F455852
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 502 | 223 | 502 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10001438|Ga0213876_1000143811 |
| Length | 307 |
| Sequence | VNPEAATHSIDRRDEIRHLHDGEPAPAANADDGGAGDDDAPLVELQDVVLRFGKKTVLDGVSLAVYPGERLIVLGGSGSGKSTTLRLIMGILQPTAGRVFFCGHEISALGRRELNVLRARIGMVYQYSALISSLTVRDNLALPMEELSDQKPEEIDRIIDEKLAMVNMGNVKSAMPAELSGGMKKRIGLARALVLDPELILFDEPSAGLDPVTSSIVDELIINLTEQTQTTSIVVTHEMDSAFRIGTRMVMLYEGKIIADGPPEEFRHSSNPVVTQFVEGRTEGPILDSTRHHDPKPEQPATTTAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 97 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 156 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 172 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 173 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 174 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 175 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 178 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.98 |
| Rhizosphere | 91.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000382 | 3300000545 | Bacteria | 3455 |
| 2 | JGI24035J26624_1002346 | 3300002126 | Bacteria | 1765 |
| 3 | JGI25406J46586_10000023 | 3300003203 | Bacteria | 76640 |
| 4 | Ga0065704_10162264 | 3300005289 | Unclassified | 1346 |
| 5 | Ga0065712_10007547 | 3300005290 | Bacteria | 2507 |
| 6 | Ga0065712_10115221 | 3300005290 | Bacteria | 1755 |
| 7 | Ga0065712_10151695 | 3300005290 | Unclassified | 1365 |
| 8 | Ga0065715_10001773 | 3300005293 | Bacteria | 9408 |
| 9 | Ga0065707_10006006 | 3300005295 | Bacteria | 3277 |
| 10 | Ga0070658_10020004 | 3300005327 | Bacteria | 5361 |
| 11 | Ga0070658_10029659 | 3300005327 | Bacteria | 4396 |
| 12 | Ga0070658_10134476 | 3300005327 | Bacteria | 2062 |
| 13 | Ga0070658_10159233 | 3300005327 | Bacteria | 1894 |
| 14 | Ga0070676_10002923 | 3300005328 | Bacteria | 8823 |
| 15 | Ga0070676_10012692 | 3300005328 | Bacteria | 4606 |
| 16 | Ga0070676_10018442 | 3300005328 | Bacteria | 3868 |
| 17 | Ga0070676_10065346 | 3300005328 | Bacteria | 2172 |
| 18 | Ga0070683_100053148 | 3300005329 | Bacteria | 3754 |
| 19 | Ga0070690_100097786 | 3300005330 | Unclassified | 1942 |
| 20 | Ga0070690_100568227 | 3300005330 | Bacteria | 857 |
| 21 | Ga0070670_100005320 | 3300005331 | Bacteria | 10856 |
| 22 | Ga0070670_100006708 | 3300005331 | Bacteria | 9755 |
| 23 | Ga0070670_100026824 | 3300005331 | Bacteria | 4955 |
| 24 | Ga0070670_100112690 | 3300005331 | Viruses | 2344 |
| 25 | Ga0070670_100210319 | 3300005331 | Bacteria | 1691 |
| 26 | Ga0070677_10023490 | 3300005333 | Bacteria | 2284 |
| 27 | Ga0070677_10138660 | 3300005333 | Bacteria | 1119 |
| 28 | Ga0068869_100270956 | 3300005334 | Bacteria | 1362 |
| 29 | Ga0070666_10005510 | 3300005335 | Bacteria | 7764 |
| 30 | Ga0070666_10061459 | 3300005335 | Bacteria | 2543 |
| 31 | Ga0070666_10122269 | 3300005335 | Bacteria | 1806 |
| 32 | Ga0070666_10425795 | 3300005335 | Bacteria | 956 |
| 33 | Ga0068868_100076108 | 3300005338 | Bacteria | 2683 |
| 34 | Ga0068868_100159304 | 3300005338 | Bacteria | 1863 |
| 35 | Ga0068868_100165307 | 3300005338 | Bacteria | 1830 |
| 36 | Ga0068868_100251472 | 3300005338 | Bacteria | 1488 |
| 37 | Ga0068868_100493100 | 3300005338 | Bacteria | 1072 |
| 38 | Ga0070660_100046737 | 3300005339 | Bacteria | 3319 |
| 39 | Ga0070660_100064592 | 3300005339 | Bacteria | 2848 |
| 40 | Ga0070689_100292044 | 3300005340 | Bacteria | 1355 |
| 41 | Ga0070691_10145511 | 3300005341 | Bacteria | 1211 |
| 42 | Ga0070661_100113246 | 3300005344 | Bacteria | 2027 |
| 43 | Ga0070668_100002392 | 3300005347 | Bacteria | 13794 |
| 44 | Ga0070668_100017294 | 3300005347 | Bacteria | 5398 |
| 45 | Ga0070668_100025289 | 3300005347 | Bacteria | 4500 |
| 46 | Ga0070669_100009421 | 3300005353 | Bacteria | 6953 |
| 47 | Ga0070669_100012301 | 3300005353 | Bacteria | 6072 |
| 48 | Ga0070669_100304104 | 3300005353 | Bacteria | 1283 |
| 49 | Ga0070675_100010789 | 3300005354 | Bacteria | 7145 |
| 50 | Ga0070675_100059781 | 3300005354 | Bacteria | 3145 |
| 51 | Ga0070675_100108573 | 3300005354 | Bacteria | 2343 |
| 52 | Ga0070675_100143007 | 3300005354 | Bacteria | 2046 |
| 53 | Ga0070675_100158210 | 3300005354 | Bacteria | 1947 |
| 54 | Ga0070671_100004750 | 3300005355 | Bacteria | 10792 |
| 55 | Ga0070671_100069906 | 3300005355 | Bacteria | 2928 |
| 56 | Ga0070671_100247898 | 3300005355 | Bacteria | 1513 |
| 57 | Ga0070671_100313908 | 3300005355 | Bacteria | 1335 |
| 58 | Ga0070674_100003820 | 3300005356 | Bacteria | 8521 |
| 59 | Ga0070674_100016618 | 3300005356 | Bacteria | 4615 |
| 60 | Ga0070674_100239453 | 3300005356 | Unclassified | 1420 |
| 61 | Ga0070674_100356650 | 3300005356 | Bacteria | 1183 |
| 62 | Ga0070673_100019760 | 3300005364 | Bacteria | 4844 |
| 63 | Ga0070673_100020468 | 3300005364 | Bacteria | 4773 |
| 64 | Ga0070673_100240659 | 3300005364 | Bacteria | 1573 |
| 65 | Ga0070688_100009213 | 3300005365 | Bacteria | 5388 |
| 66 | Ga0070688_100198870 | 3300005365 | Bacteria | 1401 |
| 67 | Ga0070667_100014735 | 3300005367 | Bacteria | 6459 |
| 68 | Ga0070667_100035329 | 3300005367 | Bacteria | 4186 |
| 69 | Ga0070667_100035605 | 3300005367 | Bacteria | 4171 |
| 70 | Ga0070667_100079668 | 3300005367 | Bacteria | 2800 |
| 71 | Ga0070667_100109467 | 3300005367 | Bacteria | 2394 |
| 72 | Ga0070714_100098117 | 3300005435 | Bacteria | 2577 |
| 73 | Ga0070714_100208400 | 3300005435 | Bacteria | 1791 |
| 74 | Ga0070714_100209009 | 3300005435 | Bacteria | 1788 |
| 75 | Ga0070714_100272972 | 3300005435 | Bacteria | 1568 |
| 76 | Ga0070714_100624726 | 3300005435 | Bacteria | 1036 |
| 77 | Ga0070713_100175055 | 3300005436 | Bacteria | 1925 |
| 78 | Ga0070713_100677211 | 3300005436 | Bacteria | 984 |
| 79 | Ga0070711_100025400 | 3300005439 | Unclassified | 3876 |
| 80 | Ga0070711_100033883 | 3300005439 | Bacteria | 3403 |
| 81 | Ga0070711_100201566 | 3300005439 | Bacteria | 1536 |
| 82 | Ga0070700_100528666 | 3300005441 | Bacteria | 912 |
| 83 | Ga0070708_100055215 | 3300005445 | Bacteria | 3531 |
| 84 | Ga0070708_100343544 | 3300005445 | Bacteria | 1406 |
| 85 | Ga0070708_100398383 | 3300005445 | Bacteria | 1298 |
| 86 | Ga0070678_100134973 | 3300005456 | Bacteria | 1967 |
| 87 | Ga0070678_100139834 | 3300005456 | Unclassified | 1936 |
| 88 | Ga0070678_100240186 | 3300005456 | Bacteria | 1514 |
| 89 | Ga0070662_100278330 | 3300005457 | Bacteria | 1353 |
| 90 | Ga0068867_100006507 | 3300005459 | Bacteria | 8255 |
| 91 | Ga0070706_100000973 | 3300005467 | Bacteria | 31247 |
| 92 | Ga0070706_100025763 | 3300005467 | Bacteria | 5412 |
| 93 | Ga0070706_100085389 | 3300005467 | Bacteria | 2925 |
| 94 | Ga0070706_100086118 | 3300005467 | Bacteria | 2911 |
| 95 | Ga0070706_100086901 | 3300005467 | Unclassified | 2898 |
| 96 | Ga0070706_100152683 | 3300005467 | Unclassified | 2156 |
| 97 | Ga0070706_100192325 | 3300005467 | Unclassified | 1906 |
| 98 | Ga0070706_100208369 | 3300005467 | Bacteria | 1825 |
| 99 | Ga0070706_100334651 | 3300005467 | Unclassified | 1412 |
| 100 | Ga0070707_100019586 | 3300005468 | Bacteria | 6377 |
| 101 | Ga0070707_100035472 | 3300005468 | Bacteria | 4758 |
| 102 | Ga0070707_100053866 | 3300005468 | Bacteria | 3857 |
| 103 | Ga0070707_100060619 | 3300005468 | Unclassified | 3628 |
| 104 | Ga0070707_100125541 | 3300005468 | Unclassified | 2493 |
| 105 | Ga0070707_100143743 | 3300005468 | Bacteria | 2322 |
| 106 | Ga0070707_100764700 | 3300005468 | Unclassified | 929 |
| 107 | Ga0070698_100001144 | 3300005471 | Bacteria | 29368 |
| 108 | Ga0070698_100004844 | 3300005471 | Bacteria | 14775 |
| 109 | Ga0070698_100026631 | 3300005471 | Bacteria | 6017 |
| 110 | Ga0070698_100037336 | 3300005471 | Bacteria | 5010 |
| 111 | Ga0070698_100395986 | 3300005471 | Unclassified | 1314 |
| 112 | Ga0070699_100091499 | 3300005518 | Bacteria | 2660 |
| 113 | Ga0070699_100206480 | 3300005518 | Bacteria | 1748 |
| 114 | Ga0070679_100765796 | 3300005530 | Bacteria | 908 |
| 115 | Ga0070697_100001763 | 3300005536 | Bacteria | 16519 |
| 116 | Ga0070697_100006844 | 3300005536 | Bacteria | 8855 |
| 117 | Ga0070697_100025379 | 3300005536 | Bacteria | 4728 |
| 118 | Ga0070697_100045936 | 3300005536 | Bacteria | 3540 |
| 119 | Ga0070697_100179633 | 3300005536 | Unclassified | 1794 |
| 120 | Ga0070697_100273453 | 3300005536 | Bacteria | 1448 |
| 121 | Ga0070697_100296765 | 3300005536 | Bacteria | 1389 |
| 122 | Ga0068853_100000011 | 3300005539 | Bacteria | 246709 |
| 123 | Ga0070672_100011259 | 3300005543 | Bacteria | 6237 |
| 124 | Ga0070695_100247823 | 3300005545 | Bacteria | 1295 |
| 125 | Ga0070696_100327680 | 3300005546 | Bacteria | 1180 |
| 126 | Ga0070665_100000772 | 3300005548 | Bacteria | 42151 |
| 127 | Ga0070665_100004925 | 3300005548 | Bacteria | 13852 |
| 128 | Ga0070665_100008642 | 3300005548 | Bacteria | 10307 |
| 129 | Ga0070665_100099861 | 3300005548 | Bacteria | 2907 |
| 130 | Ga0070665_100732598 | 3300005548 | Bacteria | 1002 |
| 131 | Ga0068855_100057644 | 3300005563 | Bacteria | 4552 |
| 132 | Ga0068855_100080775 | 3300005563 | Bacteria | 3770 |
| 133 | Ga0068855_100327224 | 3300005563 | Bacteria | 1692 |
| 134 | Ga0068855_100855140 | 3300005563 | Bacteria | 964 |
| 135 | Ga0070664_100136539 | 3300005564 | Bacteria | 2157 |
| 136 | Ga0068856_100340662 | 3300005614 | Bacteria | 1517 |
| 137 | Ga0068859_100874871 | 3300005617 | Bacteria | 984 |
| 138 | Ga0068864_100031014 | 3300005618 | Bacteria | 4534 |
| 139 | Ga0068866_10003045 | 3300005718 | Bacteria | 6917 |
| 140 | Ga0068866_10077663 | 3300005718 | Bacteria | 1774 |
| 141 | Ga0068861_100075982 | 3300005719 | Bacteria | 2616 |
| 142 | Ga0068863_100107086 | 3300005841 | Bacteria | 2660 |
| 143 | Ga0068863_100126845 | 3300005841 | Bacteria | 2435 |
| 144 | Ga0068858_100041846 | 3300005842 | Bacteria | 4247 |
| 145 | Ga0068858_100099131 | 3300005842 | Bacteria | 2717 |
| 146 | Ga0068858_100667818 | 3300005842 | Bacteria | 1010 |
| 147 | Ga0068862_100084148 | 3300005844 | Bacteria | 2763 |
| 148 | Ga0068862_100634234 | 3300005844 | Bacteria | 1029 |
| 149 | Ga0081539_10000014 | 3300005985 | Bacteria | 411270 |
| 150 | Ga0081539_10000710 | 3300005985 | Bacteria | 66710 |
| 151 | Ga0081539_10006328 | 3300005985 | Bacteria | 11428 |
| 152 | Ga0070717_10013229 | 3300006028 | Bacteria | 6315 |
| 153 | Ga0070717_10043561 | 3300006028 | Unclassified | 3664 |
| 154 | Ga0070717_10086635 | 3300006028 | Bacteria | 2637 |
| 155 | Ga0070717_10131430 | 3300006028 | Bacteria | 2153 |
| 156 | Ga0070717_10199955 | 3300006028 | Bacteria | 1750 |
| 157 | Ga0070716_100058213 | 3300006173 | Bacteria | 2223 |
| 158 | Ga0070712_100009931 | 3300006175 | Bacteria | 6000 |
| 159 | Ga0070712_100022325 | 3300006175 | Unclassified | 4168 |
| 160 | Ga0070712_100052217 | 3300006175 | Unclassified | 2850 |
| 161 | Ga0070712_100112065 | 3300006175 | Bacteria | 2038 |
| 162 | Ga0070712_100239676 | 3300006175 | Bacteria | 1444 |
| 163 | Ga0070712_100316698 | 3300006175 | Bacteria | 1267 |
| 164 | Ga0097621_100004502 | 3300006237 | Bacteria | 9716 |
| 165 | Ga0097621_100081762 | 3300006237 | Bacteria | 2689 |
| 166 | Ga0097621_100308188 | 3300006237 | Bacteria | 1400 |
| 167 | Ga0097621_100388288 | 3300006237 | Bacteria | 1248 |
| 168 | Ga0068871_100040008 | 3300006358 | Bacteria | 3754 |
| 169 | Ga0068871_100195222 | 3300006358 | Unclassified | 1745 |
| 170 | Ga0068871_100303880 | 3300006358 | Bacteria | 1401 |
| 171 | Ga0075430_100021635 | 3300006846 | Bacteria | 5465 |
| 172 | Ga0075434_100197461 | 3300006871 | Bacteria | 2032 |
| 173 | Ga0068865_100098170 | 3300006881 | Bacteria | 2139 |
| 174 | Ga0068865_100238865 | 3300006881 | Bacteria | 1429 |
| 175 | Ga0097620_100874702 | 3300006931 | Bacteria | 984 |
| 176 | Ga0099795_10003993 | 3300007788 | Bacteria | 3744 |
| 177 | Ga0099795_10077478 | 3300007788 | Unclassified | 1266 |
| 178 | Ga0105240_10000057 | 3300009093 | Bacteria | 222664 |
| 179 | Ga0105240_10018462 | 3300009093 | Bacteria | 9365 |
| 180 | Ga0111539_10112062 | 3300009094 | Bacteria | 3200 |
| 181 | Ga0111539_10298822 | 3300009094 | Bacteria | 1874 |
| 182 | Ga0105245_10024665 | 3300009098 | Bacteria | 5283 |
| 183 | Ga0105245_10084114 | 3300009098 | Bacteria | 2914 |
| 184 | Ga0105245_10150385 | 3300009098 | Bacteria | 2201 |
| 185 | Ga0105245_10205710 | 3300009098 | Bacteria | 1892 |
| 186 | Ga0105247_10042622 | 3300009101 | Bacteria | 2780 |
| 187 | Ga0114129_10907403 | 3300009147 | Bacteria | 1116 |
| 188 | Ga0105241_10352370 | 3300009174 | Bacteria | 1278 |
| 189 | Ga0105242_10007257 | 3300009176 | Bacteria | 8547 |
| 190 | Ga0105242_10016185 | 3300009176 | Bacteria | 5794 |
| 191 | Ga0105237_10005488 | 3300009545 | Bacteria | 14297 |
| 192 | Ga0105249_10285746 | 3300009553 | Bacteria | 1649 |
| 193 | Ga0099796_10021508 | 3300010159 | Bacteria | 1987 |
| 194 | Ga0105239_10035778 | 3300010375 | Bacteria | 5453 |
| 195 | Ga0105239_10201434 | 3300010375 | Bacteria | 2230 |
| 196 | Ga0105239_10279156 | 3300010375 | Bacteria | 1880 |
| 197 | Ga0157373_10127739 | 3300013100 | Bacteria | 1788 |
| 198 | Ga0157371_10187751 | 3300013102 | Unclassified | 1479 |
| 199 | Ga0157370_10095063 | 3300013104 | Bacteria | 2796 |
| 200 | Ga0157370_10199597 | 3300013104 | Bacteria | 1856 |
| 201 | Ga0157369_10100533 | 3300013105 | Bacteria | 3082 |
| 202 | Ga0157369_10188536 | 3300013105 | Bacteria | 2167 |
| 203 | Ga0157369_10242375 | 3300013105 | Bacteria | 1883 |
| 204 | Ga0157374_10011892 | 3300013296 | Bacteria | 7552 |
| 205 | Ga0157374_10033019 | 3300013296 | Bacteria | 4719 |
| 206 | Ga0157374_10054807 | 3300013296 | Unclassified | 3720 |
| 207 | Ga0157374_10447850 | 3300013296 | Unclassified | 1292 |
| 208 | Ga0157378_10032112 | 3300013297 | Bacteria | 4638 |
| 209 | Ga0157378_10039368 | 3300013297 | Bacteria | 4193 |
| 210 | Ga0157378_10177214 | 3300013297 | Unclassified | 2003 |
| 211 | Ga0157378_10180162 | 3300013297 | Unclassified | 1987 |
| 212 | Ga0163162_10020938 | 3300013306 | Bacteria | 6432 |
| 213 | Ga0163162_10026233 | 3300013306 | Bacteria | 5759 |
| 214 | Ga0163162_10157827 | 3300013306 | Bacteria | 2389 |
| 215 | Ga0163162_10818274 | 3300013306 | Bacteria | 1048 |
| 216 | Ga0157372_10067032 | 3300013307 | Bacteria | 4033 |
| 217 | Ga0157372_10131216 | 3300013307 | Bacteria | 2883 |
| 218 | Ga0157372_10426175 | 3300013307 | Bacteria | 1546 |
| 219 | Ga0157375_10003770 | 3300013308 | Bacteria | 13135 |
| 220 | Ga0157375_10009538 | 3300013308 | Bacteria | 8522 |
| 221 | Ga0157375_10034179 | 3300013308 | Bacteria | 4841 |
| 222 | Ga0157375_10112623 | 3300013308 | Bacteria | 2821 |
| 223 | Ga0157375_10166101 | 3300013308 | Bacteria | 2352 |
| 224 | Ga0157375_10235877 | 3300013308 | Bacteria | 1988 |
| 225 | Ga0157375_10383176 | 3300013308 | Bacteria | 1573 |
| 226 | Ga0163163_10121331 | 3300014325 | Bacteria | 2648 |
| 227 | Ga0157379_10636717 | 3300014968 | Bacteria | 997 |
| 228 | Ga0157376_10007798 | 3300014969 | Bacteria | 7672 |
| 229 | Ga0163161_10000942 | 3300017792 | Bacteria | 22392 |
| 230 | Ga0213872_10011117 | 3300021361 | Bacteria | 4265 |
| 231 | Ga0213872_10021749 | 3300021361 | Unclassified | 2954 |
| 232 | Ga0213872_10043134 | 3300021361 | Unclassified | 2056 |
| 233 | Ga0213872_10081131 | 3300021361 | Bacteria | 1457 |
| 234 | Ga0213872_10100578 | 3300021361 | Unclassified | 1289 |
| 235 | Ga0213874_10015345 | 3300021377 | Bacteria | 2019 |
| 236 | Ga0213876_10001438 | 3300021384 | Bacteria | 14813 |
| 237 | Ga0213876_10015390 | 3300021384 | Bacteria | 4048 |
| 238 | Ga0213871_10004130 | 3300021441 | Bacteria | 2876 |
| 239 | Ga0213871_10015935 | 3300021441 | Unclassified | 1804 |
| 240 | Ga0207673_1003719 | 3300025290 | Bacteria | 1797 |
| 241 | Ga0207697_10000238 | 3300025315 | Bacteria | 29919 |
| 242 | Ga0207697_10000262 | 3300025315 | Bacteria | 28988 |
| 243 | Ga0207697_10018575 | 3300025315 | Bacteria | 2851 |
| 244 | Ga0207697_10099162 | 3300025315 | Bacteria | 1241 |
| 245 | Ga0207642_10139221 | 3300025899 | Bacteria | 1277 |
| 246 | Ga0207688_10000429 | 3300025901 | Bacteria | 19807 |
| 247 | Ga0207688_10000823 | 3300025901 | Bacteria | 15526 |
| 248 | Ga0207680_10026298 | 3300025903 | Bacteria | 3224 |
| 249 | Ga0207680_10031477 | 3300025903 | Bacteria | 3005 |
| 250 | Ga0207680_10040126 | 3300025903 | Bacteria | 2721 |
| 251 | Ga0207680_10156307 | 3300025903 | Bacteria | 1525 |
| 252 | Ga0207699_10004399 | 3300025906 | Bacteria | 6739 |
| 253 | Ga0207699_10183450 | 3300025906 | Bacteria | 1408 |
| 254 | Ga0207699_10315003 | 3300025906 | Bacteria | 1096 |
| 255 | Ga0207699_10349132 | 3300025906 | Bacteria | 1044 |
| 256 | Ga0207645_10000823 | 3300025907 | Bacteria | 25996 |
| 257 | Ga0207645_10015174 | 3300025907 | Bacteria | 5130 |
| 258 | Ga0207645_10040071 | 3300025907 | Bacteria | 3000 |
| 259 | Ga0207645_10091809 | 3300025907 | Bacteria | 1953 |
| 260 | Ga0207705_10058972 | 3300025909 | Bacteria | 2769 |
| 261 | Ga0207684_10001687 | 3300025910 | Bacteria | 23476 |
| 262 | Ga0207684_10049137 | 3300025910 | Bacteria | 3579 |
| 263 | Ga0207684_10120686 | 3300025910 | Bacteria | 2247 |
| 264 | Ga0207684_10152052 | 3300025910 | Bacteria | 1991 |
| 265 | Ga0207684_10188176 | 3300025910 | Unclassified | 1780 |
| 266 | Ga0207684_10214002 | 3300025910 | Unclassified | 1662 |
| 267 | Ga0207684_10238014 | 3300025910 | Bacteria | 1570 |
| 268 | Ga0207684_10307092 | 3300025910 | Viruses | 1367 |
| 269 | Ga0207695_10000072 | 3300025913 | Bacteria | 312795 |
| 270 | Ga0207695_10000450 | 3300025913 | Bacteria | 89495 |
| 271 | Ga0207671_10039468 | 3300025914 | Unclassified | 3495 |
| 272 | Ga0207693_10002474 | 3300025915 | Bacteria | 16059 |
| 273 | Ga0207693_10006817 | 3300025915 | Bacteria | 9431 |
| 274 | Ga0207693_10070160 | 3300025915 | Bacteria | 2742 |
| 275 | Ga0207693_10101281 | 3300025915 | Unclassified | 2258 |
| 276 | Ga0207693_10119018 | 3300025915 | Bacteria | 2074 |
| 277 | Ga0207663_10001758 | 3300025916 | Bacteria | 10214 |
| 278 | Ga0207663_10138907 | 3300025916 | Bacteria | 1690 |
| 279 | Ga0207663_10155606 | 3300025916 | Bacteria | 1608 |
| 280 | Ga0207663_10533298 | 3300025916 | Bacteria | 916 |
| 281 | Ga0207662_10064006 | 3300025918 | Bacteria | 2212 |
| 282 | Ga0207657_10106039 | 3300025919 | Bacteria | 2326 |
| 283 | Ga0207649_10329054 | 3300025920 | Bacteria | 1125 |
| 284 | Ga0207646_10000513 | 3300025922 | Bacteria | 51606 |
| 285 | Ga0207646_10066818 | 3300025922 | Unclassified | 3210 |
| 286 | Ga0207646_10104602 | 3300025922 | Unclassified | 2539 |
| 287 | Ga0207646_10447152 | 3300025922 | Unclassified | 1166 |
| 288 | Ga0207681_10011020 | 3300025923 | Bacteria | 5552 |
| 289 | Ga0207681_10022182 | 3300025923 | Bacteria | 4046 |
| 290 | Ga0207650_10021161 | 3300025925 | Bacteria | 4597 |
| 291 | Ga0207650_10048973 | 3300025925 | Bacteria | 3118 |
| 292 | Ga0207650_10147270 | 3300025925 | Bacteria | 1855 |
| 293 | Ga0207650_10215342 | 3300025925 | Bacteria | 1544 |
| 294 | Ga0207659_10007927 | 3300025926 | Bacteria | 6567 |
| 295 | Ga0207659_10063229 | 3300025926 | Bacteria | 2675 |
| 296 | Ga0207659_10063739 | 3300025926 | Bacteria | 2666 |
| 297 | Ga0207659_10098013 | 3300025926 | Bacteria | 2204 |
| 298 | Ga0207687_10037865 | 3300025927 | Bacteria | 3293 |
| 299 | Ga0207687_10150507 | 3300025927 | Bacteria | 1775 |
| 300 | Ga0207700_10034697 | 3300025928 | Bacteria | 3625 |
| 301 | Ga0207700_10075642 | 3300025928 | Bacteria | 2610 |
| 302 | Ga0207664_10139724 | 3300025929 | Bacteria | 2048 |
| 303 | Ga0207664_10146017 | 3300025929 | Unclassified | 2006 |
| 304 | Ga0207664_10197020 | 3300025929 | Bacteria | 1737 |
| 305 | Ga0207664_10207085 | 3300025929 | Bacteria | 1695 |
| 306 | Ga0207664_10218473 | 3300025929 | Bacteria | 1652 |
| 307 | Ga0207644_10005188 | 3300025931 | Bacteria | 8512 |
| 308 | Ga0207644_10034397 | 3300025931 | Bacteria | 3545 |
| 309 | Ga0207644_10086924 | 3300025931 | Bacteria | 2322 |
| 310 | Ga0207644_10106055 | 3300025931 | Bacteria | 2118 |
| 311 | Ga0207644_10178446 | 3300025931 | Bacteria | 1663 |
| 312 | Ga0207644_10279564 | 3300025931 | Bacteria | 1340 |
| 313 | Ga0207644_10532932 | 3300025931 | Bacteria | 971 |
| 314 | Ga0207690_10108432 | 3300025932 | Bacteria | 1996 |
| 315 | Ga0207706_10036106 | 3300025933 | Bacteria | 4391 |
| 316 | Ga0207706_10084820 | 3300025933 | Bacteria | 2785 |
| 317 | Ga0207706_10151613 | 3300025933 | Unclassified | 2038 |
| 318 | Ga0207686_10008278 | 3300025934 | Bacteria | 5611 |
| 319 | Ga0207686_10311426 | 3300025934 | Unclassified | 1173 |
| 320 | Ga0207670_10553891 | 3300025936 | Bacteria | 940 |
| 321 | Ga0207669_10009962 | 3300025937 | Bacteria | 4555 |
| 322 | Ga0207669_10012468 | 3300025937 | Unclassified | 4181 |
| 323 | Ga0207669_10062587 | 3300025937 | Bacteria | 2292 |
| 324 | Ga0207669_10081094 | 3300025937 | Bacteria | 2077 |
| 325 | Ga0207669_10277044 | 3300025937 | Unclassified | 1263 |
| 326 | Ga0207704_10032009 | 3300025938 | Bacteria | 2971 |
| 327 | Ga0207704_10393596 | 3300025938 | Bacteria | 1091 |
| 328 | Ga0207665_10010290 | 3300025939 | Bacteria | 6141 |
| 329 | Ga0207691_10000306 | 3300025940 | Bacteria | 48746 |
| 330 | Ga0207691_10003086 | 3300025940 | Bacteria | 16247 |
| 331 | Ga0207691_10003406 | 3300025940 | Bacteria | 15457 |
| 332 | Ga0207691_10036248 | 3300025940 | Bacteria | 4570 |
| 333 | Ga0207691_10358566 | 3300025940 | Unclassified | 1247 |
| 334 | Ga0207679_10118737 | 3300025945 | Bacteria | 2101 |
| 335 | Ga0207667_10025782 | 3300025949 | Bacteria | 6431 |
| 336 | Ga0207651_10045287 | 3300025960 | Bacteria | 2950 |
| 337 | Ga0207651_10052267 | 3300025960 | Bacteria | 2785 |
| 338 | Ga0207651_10105071 | 3300025960 | Bacteria | 2105 |
| 339 | Ga0207651_10253309 | 3300025960 | Bacteria | 1441 |
| 340 | Ga0207668_10011447 | 3300025972 | Bacteria | 5391 |
| 341 | Ga0207668_10021024 | 3300025972 | Bacteria | 4156 |
| 342 | Ga0207668_10025525 | 3300025972 | Bacteria | 3825 |
| 343 | Ga0207668_10227849 | 3300025972 | Bacteria | 1500 |
| 344 | Ga0207668_10536475 | 3300025972 | Bacteria | 1012 |
| 345 | Ga0207658_10146322 | 3300025986 | Bacteria | 1919 |
| 346 | Ga0207658_10488118 | 3300025986 | Bacteria | 1095 |
| 347 | Ga0207677_10007188 | 3300026023 | Bacteria | 6136 |
| 348 | Ga0207677_10054821 | 3300026023 | Bacteria | 2723 |
| 349 | Ga0207703_10026174 | 3300026035 | Bacteria | 4590 |
| 350 | Ga0207703_10347165 | 3300026035 | Bacteria | 1365 |
| 351 | Ga0207703_10709336 | 3300026035 | Bacteria | 957 |
| 352 | Ga0207639_10000019 | 3300026041 | Bacteria | 246728 |
| 353 | Ga0207678_10618252 | 3300026067 | Bacteria | 950 |
| 354 | Ga0207702_10045597 | 3300026078 | Bacteria | 3688 |
| 355 | Ga0207702_10148752 | 3300026078 | Bacteria | 2128 |
| 356 | Ga0207641_10025333 | 3300026088 | Bacteria | 4891 |
| 357 | Ga0207641_10136286 | 3300026088 | Bacteria | 2210 |
| 358 | Ga0207648_10014184 | 3300026089 | Bacteria | 7369 |
| 359 | Ga0207676_10102430 | 3300026095 | Bacteria | 2377 |
| 360 | Ga0207674_10003625 | 3300026116 | Bacteria | 18829 |
| 361 | Ga0207683_10002031 | 3300026121 | Bacteria | 17894 |
| 362 | Ga0207683_10019180 | 3300026121 | Bacteria | 5840 |
| 363 | Ga0207683_10021171 | 3300026121 | Bacteria | 5565 |
| 364 | Ga0268266_10010104 | 3300028379 | Bacteria | 8274 |
| 365 | Ga0268266_10020958 | 3300028379 | Bacteria | 5572 |
| 366 | Ga0268266_10279768 | 3300028379 | Bacteria | 1551 |
| 367 | Ga0268266_10342542 | 3300028379 | Bacteria | 1403 |
| 368 | Ga0268266_10428906 | 3300028379 | Bacteria | 1254 |
| 369 | Ga0268265_10049204 | 3300028380 | Bacteria | 3169 |
| 370 | Ga0268265_10575427 | 3300028380 | Bacteria | 1073 |
| 371 | Ga0268264_10043163 | 3300028381 | Bacteria | 3736 |
| 372 | Ga0265330_10150754 | 3300031235 | Bacteria | 988 |
| 373 | Ga0265316_10208554 | 3300031344 | Bacteria | 1446 |
| 374 | Ga0307513_10137766 | 3300031456 | Bacteria | 2373 |
| 375 | Ga0307413_10307916 | 3300031824 | Bacteria | 1204 |
| 376 | Ga0307410_10025821 | 3300031852 | Bacteria | 3690 |
| 377 | Ga0307409_100118727 | 3300031995 | Bacteria | 2234 |
| 378 | Ga0307409_100433081 | 3300031995 | Bacteria | 1265 |
| 379 | Ga0307416_100082683 | 3300032002 | Bacteria | 2721 |
| 380 | Ga0307416_100557434 | 3300032002 | Bacteria | 1220 |
| 381 | Ga0307416_100973830 | 3300032002 | Bacteria | 951 |
| 382 | Ga0307411_10141997 | 3300032005 | Bacteria | 1772 |
| 383 | Ga0373926_0048133 | 3300035083 | Bacteria | 1533 |
| 384 | Ga0373954_0204689 | 3300035118 | Bacteria | 970 |
| 385 | Ga0373943_0128896 | 3300035170 | Bacteria | 1352 |
| 386 | Ga0373946_0011788 | 3300035171 | Bacteria | 3268 |
| 387 | Ga0373955_0020926 | 3300035172 | Bacteria | 3294 |
| 388 | Ga0373924_0036750 | 3300035410 | Bacteria | 1992 |
| 389 | Ga0373931_0214025 | 3300035691 | Bacteria | 1157 |
| 390 | Ga0373935_0010731 | 3300035692 | Bacteria | 5504 |
| 391 | Ga0373935_0076518 | 3300035692 | Bacteria | 2167 |
| 392 | Ga0373947_0033533 | 3300035725 | Bacteria | 3032 |
| 393 | Ga0373937_0007726 | 3300036401 | Bacteria | 9320 |
| 394 | Ga0373937_0142912 | 3300036401 | Bacteria | 2239 |
| 395 | Ga0373937_0393484 | 3300036401 | Bacteria | 1315 |
| 396 | Ga0373925_0174691 | 3300037068 | Bacteria | 1697 |
| 397 | Ga0373925_0539072 | 3300037068 | Bacteria | 959 |
| 398 | Ga0395899_0190865 | 3300037312 | Bacteria | 1434 |
| 399 | Ga0395900_0387631 | 3300037418 | Bacteria | 1364 |
| 400 | Ga0436364_0367939 | 3300037853 | Bacteria | 2351 |
| 401 | Ga0436364_1196405 | 3300037853 | Bacteria | 2969 |
| 402 | Ga0395901_0012233 | 3300038443 | Bacteria | 8710 |
| 403 | Ga0395901_0103973 | 3300038443 | Bacteria | 2980 |
| 404 | Ga0436365_0071258 | 3300039437 | Bacteria | 37638 |
| 405 | Ga0436365_0761885 | 3300039437 | Bacteria | 4673 |
| 406 | Ga0436365_0818660 | 3300039437 | Bacteria | 34963 |
| 407 | Ga0436365_0831869 | 3300039437 | Unclassified | 3457 |
| 408 | Ga0436365_1923965 | 3300039437 | Bacteria | 20645 |
| 409 | Ga0436360_0105884 | 3300039438 | Bacteria | 9726 |
| 410 | Ga0436360_0554333 | 3300039438 | Bacteria | 6664 |
| 411 | Ga0436360_0829103 | 3300039438 | Bacteria | 1943 |
| 412 | Ga0436360_0832359 | 3300039438 | Bacteria | 4519 |
| 413 | Ga0436360_0981398 | 3300039438 | Unclassified | 2894 |
| 414 | Ga0436361_0132728 | 3300039447 | Bacteria | 1619 |
| 415 | Ga0436361_0138991 | 3300039447 | Bacteria | 1710 |
| 416 | Ga0436361_0172514 | 3300039447 | Bacteria | 2421 |
| 417 | Ga0436361_0266084 | 3300039447 | Bacteria | 1102 |
| 418 | Ga0436361_0381704 | 3300039447 | Unclassified | 3538 |
| 419 | Ga0436361_0432650 | 3300039447 | Unclassified | 1672 |
| 420 | Ga0436361_0523568 | 3300039447 | Bacteria | 6663 |
| 421 | Ga0436361_0955202 | 3300039447 | Bacteria | 2608 |
| 422 | Ga0436361_1041738 | 3300039447 | Bacteria | 4500 |
| 423 | Ga0436361_1194033 | 3300039447 | Bacteria | 6040 |
| 424 | Ga0436363_0639431 | 3300039450 | Bacteria | 4729 |
| 425 | Ga0436363_1682874 | 3300039450 | Bacteria | 1552 |
| 426 | Ga0436362_0402008 | 3300039453 | Unclassified | 2380 |
| 427 | Ga0436362_0556011 | 3300039453 | Unclassified | 963 |
| 428 | Ga0451807_0876074 | 3300041486 | Viruses | 1087 |
| 429 | Ga0451576_0033056 | 3300045051 | Bacteria | 5500 |
| 430 | Ga0451576_0803002 | 3300045051 | Bacteria | 988 |
| 431 | Ga0466967_0316681 | 3300045976 | Bacteria | 1504 |
| 432 | Ga0495592_0048276 | 3300046454 | Bacteria | 3167 |
| 433 | Ga0495608_0240038 | 3300046511 | Bacteria | 1132 |
| 434 | Ga0495630_0000483 | 3300046517 | Bacteria | 29587 |
| 435 | Ga0495630_0041259 | 3300046517 | Bacteria | 3446 |
| 436 | Ga0495643_0000105 | 3300046522 | Bacteria | 139396 |
| 437 | Ga0495652_0020595 | 3300046529 | Bacteria | 5861 |
| 438 | Ga0495640_0039060 | 3300046533 | Bacteria | 3334 |
| 439 | Ga0495640_0254874 | 3300046533 | Bacteria | 1098 |
| 440 | Ga0495586_0122231 | 3300046535 | Bacteria | 1455 |
| 441 | Ga0495645_0051896 | 3300046543 | Bacteria | 2984 |
| 442 | Ga0495667_0311402 | 3300046559 | Bacteria | 997 |
| 443 | Ga0495656_0088395 | 3300046615 | Bacteria | 1412 |
| 444 | Ga0495634_0125553 | 3300046642 | Bacteria | 1640 |
| 445 | Ga0495659_0117514 | 3300046664 | Bacteria | 1044 |
| 446 | Ga0495657_0212005 | 3300046675 | Bacteria | 1177 |
| 447 | Ga0495646_0072704 | 3300046680 | Bacteria | 2022 |
| 448 | Ga0495658_0170572 | 3300046683 | Bacteria | 1346 |
| 449 | Ga0495613_0002425 | 3300046689 | Bacteria | 14076 |
| 450 | Ga0495613_0105084 | 3300046689 | Bacteria | 2039 |
| 451 | Ga0495624_0081404 | 3300046690 | Bacteria | 2005 |
| 452 | Ga0495600_0076220 | 3300046809 | Bacteria | 2190 |
| 453 | Ga0495581_0041815 | 3300047315 | Bacteria | 2653 |
| 454 | Ga0495674_0017129 | 3300047319 | Bacteria | 6749 |
| 455 | Ga0495674_0179986 | 3300047319 | Bacteria | 1761 |
| 456 | Ga0495684_0002085 | 3300047471 | Bacteria | 16076 |
| 457 | Ga0495684_0084626 | 3300047471 | Bacteria | 2406 |
| 458 | Ga0495684_0105987 | 3300047471 | Bacteria | 2124 |
| 459 | Ga0495684_0249450 | 3300047471 | Bacteria | 1292 |
| 460 | Ga0496100_0002986 | 3300048903 | Bacteria | 8708 |
| 461 | Ga0496100_0034627 | 3300048903 | Bacteria | 3171 |
| 462 | Ga0496101_0045884 | 3300048904 | Bacteria | 3132 |
| 463 | Ga0496102_0679097 | 3300048905 | Bacteria | 953 |
| 464 | Ga0496103_0003746 | 3300048906 | Bacteria | 9248 |
| 465 | Ga0496104_0014922 | 3300048907 | Bacteria | 7024 |
| 466 | Ga0496104_0141459 | 3300048907 | Unclassified | 2311 |
| 467 | Ga0496104_0224590 | 3300048907 | Bacteria | 1790 |
| 468 | Ga0496106_0000430 | 3300048909 | Bacteria | 29885 |
| 469 | Ga0496107_0000174 | 3300048910 | Bacteria | 33216 |
| 470 | Ga0496108_0017250 | 3300048911 | Bacteria | 5905 |
| 471 | Ga0496108_0452049 | 3300048911 | Bacteria | 1122 |
| 472 | Ga0496108_0627917 | 3300048911 | Unclassified | 935 |
| 473 | Ga0496109_0055891 | 3300048912 | Bacteria | 3601 |
| 474 | Ga0496109_0104354 | 3300048912 | Bacteria | 2632 |
| 475 | Ga0496109_0149302 | 3300048912 | Bacteria | 2188 |
| 476 | Ga0496109_0548937 | 3300048912 | Unclassified | 1090 |
| 477 | Ga0496111_0303169 | 3300048914 | Bacteria | 1184 |
| 478 | Ga0496112_0006024 | 3300048915 | Bacteria | 10583 |
| 479 | Ga0496112_0010611 | 3300048915 | Bacteria | 8370 |
| 480 | Ga0496112_0011331 | 3300048915 | Bacteria | 8137 |
| 481 | Ga0496112_0016762 | 3300048915 | Bacteria | 6871 |
| 482 | Ga0496112_0019136 | 3300048915 | Bacteria | 6457 |
| 483 | Ga0496113_0042830 | 3300048916 | Unclassified | 3347 |
| 484 | Ga0496113_0141403 | 3300048916 | Bacteria | 1894 |
| 485 | Ga0496114_0024795 | 3300048917 | Bacteria | 4897 |
| 486 | Ga0496115_0003485 | 3300048918 | Bacteria | 11311 |
| 487 | Ga0496115_0035536 | 3300048918 | Bacteria | 3942 |
| 488 | Ga0496115_0338787 | 3300048918 | Bacteria | 1228 |
| 489 | Ga0501032_0039123 | 3300049569 | Bacteria | 3227 |
| 490 | Ga0501034_0003936 | 3300049571 | Bacteria | 16694 |
| 491 | Ga0501037_0019049 | 3300049573 | Bacteria | 5060 |
| 492 | Ga0501047_0006754 | 3300049581 | Bacteria | 10783 |
| 493 | Ga0501080_0013875 | 3300049742 | Bacteria | 7417 |
| 494 | Ga0501080_0039506 | 3300049742 | Bacteria | 4404 |
| 495 | Ga0501044_0000774 | 3300049823 | Bacteria | 38751 |
| 496 | Ga0501044_0140375 | 3300049823 | Bacteria | 2405 |
| 497 | nmdc:mga08y16_280607_c1 | 3300050511 | Bacteria | 1718 |
| 498 | nmdc:mga08y16_315830_c1 | 3300050511 | Bacteria | 1609 |
| 499 | nmdc:mga0n895_38298_c1 | 3300050512 | Unclassified | 4644 |
| 500 | nmdc:mga0rr50_261729_c1 | 3300050513 | Unclassified | 1439 |
| 501 | Ga0495601_0134467 | 3300053077 | Bacteria | 1611 |
| 502 | Ga0495619_0116979 | 3300053085 | Bacteria | 1825 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046533 | Ga0495640_0254874 | Ga0495640_0254874_10_756 | 240 |
| 2 | 3300005844 | Ga0068862_100634234 | Ga0068862_1006342342 | 242 |
| 3 | 3300026067 | Ga0207678_10618252 | Ga0207678_106182522 | 244 |
| 4 | 3300005327 | Ga0070658_10029659 | Ga0070658_100296593 | 245 |
| 5 | 3300005617 | Ga0068859_100874871 | Ga0068859_1008748712 | 246 |
| 6 | 3300006931 | Ga0097620_100874702 | Ga0097620_1008747021 | 246 |
| 7 | 3300005539 | Ga0068853_100000011 | Ga0068853_10000001141 | 248 |
| 8 | 3300026041 | Ga0207639_10000019 | Ga0207639_10000019151 | 248 |
| 9 | 3300005435 | Ga0070714_100098117 | Ga0070714_1000981172 | 249 |
| 10 | 3300005563 | Ga0068855_100327224 | Ga0068855_1003272242 | 249 |
| 11 | 3300005563 | Ga0068855_100855140 | Ga0068855_1008551401 | 249 |
| 12 | 3300009093 | Ga0105240_10018462 | Ga0105240_100184622 | 249 |
| 13 | 3300009098 | Ga0105245_10024665 | Ga0105245_100246653 | 249 |
| 14 | 3300010375 | Ga0105239_10279156 | Ga0105239_102791562 | 249 |
| 15 | 3300013104 | Ga0157370_10199597 | Ga0157370_101995972 | 249 |
| 16 | 3300013105 | Ga0157369_10100533 | Ga0157369_101005332 | 249 |
| 17 | 3300013307 | Ga0157372_10131216 | Ga0157372_101312162 | 249 |
| 18 | 3300025913 | Ga0207695_10000450 | Ga0207695_1000045038 | 249 |
| 19 | 3300025927 | Ga0207687_10037865 | Ga0207687_100378653 | 249 |
| 20 | 3300025929 | Ga0207664_10139724 | Ga0207664_101397242 | 249 |
| 21 | 3300025929 | Ga0207664_10197020 | Ga0207664_101970201 | 249 |
| 22 | 3300026078 | Ga0207702_10045597 | Ga0207702_100455975 | 249 |
| 23 | 3300039447 | Ga0436361_0955202 | Ga0436361_0955202_433_1218 | 249 |
| 24 | 3300005436 | Ga0070713_100677211 | Ga0070713_1006772111 | 250 |
| 25 | 3300009093 | Ga0105240_10000057 | Ga0105240_1000005722 | 250 |
| 26 | 3300009553 | Ga0105249_10285746 | Ga0105249_102857463 | 250 |
| 27 | 3300025913 | Ga0207695_10000072 | Ga0207695_1000007222 | 250 |
| 28 | 3300025933 | Ga0207706_10084820 | Ga0207706_100848203 | 250 |
| 29 | 3300049742 | Ga0501080_0039506 | Ga0501080_0039506_904_1674 | 250 |
| 30 | 3300005290 | Ga0065712_10151695 | Ga0065712_101516952 | 251 |
| 31 | 3300005327 | Ga0070658_10020004 | Ga0070658_100200042 | 251 |
| 32 | 3300005339 | Ga0070660_100064592 | Ga0070660_1000645922 | 251 |
| 33 | 3300005842 | Ga0068858_100041846 | Ga0068858_1000418462 | 251 |
| 34 | 3300006028 | Ga0070717_10131430 | Ga0070717_101314302 | 251 |
| 35 | 3300006358 | Ga0068871_100195222 | Ga0068871_1001952222 | 251 |
| 36 | 3300009174 | Ga0105241_10352370 | Ga0105241_103523702 | 251 |
| 37 | 3300009545 | Ga0105237_10005488 | Ga0105237_1000548813 | 251 |
| 38 | 3300013105 | Ga0157369_10242375 | Ga0157369_102423752 | 251 |
| 39 | 3300025914 | Ga0207671_10039468 | Ga0207671_100394682 | 251 |
| 40 | 3300026035 | Ga0207703_10026174 | Ga0207703_100261743 | 251 |
| 41 | 3300046689 | Ga0495613_0105084 | Ga0495613_0105084_1103_1903 | 251 |
| 42 | 3300005327 | Ga0070658_10134476 | Ga0070658_101344762 | 252 |
| 43 | 3300005338 | Ga0068868_100493100 | Ga0068868_1004931001 | 252 |
| 44 | 3300005344 | Ga0070661_100113246 | Ga0070661_1001132462 | 252 |
| 45 | 3300005548 | Ga0070665_100732598 | Ga0070665_1007325981 | 252 |
| 46 | 3300005563 | Ga0068855_100080775 | Ga0068855_1000807753 | 252 |
| 47 | 3300006846 | Ga0075430_100021635 | Ga0075430_1000216355 | 252 |
| 48 | 3300009098 | Ga0105245_10150385 | Ga0105245_101503852 | 252 |
| 49 | 3300009098 | Ga0105245_10205710 | Ga0105245_102057102 | 252 |
| 50 | 3300013100 | Ga0157373_10127739 | Ga0157373_101277392 | 252 |
| 51 | 3300013104 | Ga0157370_10095063 | Ga0157370_100950632 | 252 |
| 52 | 3300013105 | Ga0157369_10188536 | Ga0157369_101885362 | 252 |
| 53 | 3300013307 | Ga0157372_10067032 | Ga0157372_100670322 | 252 |
| 54 | 3300025920 | Ga0207649_10329054 | Ga0207649_103290542 | 252 |
| 55 | 3300025927 | Ga0207687_10150507 | Ga0207687_101505072 | 252 |
| 56 | 3300025929 | Ga0207664_10218473 | Ga0207664_102184732 | 252 |
| 57 | 3300026116 | Ga0207674_10003625 | Ga0207674_100036258 | 252 |
| 58 | 3300028379 | Ga0268266_10279768 | Ga0268266_102797681 | 252 |
| 59 | 3300037312 | Ga0395899_0190865 | Ga0395899_0190865_496_1299 | 252 |
| 60 | 3300038443 | Ga0395901_0103973 | Ga0395901_0103973_1635_2438 | 252 |
| 61 | 3300046517 | Ga0495630_0000483 | Ga0495630_0000483_10627_11430 | 252 |
| 62 | 3300046522 | Ga0495643_0000105 | Ga0495643_0000105_38488_39267 | 252 |
| 63 | 3300046615 | Ga0495656_0088395 | Ga0495656_0088395_544_1350 | 252 |
| 64 | 3300046642 | Ga0495634_0125553 | Ga0495634_0125553_51_854 | 252 |
| 65 | 3300046680 | Ga0495646_0072704 | Ga0495646_0072704_1007_1810 | 252 |
| 66 | 3300046690 | Ga0495624_0081404 | Ga0495624_0081404_1129_1932 | 252 |
| 67 | 3300047315 | Ga0495581_0041815 | Ga0495581_0041815_669_1472 | 252 |
| 68 | 3300047319 | Ga0495674_0017129 | Ga0495674_0017129_5691_6494 | 252 |
| 69 | 3300047471 | Ga0495684_0002085 | Ga0495684_0002085_12814_13617 | 252 |
| 70 | 3300005354 | Ga0070675_100158210 | Ga0070675_1001582102 | 253 |
| 71 | 3300005367 | Ga0070667_100035329 | Ga0070667_1000353294 | 253 |
| 72 | 3300005842 | Ga0068858_100667818 | Ga0068858_1006678182 | 253 |
| 73 | 3300005985 | Ga0081539_10006328 | Ga0081539_100063282 | 253 |
| 74 | 3300025903 | Ga0207680_10156307 | Ga0207680_101563071 | 253 |
| 75 | 3300025907 | Ga0207645_10091809 | Ga0207645_100918092 | 253 |
| 76 | 3300025926 | Ga0207659_10063229 | Ga0207659_100632292 | 253 |
| 77 | 3300025937 | Ga0207669_10081094 | Ga0207669_100810942 | 253 |
| 78 | 3300025940 | Ga0207691_10036248 | Ga0207691_100362485 | 253 |
| 79 | 3300025960 | Ga0207651_10045287 | Ga0207651_100452872 | 253 |
| 80 | 3300025972 | Ga0207668_10536475 | Ga0207668_105364751 | 253 |
| 81 | 3300025986 | Ga0207658_10146322 | Ga0207658_101463223 | 253 |
| 82 | 3300026035 | Ga0207703_10709336 | Ga0207703_107093361 | 253 |
| 83 | 3300031995 | Ga0307409_100118727 | Ga0307409_1001187272 | 253 |
| 84 | 3300032002 | Ga0307416_100082683 | Ga0307416_1000826832 | 253 |
| 85 | 3300037418 | Ga0395900_0387631 | Ga0395900_0387631_25_828 | 253 |
| 86 | 3300047471 | Ga0495684_0249450 | Ga0495684_0249450_345_1172 | 253 |
| 87 | 3300005327 | Ga0070658_10159233 | Ga0070658_101592332 | 254 |
| 88 | 3300005548 | Ga0070665_100000772 | Ga0070665_1000007724 | 254 |
| 89 | 3300005563 | Ga0068855_100057644 | Ga0068855_1000576442 | 254 |
| 90 | 3300005618 | Ga0068864_100031014 | Ga0068864_1000310141 | 254 |
| 91 | 3300005841 | Ga0068863_100126845 | Ga0068863_1001268452 | 254 |
| 92 | 3300009147 | Ga0114129_10907403 | Ga0114129_109074032 | 254 |
| 93 | 3300010375 | Ga0105239_10201434 | Ga0105239_102014343 | 254 |
| 94 | 3300013306 | Ga0163162_10818274 | Ga0163162_108182741 | 254 |
| 95 | 3300013307 | Ga0157372_10426175 | Ga0157372_104261752 | 254 |
| 96 | 3300013308 | Ga0157375_10383176 | Ga0157375_103831762 | 254 |
| 97 | 3300025909 | Ga0207705_10058972 | Ga0207705_100589723 | 254 |
| 98 | 3300025949 | Ga0207667_10025782 | Ga0207667_100257822 | 254 |
| 99 | 3300026088 | Ga0207641_10025333 | Ga0207641_100253333 | 254 |
| 100 | 3300026095 | Ga0207676_10102430 | Ga0207676_101024301 | 254 |
| 101 | 3300028379 | Ga0268266_10010104 | Ga0268266_100101042 | 254 |
| 102 | 3300028380 | Ga0268265_10575427 | Ga0268265_105754272 | 254 |
| 103 | 3300031235 | Ga0265330_10150754 | Ga0265330_101507541 | 254 |
| 104 | 3300031344 | Ga0265316_10208554 | Ga0265316_102085541 | 254 |
| 105 | 3300032002 | Ga0307416_100973830 | Ga0307416_1009738301 | 254 |
| 106 | 3300036401 | Ga0373937_0142912 | Ga0373937_0142912_33_836 | 254 |
| 107 | 3300039437 | Ga0436365_0831869 | Ga0436365_0831869_1279_2058 | 254 |
| 108 | 3300039450 | Ga0436363_1682874 | Ga0436363_1682874_563_1342 | 254 |
| 109 | 3300045051 | Ga0451576_0033056 | Ga0451576_0033056_4145_4921 | 254 |
| 110 | 3300046511 | Ga0495608_0240038 | Ga0495608_0240038_156_959 | 254 |
| 111 | 3300046535 | Ga0495586_0122231 | Ga0495586_0122231_222_1025 | 254 |
| 112 | 3300046689 | Ga0495613_0002425 | Ga0495613_0002425_6054_6857 | 254 |
| 113 | 3300046809 | Ga0495600_0076220 | Ga0495600_0076220_355_1158 | 254 |
| 114 | 3300047319 | Ga0495674_0179986 | Ga0495674_0179986_181_984 | 254 |
| 115 | 3300047471 | Ga0495684_0084626 | Ga0495684_0084626_29_832 | 254 |
| 116 | 3300047471 | Ga0495684_0105987 | Ga0495684_0105987_611_1414 | 254 |
| 117 | 3300049569 | Ga0501032_0039123 | Ga0501032_0039123_2048_2851 | 254 |
| 118 | 3300049571 | Ga0501034_0003936 | Ga0501034_0003936_15852_16655 | 254 |
| 119 | 3300049573 | Ga0501037_0019049 | Ga0501037_0019049_3686_4489 | 254 |
| 120 | 3300049581 | Ga0501047_0006754 | Ga0501047_0006754_7264_8067 | 254 |
| 121 | 3300049742 | Ga0501080_0013875 | Ga0501080_0013875_303_1106 | 254 |
| 122 | 3300049823 | Ga0501044_0000774 | Ga0501044_0000774_33303_34106 | 254 |
| 123 | 3300049823 | Ga0501044_0140375 | Ga0501044_0140375_1477_2280 | 254 |
| 124 | 3300005333 | Ga0070677_10138660 | Ga0070677_101386602 | 255 |
| 125 | 3300005354 | Ga0070675_100010789 | Ga0070675_1000107894 | 255 |
| 126 | 3300005467 | Ga0070706_100000973 | Ga0070706_10000097310 | 255 |
| 127 | 3300005471 | Ga0070698_100001144 | Ga0070698_10000114425 | 255 |
| 128 | 3300005471 | Ga0070698_100395986 | Ga0070698_1003959862 | 255 |
| 129 | 3300005530 | Ga0070679_100765796 | Ga0070679_1007657961 | 255 |
| 130 | 3300005536 | Ga0070697_100001763 | Ga0070697_10000176312 | 255 |
| 131 | 3300005536 | Ga0070697_100045936 | Ga0070697_1000459363 | 255 |
| 132 | 3300005546 | Ga0070696_100327680 | Ga0070696_1003276801 | 255 |
| 133 | 3300006028 | Ga0070717_10086635 | Ga0070717_100866352 | 255 |
| 134 | 3300006173 | Ga0070716_100058213 | Ga0070716_1000582132 | 255 |
| 135 | 3300006175 | Ga0070712_100052217 | Ga0070712_1000522173 | 255 |
| 136 | 3300007788 | Ga0099795_10077478 | Ga0099795_100774782 | 255 |
| 137 | 3300009094 | Ga0111539_10112062 | Ga0111539_101120624 | 255 |
| 138 | 3300021361 | Ga0213872_10011117 | Ga0213872_100111173 | 255 |
| 139 | 3300021361 | Ga0213872_10043134 | Ga0213872_100431342 | 255 |
| 140 | 3300021377 | Ga0213874_10015345 | Ga0213874_100153452 | 255 |
| 141 | 3300021384 | Ga0213876_10015390 | Ga0213876_100153902 | 255 |
| 142 | 3300021441 | Ga0213871_10004130 | Ga0213871_100041302 | 255 |
| 143 | 3300021441 | Ga0213871_10015935 | Ga0213871_100159352 | 255 |
| 144 | 3300025906 | Ga0207699_10183450 | Ga0207699_101834502 | 255 |
| 145 | 3300025910 | Ga0207684_10001687 | Ga0207684_1000168711 | 255 |
| 146 | 3300025910 | Ga0207684_10238014 | Ga0207684_102380142 | 255 |
| 147 | 3300025928 | Ga0207700_10034697 | Ga0207700_100346972 | 255 |
| 148 | 3300025928 | Ga0207700_10075642 | Ga0207700_100756423 | 255 |
| 149 | 3300028381 | Ga0268264_10043163 | Ga0268264_100431633 | 255 |
| 150 | 3300031824 | Ga0307413_10307916 | Ga0307413_103079162 | 255 |
| 151 | 3300031852 | Ga0307410_10025821 | Ga0307410_100258214 | 255 |
| 152 | 3300031995 | Ga0307409_100433081 | Ga0307409_1004330812 | 255 |
| 153 | 3300032002 | Ga0307416_100557434 | Ga0307416_1005574341 | 255 |
| 154 | 3300032005 | Ga0307411_10141997 | Ga0307411_101419971 | 255 |
| 155 | 3300037853 | Ga0436364_0367939 | Ga0436364_0367939_1183_1965 | 255 |
| 156 | 3300039437 | Ga0436365_0071258 | Ga0436365_0071258_17116_17898 | 255 |
| 157 | 3300039437 | Ga0436365_0761885 | Ga0436365_0761885_2424_3311 | 255 |
| 158 | 3300039438 | Ga0436360_0554333 | Ga0436360_0554333_2544_3326 | 255 |
| 159 | 3300039438 | Ga0436360_0981398 | Ga0436360_0981398_1479_2261 | 255 |
| 160 | 3300039447 | Ga0436361_0172514 | Ga0436361_0172514_334_1116 | 255 |
| 161 | 3300039447 | Ga0436361_0381704 | Ga0436361_0381704_1791_2573 | 255 |
| 162 | 3300039447 | Ga0436361_0432650 | Ga0436361_0432650_485_1267 | 255 |
| 163 | 3300039447 | Ga0436361_1194033 | Ga0436361_1194033_1606_2388 | 255 |
| 164 | 3300039450 | Ga0436363_0639431 | Ga0436363_0639431_3031_3810 | 255 |
| 165 | 3300039453 | Ga0436362_0402008 | Ga0436362_0402008_634_1416 | 255 |
| 166 | 3300046664 | Ga0495659_0117514 | Ga0495659_0117514_46_915 | 255 |
| 167 | 3300048911 | Ga0496108_0627917 | Ga0496108_0627917_156_923 | 255 |
| 168 | 3300050511 | nmdc:mga08y16_315830_c1 | nmdc:mga08y16_315830_c1_770_1576 | 255 |
| 169 | 3300002126 | JGI24035J26624_1002346 | JGI24035J26624_10023462 | 256 |
| 170 | 3300003203 | JGI25406J46586_10000023 | JGI25406J46586_1000002379 | 256 |
| 171 | 3300005289 | Ga0065704_10162264 | Ga0065704_101622641 | 256 |
| 172 | 3300005290 | Ga0065712_10007547 | Ga0065712_100075472 | 256 |
| 173 | 3300005293 | Ga0065715_10001773 | Ga0065715_100017732 | 256 |
| 174 | 3300005295 | Ga0065707_10006006 | Ga0065707_100060063 | 256 |
| 175 | 3300005328 | Ga0070676_10002923 | Ga0070676_100029237 | 256 |
| 176 | 3300005328 | Ga0070676_10012692 | Ga0070676_100126924 | 256 |
| 177 | 3300005331 | Ga0070670_100112690 | Ga0070670_1001126903 | 256 |
| 178 | 3300005333 | Ga0070677_10023490 | Ga0070677_100234903 | 256 |
| 179 | 3300005335 | Ga0070666_10061459 | Ga0070666_100614592 | 256 |
| 180 | 3300005338 | Ga0068868_100251472 | Ga0068868_1002514722 | 256 |
| 181 | 3300005339 | Ga0070660_100046737 | Ga0070660_1000467372 | 256 |
| 182 | 3300005341 | Ga0070691_10145511 | Ga0070691_101455112 | 256 |
| 183 | 3300005347 | Ga0070668_100002392 | Ga0070668_1000023927 | 256 |
| 184 | 3300005347 | Ga0070668_100025289 | Ga0070668_1000252893 | 256 |
| 185 | 3300005353 | Ga0070669_100012301 | Ga0070669_1000123017 | 256 |
| 186 | 3300005353 | Ga0070669_100304104 | Ga0070669_1003041042 | 256 |
| 187 | 3300005354 | Ga0070675_100059781 | Ga0070675_1000597814 | 256 |
| 188 | 3300005354 | Ga0070675_100108573 | Ga0070675_1001085732 | 256 |
| 189 | 3300005355 | Ga0070671_100313908 | Ga0070671_1003139081 | 256 |
| 190 | 3300005356 | Ga0070674_100003820 | Ga0070674_1000038202 | 256 |
| 191 | 3300005356 | Ga0070674_100239453 | Ga0070674_1002394531 | 256 |
| 192 | 3300005364 | Ga0070673_100240659 | Ga0070673_1002406592 | 256 |
| 193 | 3300005365 | Ga0070688_100198870 | Ga0070688_1001988702 | 256 |
| 194 | 3300005367 | Ga0070667_100035605 | Ga0070667_1000356053 | 256 |
| 195 | 3300005367 | Ga0070667_100079668 | Ga0070667_1000796682 | 256 |
| 196 | 3300005435 | Ga0070714_100209009 | Ga0070714_1002090092 | 256 |
| 197 | 3300005435 | Ga0070714_100272972 | Ga0070714_1002729722 | 256 |
| 198 | 3300005439 | Ga0070711_100025400 | Ga0070711_1000254004 | 256 |
| 199 | 3300005445 | Ga0070708_100055215 | Ga0070708_1000552152 | 256 |
| 200 | 3300005456 | Ga0070678_100139834 | Ga0070678_1001398342 | 256 |
| 201 | 3300005456 | Ga0070678_100240186 | Ga0070678_1002401862 | 256 |
| 202 | 3300005457 | Ga0070662_100278330 | Ga0070662_1002783302 | 256 |
| 203 | 3300005467 | Ga0070706_100025763 | Ga0070706_1000257633 | 256 |
| 204 | 3300005467 | Ga0070706_100085389 | Ga0070706_1000853893 | 256 |
| 205 | 3300005467 | Ga0070706_100086901 | Ga0070706_1000869013 | 256 |
| 206 | 3300005467 | Ga0070706_100334651 | Ga0070706_1003346512 | 256 |
| 207 | 3300005468 | Ga0070707_100035472 | Ga0070707_1000354722 | 256 |
| 208 | 3300005468 | Ga0070707_100053866 | Ga0070707_1000538662 | 256 |
| 209 | 3300005468 | Ga0070707_100125541 | Ga0070707_1001255412 | 256 |
| 210 | 3300005471 | Ga0070698_100004844 | Ga0070698_1000048445 | 256 |
| 211 | 3300005471 | Ga0070698_100037336 | Ga0070698_1000373364 | 256 |
| 212 | 3300005536 | Ga0070697_100179633 | Ga0070697_1001796332 | 256 |
| 213 | 3300005545 | Ga0070695_100247823 | Ga0070695_1002478232 | 256 |
| 214 | 3300005548 | Ga0070665_100099861 | Ga0070665_1000998613 | 256 |
| 215 | 3300005564 | Ga0070664_100136539 | Ga0070664_1001365392 | 256 |
| 216 | 3300005614 | Ga0068856_100340662 | Ga0068856_1003406622 | 256 |
| 217 | 3300005718 | Ga0068866_10003045 | Ga0068866_100030456 | 256 |
| 218 | 3300005719 | Ga0068861_100075982 | Ga0068861_1000759822 | 256 |
| 219 | 3300005844 | Ga0068862_100084148 | Ga0068862_1000841482 | 256 |
| 220 | 3300005985 | Ga0081539_10000014 | Ga0081539_1000001488 | 256 |
| 221 | 3300006028 | Ga0070717_10043561 | Ga0070717_100435615 | 256 |
| 222 | 3300006028 | Ga0070717_10199955 | Ga0070717_101999552 | 256 |
| 223 | 3300006175 | Ga0070712_100009931 | Ga0070712_1000099314 | 256 |
| 224 | 3300006175 | Ga0070712_100022325 | Ga0070712_1000223252 | 256 |
| 225 | 3300006175 | Ga0070712_100239676 | Ga0070712_1002396762 | 256 |
| 226 | 3300006175 | Ga0070712_100316698 | Ga0070712_1003166982 | 256 |
| 227 | 3300006237 | Ga0097621_100388288 | Ga0097621_1003882881 | 256 |
| 228 | 3300006871 | Ga0075434_100197461 | Ga0075434_1001974612 | 256 |
| 229 | 3300006881 | Ga0068865_100098170 | Ga0068865_1000981702 | 256 |
| 230 | 3300007788 | Ga0099795_10003993 | Ga0099795_100039933 | 256 |
| 231 | 3300009098 | Ga0105245_10084114 | Ga0105245_100841142 | 256 |
| 232 | 3300009101 | Ga0105247_10042622 | Ga0105247_100426222 | 256 |
| 233 | 3300009176 | Ga0105242_10007257 | Ga0105242_100072576 | 256 |
| 234 | 3300010159 | Ga0099796_10021508 | Ga0099796_100215082 | 256 |
| 235 | 3300010375 | Ga0105239_10035778 | Ga0105239_100357786 | 256 |
| 236 | 3300013102 | Ga0157371_10187751 | Ga0157371_101877512 | 256 |
| 237 | 3300013296 | Ga0157374_10054807 | Ga0157374_100548072 | 256 |
| 238 | 3300013296 | Ga0157374_10447850 | Ga0157374_104478501 | 256 |
| 239 | 3300013297 | Ga0157378_10180162 | Ga0157378_101801622 | 256 |
| 240 | 3300013306 | Ga0163162_10020938 | Ga0163162_100209382 | 256 |
| 241 | 3300013308 | Ga0157375_10009538 | Ga0157375_100095386 | 256 |
| 242 | 3300013308 | Ga0157375_10112623 | Ga0157375_101126234 | 256 |
| 243 | 3300013308 | Ga0157375_10166101 | Ga0157375_101661012 | 256 |
| 244 | 3300014325 | Ga0163163_10121331 | Ga0163163_101213313 | 256 |
| 245 | 3300014968 | Ga0157379_10636717 | Ga0157379_106367172 | 256 |
| 246 | 3300017792 | Ga0163161_10000942 | Ga0163161_1000094220 | 256 |
| 247 | 3300021361 | Ga0213872_10021749 | Ga0213872_100217492 | 256 |
| 248 | 3300021361 | Ga0213872_10081131 | Ga0213872_100811312 | 256 |
| 249 | 3300021361 | Ga0213872_10100578 | Ga0213872_101005782 | 256 |
| 250 | 3300025315 | Ga0207697_10000262 | Ga0207697_1000026211 | 256 |
| 251 | 3300025901 | Ga0207688_10000823 | Ga0207688_100008239 | 256 |
| 252 | 3300025906 | Ga0207699_10004399 | Ga0207699_100043994 | 256 |
| 253 | 3300025906 | Ga0207699_10315003 | Ga0207699_103150031 | 256 |
| 254 | 3300025906 | Ga0207699_10349132 | Ga0207699_103491322 | 256 |
| 255 | 3300025907 | Ga0207645_10000823 | Ga0207645_1000082323 | 256 |
| 256 | 3300025910 | Ga0207684_10120686 | Ga0207684_101206862 | 256 |
| 257 | 3300025910 | Ga0207684_10152052 | Ga0207684_101520522 | 256 |
| 258 | 3300025910 | Ga0207684_10214002 | Ga0207684_102140022 | 256 |
| 259 | 3300025915 | Ga0207693_10002474 | Ga0207693_100024746 | 256 |
| 260 | 3300025915 | Ga0207693_10006817 | Ga0207693_100068177 | 256 |
| 261 | 3300025915 | Ga0207693_10070160 | Ga0207693_100701603 | 256 |
| 262 | 3300025916 | Ga0207663_10001758 | Ga0207663_100017587 | 256 |
| 263 | 3300025916 | Ga0207663_10138907 | Ga0207663_101389073 | 256 |
| 264 | 3300025916 | Ga0207663_10533298 | Ga0207663_105332982 | 256 |
| 265 | 3300025918 | Ga0207662_10064006 | Ga0207662_100640062 | 256 |
| 266 | 3300025919 | Ga0207657_10106039 | Ga0207657_101060393 | 256 |
| 267 | 3300025922 | Ga0207646_10066818 | Ga0207646_100668184 | 256 |
| 268 | 3300025922 | Ga0207646_10104602 | Ga0207646_101046022 | 256 |
| 269 | 3300025923 | Ga0207681_10011020 | Ga0207681_100110204 | 256 |
| 270 | 3300025925 | Ga0207650_10021161 | Ga0207650_100211614 | 256 |
| 271 | 3300025926 | Ga0207659_10007927 | Ga0207659_100079272 | 256 |
| 272 | 3300025929 | Ga0207664_10207085 | Ga0207664_102070852 | 256 |
| 273 | 3300025931 | Ga0207644_10034397 | Ga0207644_100343971 | 256 |
| 274 | 3300025931 | Ga0207644_10178446 | Ga0207644_101784462 | 256 |
| 275 | 3300025932 | Ga0207690_10108432 | Ga0207690_101084322 | 256 |
| 276 | 3300025933 | Ga0207706_10036106 | Ga0207706_100361064 | 256 |
| 277 | 3300025933 | Ga0207706_10151613 | Ga0207706_101516132 | 256 |
| 278 | 3300025934 | Ga0207686_10008278 | Ga0207686_100082786 | 256 |
| 279 | 3300025937 | Ga0207669_10012468 | Ga0207669_100124682 | 256 |
| 280 | 3300025937 | Ga0207669_10277044 | Ga0207669_102770441 | 256 |
| 281 | 3300025938 | Ga0207704_10393596 | Ga0207704_103935962 | 256 |
| 282 | 3300025939 | Ga0207665_10010290 | Ga0207665_100102904 | 256 |
| 283 | 3300025940 | Ga0207691_10003086 | Ga0207691_1000308614 | 256 |
| 284 | 3300025960 | Ga0207651_10253309 | Ga0207651_102533091 | 256 |
| 285 | 3300025972 | Ga0207668_10011447 | Ga0207668_100114472 | 256 |
| 286 | 3300025972 | Ga0207668_10025525 | Ga0207668_100255254 | 256 |
| 287 | 3300025986 | Ga0207658_10488118 | Ga0207658_104881182 | 256 |
| 288 | 3300026023 | Ga0207677_10007188 | Ga0207677_100071883 | 256 |
| 289 | 3300026078 | Ga0207702_10148752 | Ga0207702_101487522 | 256 |
| 290 | 3300026121 | Ga0207683_10019180 | Ga0207683_100191802 | 256 |
| 291 | 3300026121 | Ga0207683_10021171 | Ga0207683_100211712 | 256 |
| 292 | 3300028379 | Ga0268266_10428906 | Ga0268266_104289062 | 256 |
| 293 | 3300028380 | Ga0268265_10049204 | Ga0268265_100492042 | 256 |
| 294 | 3300031456 | Ga0307513_10137766 | Ga0307513_101377662 | 256 |
| 295 | 3300035083 | Ga0373926_0048133 | Ga0373926_0048133_367_1155 | 256 |
| 296 | 3300035171 | Ga0373946_0011788 | Ga0373946_0011788_996_1778 | 256 |
| 297 | 3300035691 | Ga0373931_0214025 | Ga0373931_0214025_343_1113 | 256 |
| 298 | 3300035692 | Ga0373935_0010731 | Ga0373935_0010731_3163_3933 | 256 |
| 299 | 3300035692 | Ga0373935_0076518 | Ga0373935_0076518_175_963 | 256 |
| 300 | 3300035725 | Ga0373947_0033533 | Ga0373947_0033533_761_1549 | 256 |
| 301 | 3300037068 | Ga0373925_0174691 | Ga0373925_0174691_670_1458 | 256 |
| 302 | 3300037853 | Ga0436364_1196405 | Ga0436364_1196405_2161_2949 | 256 |
| 303 | 3300038443 | Ga0395901_0012233 | Ga0395901_0012233_974_1756 | 256 |
| 304 | 3300039437 | Ga0436365_0818660 | Ga0436365_0818660_25046_25837 | 256 |
| 305 | 3300039438 | Ga0436360_0105884 | Ga0436360_0105884_1601_2386 | 256 |
| 306 | 3300039438 | Ga0436360_0829103 | Ga0436360_0829103_707_1492 | 256 |
| 307 | 3300039438 | Ga0436360_0832359 | Ga0436360_0832359_1369_2154 | 256 |
| 308 | 3300039447 | Ga0436361_0132728 | Ga0436361_0132728_723_1508 | 256 |
| 309 | 3300039447 | Ga0436361_0138991 | Ga0436361_0138991_781_1566 | 256 |
| 310 | 3300039447 | Ga0436361_0266084 | Ga0436361_0266084_18_803 | 256 |
| 311 | 3300039447 | Ga0436361_0523568 | Ga0436361_0523568_1081_1866 | 256 |
| 312 | 3300039447 | Ga0436361_1041738 | Ga0436361_1041738_1046_1831 | 256 |
| 313 | 3300039453 | Ga0436362_0556011 | Ga0436362_0556011_117_902 | 256 |
| 314 | 3300041486 | Ga0451807_0876074 | Ga0451807_0876074_39_827 | 256 |
| 315 | 3300045051 | Ga0451576_0803002 | Ga0451576_0803002_183_953 | 256 |
| 316 | 3300048903 | Ga0496100_0002986 | Ga0496100_0002986_311_1099 | 256 |
| 317 | 3300048906 | Ga0496103_0003746 | Ga0496103_0003746_3132_3920 | 256 |
| 318 | 3300048907 | Ga0496104_0141459 | Ga0496104_0141459_376_1158 | 256 |
| 319 | 3300048907 | Ga0496104_0224590 | Ga0496104_0224590_345_1115 | 256 |
| 320 | 3300048909 | Ga0496106_0000430 | Ga0496106_0000430_21286_22074 | 256 |
| 321 | 3300048910 | Ga0496107_0000174 | Ga0496107_0000174_10426_11214 | 256 |
| 322 | 3300048911 | Ga0496108_0017250 | Ga0496108_0017250_1460_2248 | 256 |
| 323 | 3300048912 | Ga0496109_0149302 | Ga0496109_0149302_831_1601 | 256 |
| 324 | 3300048912 | Ga0496109_0548937 | Ga0496109_0548937_198_980 | 256 |
| 325 | 3300048914 | Ga0496111_0303169 | Ga0496111_0303169_201_989 | 256 |
| 326 | 3300048915 | Ga0496112_0006024 | Ga0496112_0006024_9288_10070 | 256 |
| 327 | 3300048915 | Ga0496112_0011331 | Ga0496112_0011331_3449_4237 | 256 |
| 328 | 3300048915 | Ga0496112_0016762 | Ga0496112_0016762_4525_5307 | 256 |
| 329 | 3300048916 | Ga0496113_0042830 | Ga0496113_0042830_2041_2823 | 256 |
| 330 | 3300048916 | Ga0496113_0141403 | Ga0496113_0141403_471_1259 | 256 |
| 331 | 3300048918 | Ga0496115_0035536 | Ga0496115_0035536_137_925 | 256 |
| 332 | 3300048918 | Ga0496115_0338787 | Ga0496115_0338787_325_1110 | 256 |
| 333 | 3300050512 | nmdc:mga0n895_38298_c1 | nmdc:mga0n895_38298_c1_3603_4385 | 256 |
| 334 | 3300050513 | nmdc:mga0rr50_261729_c1 | nmdc:mga0rr50_261729_c1_205_993 | 256 |
| 335 | 3300000545 | CNXas_1000382 | CNXas_10003825 | 257 |
| 336 | 3300005290 | Ga0065712_10115221 | Ga0065712_101152212 | 257 |
| 337 | 3300005328 | Ga0070676_10018442 | Ga0070676_100184422 | 257 |
| 338 | 3300005328 | Ga0070676_10065346 | Ga0070676_100653462 | 257 |
| 339 | 3300005329 | Ga0070683_100053148 | Ga0070683_1000531483 | 257 |
| 340 | 3300005330 | Ga0070690_100097786 | Ga0070690_1000977862 | 257 |
| 341 | 3300005330 | Ga0070690_100568227 | Ga0070690_1005682271 | 257 |
| 342 | 3300005331 | Ga0070670_100005320 | Ga0070670_10000532011 | 257 |
| 343 | 3300005331 | Ga0070670_100006708 | Ga0070670_1000067084 | 257 |
| 344 | 3300005331 | Ga0070670_100026824 | Ga0070670_1000268242 | 257 |
| 345 | 3300005331 | Ga0070670_100210319 | Ga0070670_1002103192 | 257 |
| 346 | 3300005334 | Ga0068869_100270956 | Ga0068869_1002709562 | 257 |
| 347 | 3300005335 | Ga0070666_10005510 | Ga0070666_100055107 | 257 |
| 348 | 3300005335 | Ga0070666_10122269 | Ga0070666_101222692 | 257 |
| 349 | 3300005335 | Ga0070666_10425795 | Ga0070666_104257951 | 257 |
| 350 | 3300005338 | Ga0068868_100076108 | Ga0068868_1000761083 | 257 |
| 351 | 3300005338 | Ga0068868_100159304 | Ga0068868_1001593042 | 257 |
| 352 | 3300005338 | Ga0068868_100165307 | Ga0068868_1001653072 | 257 |
| 353 | 3300005340 | Ga0070689_100292044 | Ga0070689_1002920441 | 257 |
| 354 | 3300005347 | Ga0070668_100017294 | Ga0070668_1000172946 | 257 |
| 355 | 3300005353 | Ga0070669_100009421 | Ga0070669_1000094216 | 257 |
| 356 | 3300005354 | Ga0070675_100143007 | Ga0070675_1001430072 | 257 |
| 357 | 3300005355 | Ga0070671_100004750 | Ga0070671_1000047505 | 257 |
| 358 | 3300005355 | Ga0070671_100069906 | Ga0070671_1000699062 | 257 |
| 359 | 3300005355 | Ga0070671_100247898 | Ga0070671_1002478982 | 257 |
| 360 | 3300005356 | Ga0070674_100016618 | Ga0070674_1000166185 | 257 |
| 361 | 3300005356 | Ga0070674_100356650 | Ga0070674_1003566501 | 257 |
| 362 | 3300005364 | Ga0070673_100019760 | Ga0070673_1000197604 | 257 |
| 363 | 3300005364 | Ga0070673_100020468 | Ga0070673_1000204685 | 257 |
| 364 | 3300005365 | Ga0070688_100009213 | Ga0070688_1000092135 | 257 |
| 365 | 3300005367 | Ga0070667_100014735 | Ga0070667_1000147357 | 257 |
| 366 | 3300005367 | Ga0070667_100109467 | Ga0070667_1001094672 | 257 |
| 367 | 3300005435 | Ga0070714_100208400 | Ga0070714_1002084002 | 257 |
| 368 | 3300005435 | Ga0070714_100624726 | Ga0070714_1006247262 | 257 |
| 369 | 3300005436 | Ga0070713_100175055 | Ga0070713_1001750552 | 257 |
| 370 | 3300005439 | Ga0070711_100033883 | Ga0070711_1000338833 | 257 |
| 371 | 3300005439 | Ga0070711_100201566 | Ga0070711_1002015662 | 257 |
| 372 | 3300005441 | Ga0070700_100528666 | Ga0070700_1005286661 | 257 |
| 373 | 3300005445 | Ga0070708_100343544 | Ga0070708_1003435442 | 257 |
| 374 | 3300005445 | Ga0070708_100398383 | Ga0070708_1003983832 | 257 |
| 375 | 3300005456 | Ga0070678_100134973 | Ga0070678_1001349732 | 257 |
| 376 | 3300005459 | Ga0068867_100006507 | Ga0068867_1000065078 | 257 |
| 377 | 3300005467 | Ga0070706_100086118 | Ga0070706_1000861183 | 257 |
| 378 | 3300005467 | Ga0070706_100152683 | Ga0070706_1001526833 | 257 |
| 379 | 3300005467 | Ga0070706_100192325 | Ga0070706_1001923253 | 257 |
| 380 | 3300005467 | Ga0070706_100208369 | Ga0070706_1002083692 | 257 |
| 381 | 3300005468 | Ga0070707_100019586 | Ga0070707_1000195864 | 257 |
| 382 | 3300005468 | Ga0070707_100060619 | Ga0070707_1000606193 | 257 |
| 383 | 3300005468 | Ga0070707_100143743 | Ga0070707_1001437432 | 257 |
| 384 | 3300005468 | Ga0070707_100764700 | Ga0070707_1007647002 | 257 |
| 385 | 3300005471 | Ga0070698_100026631 | Ga0070698_1000266312 | 257 |
| 386 | 3300005518 | Ga0070699_100091499 | Ga0070699_1000914992 | 257 |
| 387 | 3300005518 | Ga0070699_100206480 | Ga0070699_1002064802 | 257 |
| 388 | 3300005536 | Ga0070697_100006844 | Ga0070697_1000068445 | 257 |
| 389 | 3300005536 | Ga0070697_100025379 | Ga0070697_1000253794 | 257 |
| 390 | 3300005536 | Ga0070697_100273453 | Ga0070697_1002734532 | 257 |
| 391 | 3300005536 | Ga0070697_100296765 | Ga0070697_1002967651 | 257 |
| 392 | 3300005543 | Ga0070672_100011259 | Ga0070672_1000112593 | 257 |
| 393 | 3300005548 | Ga0070665_100004925 | Ga0070665_1000049253 | 257 |
| 394 | 3300005548 | Ga0070665_100008642 | Ga0070665_1000086422 | 257 |
| 395 | 3300005718 | Ga0068866_10077663 | Ga0068866_100776632 | 257 |
| 396 | 3300005841 | Ga0068863_100107086 | Ga0068863_1001070862 | 257 |
| 397 | 3300005842 | Ga0068858_100099131 | Ga0068858_1000991313 | 257 |
| 398 | 3300005985 | Ga0081539_10000710 | Ga0081539_1000071058 | 257 |
| 399 | 3300006028 | Ga0070717_10013229 | Ga0070717_100132293 | 257 |
| 400 | 3300006175 | Ga0070712_100112065 | Ga0070712_1001120652 | 257 |
| 401 | 3300006237 | Ga0097621_100004502 | Ga0097621_10000450211 | 257 |
| 402 | 3300006237 | Ga0097621_100081762 | Ga0097621_1000817623 | 257 |
| 403 | 3300006237 | Ga0097621_100308188 | Ga0097621_1003081882 | 257 |
| 404 | 3300006358 | Ga0068871_100040008 | Ga0068871_1000400083 | 257 |
| 405 | 3300006358 | Ga0068871_100303880 | Ga0068871_1003038802 | 257 |
| 406 | 3300006881 | Ga0068865_100238865 | Ga0068865_1002388652 | 257 |
| 407 | 3300009094 | Ga0111539_10298822 | Ga0111539_102988222 | 257 |
| 408 | 3300009176 | Ga0105242_10016185 | Ga0105242_100161853 | 257 |
| 409 | 3300013296 | Ga0157374_10011892 | Ga0157374_100118926 | 257 |
| 410 | 3300013296 | Ga0157374_10033019 | Ga0157374_100330192 | 257 |
| 411 | 3300013297 | Ga0157378_10032112 | Ga0157378_100321123 | 257 |
| 412 | 3300013297 | Ga0157378_10039368 | Ga0157378_100393682 | 257 |
| 413 | 3300013297 | Ga0157378_10177214 | Ga0157378_101772142 | 257 |
| 414 | 3300013306 | Ga0163162_10026233 | Ga0163162_100262337 | 257 |
| 415 | 3300013306 | Ga0163162_10157827 | Ga0163162_101578273 | 257 |
| 416 | 3300013308 | Ga0157375_10003770 | Ga0157375_100037704 | 257 |
| 417 | 3300013308 | Ga0157375_10034179 | Ga0157375_100341795 | 257 |
| 418 | 3300013308 | Ga0157375_10235877 | Ga0157375_102358772 | 257 |
| 419 | 3300014969 | Ga0157376_10007798 | Ga0157376_100077983 | 257 |
| 420 | 3300021384 | Ga0213876_10001438 | Ga0213876_1000143811 | 257 |
| 421 | 3300025290 | Ga0207673_1003719 | Ga0207673_10037191 | 257 |
| 422 | 3300025315 | Ga0207697_10000238 | Ga0207697_1000023812 | 257 |
| 423 | 3300025315 | Ga0207697_10018575 | Ga0207697_100185752 | 257 |
| 424 | 3300025315 | Ga0207697_10099162 | Ga0207697_100991622 | 257 |
| 425 | 3300025899 | Ga0207642_10139221 | Ga0207642_101392211 | 257 |
| 426 | 3300025901 | Ga0207688_10000429 | Ga0207688_1000042915 | 257 |
| 427 | 3300025903 | Ga0207680_10026298 | Ga0207680_100262984 | 257 |
| 428 | 3300025903 | Ga0207680_10031477 | Ga0207680_100314772 | 257 |
| 429 | 3300025903 | Ga0207680_10040126 | Ga0207680_100401262 | 257 |
| 430 | 3300025907 | Ga0207645_10015174 | Ga0207645_100151743 | 257 |
| 431 | 3300025907 | Ga0207645_10040071 | Ga0207645_100400712 | 257 |
| 432 | 3300025910 | Ga0207684_10049137 | Ga0207684_100491373 | 257 |
| 433 | 3300025910 | Ga0207684_10188176 | Ga0207684_101881762 | 257 |
| 434 | 3300025910 | Ga0207684_10307092 | Ga0207684_103070922 | 257 |
| 435 | 3300025915 | Ga0207693_10101281 | Ga0207693_101012813 | 257 |
| 436 | 3300025915 | Ga0207693_10119018 | Ga0207693_101190182 | 257 |
| 437 | 3300025916 | Ga0207663_10155606 | Ga0207663_101556062 | 257 |
| 438 | 3300025922 | Ga0207646_10000513 | Ga0207646_100005136 | 257 |
| 439 | 3300025922 | Ga0207646_10447152 | Ga0207646_104471522 | 257 |
| 440 | 3300025923 | Ga0207681_10022182 | Ga0207681_100221822 | 257 |
| 441 | 3300025925 | Ga0207650_10048973 | Ga0207650_100489733 | 257 |
| 442 | 3300025925 | Ga0207650_10147270 | Ga0207650_101472702 | 257 |
| 443 | 3300025925 | Ga0207650_10215342 | Ga0207650_102153422 | 257 |
| 444 | 3300025926 | Ga0207659_10063739 | Ga0207659_100637392 | 257 |
| 445 | 3300025926 | Ga0207659_10098013 | Ga0207659_100980132 | 257 |
| 446 | 3300025929 | Ga0207664_10146017 | Ga0207664_101460172 | 257 |
| 447 | 3300025931 | Ga0207644_10005188 | Ga0207644_100051889 | 257 |
| 448 | 3300025931 | Ga0207644_10086924 | Ga0207644_100869242 | 257 |
| 449 | 3300025931 | Ga0207644_10106055 | Ga0207644_101060552 | 257 |
| 450 | 3300025931 | Ga0207644_10279564 | Ga0207644_102795642 | 257 |
| 451 | 3300025931 | Ga0207644_10532932 | Ga0207644_105329321 | 257 |
| 452 | 3300025934 | Ga0207686_10311426 | Ga0207686_103114261 | 257 |
| 453 | 3300025936 | Ga0207670_10553891 | Ga0207670_105538912 | 257 |
| 454 | 3300025937 | Ga0207669_10009962 | Ga0207669_100099623 | 257 |
| 455 | 3300025937 | Ga0207669_10062587 | Ga0207669_100625872 | 257 |
| 456 | 3300025938 | Ga0207704_10032009 | Ga0207704_100320092 | 257 |
| 457 | 3300025940 | Ga0207691_10000306 | Ga0207691_1000030623 | 257 |
| 458 | 3300025940 | Ga0207691_10003406 | Ga0207691_1000340613 | 257 |
| 459 | 3300025940 | Ga0207691_10358566 | Ga0207691_103585662 | 257 |
| 460 | 3300025945 | Ga0207679_10118737 | Ga0207679_101187372 | 257 |
| 461 | 3300025960 | Ga0207651_10052267 | Ga0207651_100522672 | 257 |
| 462 | 3300025960 | Ga0207651_10105071 | Ga0207651_101050712 | 257 |
| 463 | 3300025972 | Ga0207668_10021024 | Ga0207668_100210242 | 257 |
| 464 | 3300025972 | Ga0207668_10227849 | Ga0207668_102278492 | 257 |
| 465 | 3300026023 | Ga0207677_10054821 | Ga0207677_100548212 | 257 |
| 466 | 3300026035 | Ga0207703_10347165 | Ga0207703_103471652 | 257 |
| 467 | 3300026088 | Ga0207641_10136286 | Ga0207641_101362862 | 257 |
| 468 | 3300026089 | Ga0207648_10014184 | Ga0207648_100141842 | 257 |
| 469 | 3300026121 | Ga0207683_10002031 | Ga0207683_1000203112 | 257 |
| 470 | 3300028379 | Ga0268266_10020958 | Ga0268266_100209583 | 257 |
| 471 | 3300028379 | Ga0268266_10342542 | Ga0268266_103425422 | 257 |
| 472 | 3300035118 | Ga0373954_0204689 | Ga0373954_0204689_88_879 | 257 |
| 473 | 3300035170 | Ga0373943_0128896 | Ga0373943_0128896_48_839 | 257 |
| 474 | 3300035172 | Ga0373955_0020926 | Ga0373955_0020926_2154_2945 | 257 |
| 475 | 3300035410 | Ga0373924_0036750 | Ga0373924_0036750_573_1364 | 257 |
| 476 | 3300036401 | Ga0373937_0007726 | Ga0373937_0007726_4669_5460 | 257 |
| 477 | 3300036401 | Ga0373937_0393484 | Ga0373937_0393484_302_1093 | 257 |
| 478 | 3300037068 | Ga0373925_0539072 | Ga0373925_0539072_43_834 | 257 |
| 479 | 3300039437 | Ga0436365_1923965 | Ga0436365_1923965_8910_9833 | 257 |
| 480 | 3300045976 | Ga0466967_0316681 | Ga0466967_0316681_255_1046 | 257 |
| 481 | 3300046454 | Ga0495592_0048276 | Ga0495592_0048276_1577_2368 | 257 |
| 482 | 3300046517 | Ga0495630_0041259 | Ga0495630_0041259_218_1009 | 257 |
| 483 | 3300046529 | Ga0495652_0020595 | Ga0495652_0020595_4629_5420 | 257 |
| 484 | 3300046533 | Ga0495640_0039060 | Ga0495640_0039060_827_1618 | 257 |
| 485 | 3300046543 | Ga0495645_0051896 | Ga0495645_0051896_1855_2646 | 257 |
| 486 | 3300046559 | Ga0495667_0311402 | Ga0495667_0311402_172_963 | 257 |
| 487 | 3300046675 | Ga0495657_0212005 | Ga0495657_0212005_175_966 | 257 |
| 488 | 3300046683 | Ga0495658_0170572 | Ga0495658_0170572_408_1199 | 257 |
| 489 | 3300048903 | Ga0496100_0034627 | Ga0496100_0034627_846_1637 | 257 |
| 490 | 3300048904 | Ga0496101_0045884 | Ga0496101_0045884_1870_2661 | 257 |
| 491 | 3300048905 | Ga0496102_0679097 | Ga0496102_0679097_126_917 | 257 |
| 492 | 3300048907 | Ga0496104_0014922 | Ga0496104_0014922_1958_2749 | 257 |
| 493 | 3300048911 | Ga0496108_0452049 | Ga0496108_0452049_127_918 | 257 |
| 494 | 3300048912 | Ga0496109_0055891 | Ga0496109_0055891_1583_2374 | 257 |
| 495 | 3300048912 | Ga0496109_0104354 | Ga0496109_0104354_303_1094 | 257 |
| 496 | 3300048915 | Ga0496112_0010611 | Ga0496112_0010611_2182_2973 | 257 |
| 497 | 3300048915 | Ga0496112_0019136 | Ga0496112_0019136_2620_3411 | 257 |
| 498 | 3300048917 | Ga0496114_0024795 | Ga0496114_0024795_2626_3417 | 257 |
| 499 | 3300048918 | Ga0496115_0003485 | Ga0496115_0003485_2103_2894 | 257 |
| 500 | 3300050511 | nmdc:mga08y16_280607_c1 | nmdc:mga08y16_280607_c1_248_1039 | 257 |
| 501 | 3300053077 | Ga0495601_0134467 | Ga0495601_0134467_639_1430 | 257 |
| 502 | 3300053085 | Ga0495619_0116979 | Ga0495619_0116979_317_1108 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ch8-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.9763 | 4 | 246 |
| 7ch8-assembly1.cif.gz_I | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.9719 | 4 | 246 |
| 8fee-assembly1.cif.gz_H | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.9717 | 4 | 245 |
| 7cha-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with amppnp | 0.9677 | 4 | 246 |
| 7d06-assembly1.cif.gz_B | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.9628 | 4 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P63386_5_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9894 | 4 | 245 | 3.40.50.300 |
| af_P9WQL5_26_341_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9846 | 1 | 246 | 3.40.50.300 |
| af_P63386_5_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9657 | 4 | 245 | 3.40.50.300 |
| af_P14175_33_289_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9624 | 17 | 242 | 3.40.50.300 |
| af_P16678_3_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9596 | 4 | 240 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0E135-F1-model_v4 | ABC transporter ATP-binding protein | 0.9924 | 4 | 244 |
GO:0005524
GO:0016887 |
| AF-A0A640P064-F1-model_v4 | ABC transporter ATP-binding protein | 0.9903 | 4 | 245 |
GO:0005524
GO:0016887 |
| AF-A0A5C7SZM3-F1-model_v4 | ABC transporter ATP-binding protein | 0.9897 | 4 | 246 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A2N7JK81-F1-model_v4 | ABC transporter ATP-binding protein | 0.9883 | 4 | 246 |
GO:0005524
GO:0016887 |
| AF-A0A0A8XEL2-F1-model_v4 | Toluene tolerance efflux transporter ABC superfamily, ATP-bind | 0.9866 | 4 | 245 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar