401 Ga0501300_035022 3300049523 Bacteria 747
402 Ga0501303_001673 3300049526 Bacteria 1670
403 Ga0501034_0010567 3300049571 Bacteria 9607
404 Ga0501040_0133203 3300049576 Bacteria 1748
405 Ga0501040_0326704 3300049576 Bacteria 1097
406 Ga0501040_0578902 3300049576 Unclassified 811
407 Ga0501040_0661706 3300049576 Bacteria 755
408 Ga0501041_0310157 3300049577 Bacteria 995
409 Ga0501042_0506414 3300049578 Unclassified 877
410 Ga0501046_0777539 3300049580 Unclassified 672
411 Ga0501047_0450931 3300049581 Bacteria 1116
412 Ga0501067_0048976 3300049583 Bacteria 2342
413 Ga0501067_0408203 3300049583 Bacteria 758
414 Ga0501067_0453778 3300049583 Bacteria 716
415 Ga0501071_0012176 3300049587 Bacteria 5822
416 Ga0501072_0054671 3300049588 Bacteria 3146
417 Ga0501072_0082516 3300049588 Bacteria 2548
418 Ga0501072_0100516 3300049588 Bacteria 2299
419 Ga0501072_0407437 3300049588 Bacteria 1078
420 Ga0501074_0143088 3300049590 Bacteria 1710
421 Ga0501074_0765651 3300049590 Bacteria 681
422 Ga0501075_0016140 3300049591 Bacteria 5375
423 Ga0501075_0025261 3300049591 Bacteria 4365
424 Ga0501076_0197904 3300049592 Bacteria 1640
425 Ga0501217_002998 3300049661 Bacteria 3382
426 Ga0501079_0083879 3300049741 Bacteria 2465
427 Ga0501080_0163361 3300049742 Bacteria 2056
428 Ga0501080_0661001 3300049742 Bacteria 924
429 Ga0501080_0662637 3300049742 Bacteria 923
430 Ga0501081_0340057 3300049743 Bacteria 1105
431 Ga0501268_049869 3300049765 Unclassified 808
432 Ga0501035_0030072 3300049822 Bacteria 4952
433 Ga0501045_0075041 3300049824 Bacteria 2490
434 nmdc:mga03683_26262_c1 3300050489 Bacteria 2296
435 nmdc:mga00v17_17008_c2 3300050491 Bacteria 3597
436 nmdc:mga00v17_183361_c1 3300050491 Bacteria 1351
437 nmdc:mga00v17_237399_c1 3300050491 Bacteria 1181
438 nmdc:mga00v17_269451_c1 3300050491 Bacteria 1105
439 nmdc:mga00v17_3790_c1 3300050491 Bacteria 5428
440 nmdc:mga0yw44_8764_c1 3300050492 Bacteria 5060
441 nmdc:mga0k408_313836_c1 3300050493 Bacteria 936
442 nmdc:mga0k408_8489_c1 3300050493 Bacteria 5517
443 nmdc:mga06z11_209842_c1 3300050494 Bacteria 1134
444 nmdc:mga06z11_44418_c1 3300050494 Bacteria 2241
445 nmdc:mga06z11_489750_c1 3300050494 Bacteria 744
446 nmdc:mga04h51_84650_c1 3300050495 Bacteria 1131
447 nmdc:mga05p37_160931_c1 3300050507 Bacteria 2742
448 nmdc:mga05p37_186211_c1 3300050507 Bacteria 2524
449 nmdc:mga05p37_1981_c1 3300050507 Bacteria 23880
450 nmdc:mga05p37_779922_c1 3300050507 Bacteria 1049
451 nmdc:mga05p37_8178_c1 3300050507 Bacteria 12363
452 nmdc:mga05p37_8567_c1 3300050507 Bacteria 12090
453 nmdc:mga09592_43360_c1 3300050508 Bacteria 3787
454 nmdc:mga09592_591009_c1 3300050508 Unclassified 952
455 nmdc:mga09592_980684_c1 3300050508 Bacteria 707
456 nmdc:mga0qj67_40454_c1 3300050509 Bacteria 3663
457 nmdc:mga0qj67_5153_c1 3300050509 Bacteria 9527
458 nmdc:mga0qj67_6470_c1 3300050509 Bacteria 8609
459 nmdc:mga06r32_10057_c1 3300050510 Bacteria 8537
460 nmdc:mga06r32_379637_c1 3300050510 Bacteria 1396
461 nmdc:mga06r32_45003_c1 3300050510 Bacteria 4206
462 nmdc:mga06r32_532498_c1 3300050510 Unclassified 1150
463 nmdc:mga06r32_70607_c1 3300050510 Bacteria 3378
464 nmdc:mga06r32_88273_c1 3300050510 Bacteria 3027
465 nmdc:mga06r32_9552_c1 3300050510 Bacteria 8758
466 nmdc:mga08y16_255988_c1 3300050511 Bacteria 1808
467 nmdc:mga08y16_2850_c1 3300050511 Bacteria 17782
468 nmdc:mga08y16_3529_c1 3300050511 Bacteria 16237
469 nmdc:mga08y16_812022_c1 3300050511 Bacteria 927
470 nmdc:mga08y16_834956_c1 3300050511 Unclassified 912
471 nmdc:mga08y16_98964_c1 3300050511 Bacteria 3037
472 nmdc:mga0n895_121296_c1 3300050512 Bacteria 2635
473 nmdc:mga0n895_262345_c1 3300050512 Bacteria 1753
474 nmdc:mga0n895_41549_c1 3300050512 Bacteria 4472
475 nmdc:mga0n895_556846_c1 3300050512 Bacteria 1152
476 nmdc:mga0rr50_754689_c1 3300050513 Bacteria 830
477 nmdc:mga0rr50_99309_c1 3300050513 Bacteria 2284
478 nmdc:mga08x19_279178_c1 3300050514 Bacteria 1157
479 nmdc:mga0a205_132663_c1 3300050515 Bacteria 2391
480 nmdc:mga0a205_140082_c1 3300050515 Bacteria 2319
481 nmdc:mga0a205_17714_c1 3300050515 Bacteria 6684
482 nmdc:mga0a205_18629_c1 3300050515 Bacteria 6531
483 nmdc:mga0a205_263651_c1 3300050515 Bacteria 1600
484 nmdc:mga0sz30_262688_c1 3300050516 Unclassified 769
485 Ga0495601_0272799 3300053077 Bacteria 1103
486 Ga0495619_0437723 3300053085 Bacteria 902
487 Ga0500628_031819 3300053129 Bacteria 1150
488 Ga0500561_0190172 3300053137 Bacteria 648
489 Ga0501084_0117955 3300054114 Bacteria 2231
490 Ga0501084_0321450 3300054114 Bacteria 1307
491 Ga0590071_002722 3300059421 Bacteria 4429
492 Ga0590071_008152 3300059421 Bacteria 2472
493 Ga0590074_007751 3300059423 Bacteria 1786
494 Ga0590074_011890 3300059423 Bacteria 1460
495 Ga0590075_002816 3300059424 Bacteria 4149
496 Ga0590075_012357 3300059424 Bacteria 2073
497 Ga0590075_038840 3300059424 Bacteria 1215
498 Ga0590077_000554 3300059426 Bacteria 10326
499 Ga0590077_001886 3300059426 Bacteria 4651
500 Ga0590077_007220 3300059426 Bacteria 2273
501 Ga0590077_028914 3300059426 Unclassified 1205
502 Ga0530510_0004651 3300061734 Bacteria 9494
503 Ga0307405_10301318
504 JGI24751J29686_10080072
505 Ga0058863_11782842
506 Ga0065704_10201113
507 Ga0065712_10082125
508 Ga0065712_10120471
509 Ga0065712_10477147
510 Ga0065715_10032908
511 Ga0065715_10033396
512 Ga0065715_10102931
513 Ga0065715_10121481
514 Ga0065715_10222821
515 Ga0065707_10007275
516 Ga0070676_10067915
517 Ga0070676_10140147
518 Ga0070676_10165393
519 Ga0070683_100000094
520 Ga0070683_100420558
521 Ga0070690_100005931
522 Ga0070690_100120624
523 Ga0070670_100004554
524 Ga0070670_100021571
525 Ga0070670_100187175
526 Ga0070677_10016501
527 Ga0070666_10247021
528 Ga0070666_10346043
529 Ga0070680_100220316
530 Ga0070680_100643536
531 Ga0070689_100014041
532 Ga0070689_100440100
533 Ga0070691_10067804
534 Ga0070687_100003238
535 Ga0070661_100007500
536 Ga0070661_100226119
537 Ga0070661_100356535
538 Ga0070661_100430685
539 Ga0070692_10002464
540 Ga0070668_100118919
541 Ga0070668_100448615
542 Ga0070669_100000356
543 Ga0070669_100012399
544 Ga0070669_100017163
545 Ga0070669_100180784
546 Ga0070669_100182907
547 Ga0070669_100214607
548 Ga0070675_100333144
549 Ga0070675_100678438
550 Ga0070671_100528175
551 Ga0070674_100037405
552 Ga0070674_100086254
553 Ga0070674_100331872
554 Ga0070673_100000690
555 Ga0070688_100042989
556 Ga0070688_100388942
557 Ga0070659_100123891
558 Ga0070659_100416379
559 Ga0070667_100380527
560 Ga0070713_100087397
561 Ga0070701_10076921
562 Ga0070711_100480178
563 Ga0070705_100182837
564 Ga0070700_100012184
565 Ga0070700_100453050
566 Ga0070700_100721172
567 Ga0070694_100026712
568 Ga0070694_100329721
569 Ga0070694_100341478
570 Ga0070694_100468194
571 Ga0070663_100009234
572 Ga0070678_100327604
573 Ga0070662_100563380
574 Ga0070681_10105985
575 Ga0070681_10256410
576 Ga0070681_10314215
577 Ga0070681_10351201
578 Ga0068867_100013785
579 Ga0068867_100072160
580 Ga0070706_100279906
581 Ga0070706_100533478
582 Ga0070707_100102292
583 Ga0070707_100458863
584 Ga0070698_100175273
585 Ga0070699_100050675
586 Ga0070679_100882580
587 Ga0070684_100014324
588 Ga0070684_100302874
589 Ga0070672_100078370
590 Ga0070672_100124222
591 Ga0070672_100137888
592 Ga0070672_100300005
593 Ga0070686_100195424
594 Ga0070686_100379622
595 Ga0070686_100438448
596 Ga0070695_100717809
597 Ga0070696_100084766
598 Ga0070696_100189281
599 Ga0070693_100263361
600 Ga0070704_100003975
601 Ga0070704_100279393
602 Ga0068855_100031676
603 Ga0070664_100142001
604 Ga0070664_100152418
605 Ga0070664_100466359
606 Ga0068857_100029044
607 Ga0068857_100179709
608 Ga0068857_100339603
609 Ga0068857_100367149
610 Ga0068854_100134965
611 Ga0068854_100495515
612 Ga0068856_100490344
613 Ga0070702_100005168
614 Ga0068859_100002556
615 Ga0068859_100386853
616 Ga0068864_100049157
617 Ga0068864_100165008
618 Ga0068861_100073501
619 Ga0068861_100347063
620 Ga0068861_100921187
621 Ga0068870_10070700
622 Ga0068860_100031570
623 Ga0068860_100596399
624 Ga0068862_100000604
625 Ga0068862_100166489
626 Ga0068862_100525487
627 Ga0070717_10417494
628 Ga0075368_10010875
629 Ga0075364_10017344
630 Ga0075364_10022732
631 Ga0075362_10000746
632 Ga0075367_10024219
633 Ga0075367_10165891
634 Ga0075367_10382371
635 Ga0075367_10484974
636 Ga0075366_10107266
637 Ga0075366_10107387
638 Ga0075366_10301958
639 Ga0097621_100099499
640 Ga0097621_100438543
641 Ga0075428_100000295
642 Ga0075428_100008555
643 Ga0075428_100062788
644 Ga0075428_100313373
645 Ga0075428_100364677
646 Ga0075430_100003248
647 Ga0075430_100033466
648 Ga0075430_100041554
649 Ga0075430_100051781
650 Ga0075430_100595972
651 Ga0075431_100004098
652 Ga0075431_100007716
653 Ga0075431_100052700
654 Ga0075431_100074677
655 Ga0075431_100102887
656 Ga0075431_100228015
657 Ga0075431_100428608
658 Ga0075434_100274826
659 Ga0075434_100503724
660 Ga0075434_100612523
661 Ga0075429_100187454
662 Ga0075429_100408976
663 Ga0075429_100532022
664 Ga0068865_100635100
665 Ga0068865_101294839
666 Ga0097620_100002556
667 Ga0097620_100386838
668 Ga0075435_100009689
669 Ga0075435_100435613
670 Ga0105240_10455038
671 Ga0111539_10000037
672 Ga0111539_10008348
673 Ga0111539_10019538
674 Ga0111539_10251814
675 Ga0111539_10471170
676 Ga0105245_10281346
677 Ga0105247_10191396
678 Ga0114129_10009195
679 Ga0114129_10014093
680 Ga0114129_10058076
681 Ga0114129_10145415
682 Ga0114129_10197054
683 Ga0114129_10207811
684 Ga0105243_10088135
685 Ga0105243_10367687
686 Ga0105242_10317879
687 Ga0105248_10210153
688 Ga0105249_10004031
689 Ga0105249_10017055
690 Ga0105239_11053248
691 Ga0157378_10512992
692 Ga0163162_10042458
693 Ga0163162_10690366
694 Ga0157372_10359414
695 Ga0157375_10027167
696 Ga0163163_10285433
697 Ga0157380_10024377
698 Ga0157380_10228430
699 Ga0157380_10853576
700 Ga0157380_11374767
701 Ga0157377_10203830
702 Ga0157377_10607562
703 Ga0163161_10298066
704 Ga0206356_10312201
705 Ga0207666_1016912
706 Ga0207697_10105959
707 Ga0207656_10018438
708 Ga0207653_10185701
709 Ga0207682_10015662
710 Ga0207682_10064420
711 Ga0207710_10087927
712 Ga0207688_10110614
713 Ga0207688_10184338
714 Ga0207688_10388397
715 Ga0207680_10081028
716 Ga0207647_10116762
717 Ga0207645_10010770
718 Ga0207645_10043815
719 Ga0207643_10004952
720 Ga0207643_10011395
721 Ga0207643_10110111
722 Ga0207684_10439037
723 Ga0207654_10367241
724 Ga0207707_10169388
725 Ga0207707_10570596
726 Ga0207695_10509525
727 Ga0207693_10097658
728 Ga0207663_10518055
729 Ga0207660_10252300
730 Ga0207660_10310176
731 Ga0207662_10018021
732 Ga0207657_10183374
733 Ga0207649_10108850
734 Ga0207652_10463131
735 Ga0207646_10084225
736 Ga0207681_10001518
737 Ga0207681_10003863
738 Ga0207681_10045407
739 Ga0207681_10056971
740 Ga0207681_10156408
741 Ga0207681_11129681
742 Ga0207694_10003652
743 Ga0207650_10014078
744 Ga0207650_10281986
745 Ga0207650_10571945
746 Ga0207659_10036103
747 Ga0207659_10335296
748 Ga0207659_10410987
749 Ga0207659_10529213
750 Ga0207687_10151384
751 Ga0207700_10123603
752 Ga0207706_10383870
753 Ga0207706_10392355
754 Ga0207670_10017490
755 Ga0207670_10212110
756 Ga0207669_10008736
757 Ga0207691_10035782
758 Ga0207691_10230747
759 Ga0207691_10278348
760 Ga0207691_10476085
761 Ga0207711_10072487
762 Ga0207689_10231638
763 Ga0207661_10002320
764 Ga0207679_10141518
765 Ga0207667_10152726
766 Ga0207651_10015537
767 Ga0207651_10044555
768 Ga0207651_10618131
769 Ga0207712_10001123
770 Ga0207712_10019497
771 Ga0207668_10125318
772 Ga0207668_10675511
773 Ga0207640_10088128
774 Ga0207658_10019031
775 Ga0207658_10199844
776 Ga0207677_10258420
777 Ga0207677_10393200
778 Ga0207677_10818896
779 Ga0207703_10058739
780 Ga0207678_10024459
781 Ga0207678_10914961
782 Ga0207708_10004966
783 Ga0207708_10032560
784 Ga0207708_10333922
785 Ga0207702_10147506
786 Ga0207648_10005858
787 Ga0207648_10044696
788 Ga0207676_10033860
789 Ga0207676_10087023
790 Ga0207676_10232775
791 Ga0207674_10004709
792 Ga0207675_100020098
793 Ga0207675_100069721
794 Ga0207675_100311991
795 Ga0207675_100718365
796 Ga0207683_10300323
797 Ga0207698_10047178
798 Ga0207428_10000482
799 Ga0207428_10001068
800 Ga0207428_10008407
801 Ga0268265_10000160
802 Ga0268265_10142192
803 Ga0268265_10191689
804 Ga0268265_10647530
805 Ga0268264_10204203
806 Ga0268264_10272308
807 Ga0268264_11173950
808 Ga0307408_100090780
809 Ga0307408_100738674
810 Ga0307405_10037656
811 Ga0307405_10052089
812 Ga0307405_10053135
813 Ga0307405_10058313
814 Ga0307413_10431089
815 Ga0307410_10001166
816 Ga0307410_10033653
817 Ga0307410_10077342
818 Ga0307410_10196294
819 Ga0307410_10365063
820 Ga0307406_10043369
821 Ga0307407_10022564
822 Ga0307407_10251837
823 Ga0307407_10697191
824 Ga0307412_10011011
825 Ga0307412_10266529
826 Ga0307412_11083363
827 Ga0307409_100002826
828 Ga0307409_100006688
829 Ga0307409_100121478
830 Ga0307409_100201242
831 Ga0307409_100587131
832 Ga0307409_100980311
833 Ga0307416_100027049
834 Ga0307416_100136201
835 Ga0307416_100177206
836 Ga0307416_100803844
837 Ga0307416_101276063
838 Ga0307414_10031676
839 Ga0307414_10054605
840 Ga0307414_10156317
841 Ga0307411_10069091
842 Ga0307411_10938889
843 Ga0307415_100116323
844 Ga0373949_0029331
845 Ga0373952_0109917
846 Ga0373941_0046343
847 Ga0373945_0264558
848 Ga0373943_0021404
849 Ga0373943_0482605
850 Ga0373946_0068247
851 Ga0373942_0064802
852 Ga0373931_0071033
853 Ga0373935_0393342
854 Ga0373933_0041416
855 Ga0373947_0547871
856 Ga0373937_0025518
857 Ga0373937_1151371
858 Ga0373925_0015082
859 Ga0395905_0667404
860 Ga0436365_1190535
861 Ga0439439_0028663
862 Ga0439453_0021296
863 Ga0439461_0012392
864 Ga0451804_0655138
865 Ga0439431_0013869
866 Ga0439449_0049305
867 Ga0439450_004241
868 Ga0439462_0040331
869 Ga0439462_0084348
870 Ga0439462_0147791
871 Ga0450923_055649
872 Ga0439446_0069408
873 Ga0439446_0146756
874 Ga0439444_0007460
875 Ga0439444_0023493
876 Ga0439464_0005716
877 Ga0451577_0024791
878 Ga0453684_0355712
879 Ga0451576_0120416
880 Ga0495603_0046807
881 Ga0495629_0002703
882 Ga0495594_0102909
883 Ga0495642_0300624
884 Ga0495598_0079973
885 Ga0495621_0002895
886 Ga0495659_0013950
887 Ga0495646_0350247
888 Ga0495658_0256015
889 Ga0495613_0063708
890 Ga0495636_0054709
891 Ga0495676_0139514
892 Ga0496102_0909010
893 Ga0496104_0041711
894 Ga0496105_0205593
895 Ga0496107_0206916
896 Ga0496108_0023614
897 Ga0496109_0018373
898 Ga0496110_0087790
899 Ga0496111_0012097
900 Ga0496112_0003634
901 Ga0501292_030741
902 Ga0501299_005500
903 Ga0501300_035022
904 Ga0501303_001673
905 Ga0501034_0010567
906 Ga0501040_0133203
907 Ga0501040_0326704
908 Ga0501040_0578902
909 Ga0501040_0661706
910 Ga0501041_0310157
911 Ga0501042_0506414
912 Ga0501046_0777539
913 Ga0501047_0450931
914 Ga0501067_0048976
915 Ga0501067_0408203
916 Ga0501067_0453778
917 Ga0501071_0012176
918 Ga0501072_0054671
919 Ga0501072_0082516
920 Ga0501072_0100516
921 Ga0501072_0407437
922 Ga0501074_0143088
923 Ga0501074_0765651
924 Ga0501075_0016140
925 Ga0501075_0025261
926 Ga0501076_0197904
927 Ga0501217_002998
928 Ga0501079_0083879
929 Ga0501080_0163361
930 Ga0501080_0661001
931 Ga0501080_0662637
932 Ga0501081_0340057
933 Ga0501268_049869
934 Ga0501035_0030072
935 Ga0501045_0075041
936 nmdc:mga03683_26262_c1
937 nmdc:mga00v17_17008_c2
938 nmdc:mga00v17_183361_c1
939 nmdc:mga00v17_237399_c1
940 nmdc:mga00v17_269451_c1
941 nmdc:mga00v17_3790_c1
942 nmdc:mga0yw44_8764_c1
943 nmdc:mga0k408_313836_c1
944 nmdc:mga0k408_8489_c1
945 nmdc:mga06z11_209842_c1
946 nmdc:mga06z11_44418_c1
947 nmdc:mga06z11_489750_c1
948 nmdc:mga04h51_84650_c1
949 nmdc:mga05p37_160931_c1
950 nmdc:mga05p37_186211_c1
951 nmdc:mga05p37_1981_c1
952 nmdc:mga05p37_779922_c1
953 nmdc:mga05p37_8178_c1
954 nmdc:mga05p37_8567_c1
955 nmdc:mga09592_43360_c1
956 nmdc:mga09592_591009_c1
957 nmdc:mga09592_980684_c1
958 nmdc:mga0qj67_40454_c1
959 nmdc:mga0qj67_5153_c1
960 nmdc:mga0qj67_6470_c1
961 nmdc:mga06r32_10057_c1
962 nmdc:mga06r32_379637_c1
963 nmdc:mga06r32_45003_c1
964 nmdc:mga06r32_532498_c1
965 nmdc:mga06r32_70607_c1
966 nmdc:mga06r32_88273_c1
967 nmdc:mga06r32_9552_c1
968 nmdc:mga08y16_255988_c1
969 nmdc:mga08y16_2850_c1
970 nmdc:mga08y16_3529_c1
971 nmdc:mga08y16_812022_c1
972 nmdc:mga08y16_834956_c1
973 nmdc:mga08y16_98964_c1
974 nmdc:mga0n895_121296_c1
975 nmdc:mga0n895_262345_c1
976 nmdc:mga0n895_41549_c1
977 nmdc:mga0n895_556846_c1
978 nmdc:mga0rr50_754689_c1
979 nmdc:mga0rr50_99309_c1
980 nmdc:mga08x19_279178_c1
981 nmdc:mga0a205_132663_c1
982 nmdc:mga0a205_140082_c1
983 nmdc:mga0a205_17714_c1
984 nmdc:mga0a205_18629_c1
985 nmdc:mga0a205_263651_c1
986 nmdc:mga0sz30_262688_c1
987 Ga0495601_0272799
988 Ga0495619_0437723
989 Ga0500628_031819
990 Ga0500561_0190172
991 Ga0501084_0117955
992 Ga0501084_0321450
993 Ga0590071_002722
994 Ga0590071_008152
995 Ga0590074_007751
996 Ga0590074_011890
997 Ga0590075_002816
998 Ga0590075_012357
999 Ga0590075_038840
1000 Ga0590077_000554
1001 Ga0590077_001886
1002 Ga0590077_007220
1003 Ga0590077_028914
1004 Ga0530510_0004651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

38

184

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.9145 27 182
3iam-assembly1.cif.gz_2 crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh 0.9017 28 186
5gpn-assembly1.cif.gz_d architecture of mammalian respirasome 0.8983 25 185
5gup-assembly1.cif.gz_E cryo-em structure of mammalian respiratory supercomplex i1iii2iv1 0.8983 25 185
5xtb-assembly1.cif.gz_O cryo-em structure of human respiratory complex i matrix arm 0.8936 22 185
ID Description Score Start End Superfamily
af_Q6PBX8_48_121_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9842 27 100 1.10.10.1590
af_Q6PBX8_48_121_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9713 27 100 1.10.10.1590
af_O13691_6_74_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.947 28 93 1.10.10.1590
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9382 100 182 3.40.30.10
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9371 101 185 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1G8B5Y7-F1-model_v4 NADH-quinone oxidoreductase subunit E 0.9296 25 185 GO:0003954
GO:0046872
GO:0051537
AF-A0A7K1YXI7-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.929 27 149 GO:0003954
GO:0046872
GO:0051537
AF-A0A2A4W2X3-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE 0.9275 24 185 GO:0003954
GO:0046872
GO:0051537
AF-W1QA07-F1-model_v4 NADH-ubiquinone oxidoreductase subunit, mitochondrial (EC 1.6.5.3) 0.9271 25 185 GO:0016491
GO:0046872
GO:0051537
AF-A0A0D2QZN3-F1-model_v4 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial 0.9226 21 153 GO:0003954
GO:0005739
GO:0006120
GO:0046872
GO:0051536

Map