F455852

General Info

Members Datasets Scaffolds Average Seq Length
502 223 502 263

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10001438|Ga0213876_1000143811
Length 307
Sequence VNPEAATHSIDRRDEIRHLHDGEPAPAANADDGGAGDDDAPLVELQDVVLRFGKKTVLDGVSLAVYPGERLIVLGGSGSGKSTTLRLIMGILQPTAGRVFFCGHEISALGRRELNVLRARIGMVYQYSALISSLTVRDNLALPMEELSDQKPEEIDRIIDEKLAMVNMGNVKSAMPAELSGGMKKRIGLARALVLDPELILFDEPSAGLDPVTSSIVDELIINLTEQTQTTSIVVTHEMDSAFRIGTRMVMLYEGKIIADGPPEEFRHSSNPVVTQFVEGRTEGPILDSTRHHDPKPEQPATTTAGR

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.98
Rhizosphere 91.43
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000382 3300000545 Bacteria 3455
2 JGI24035J26624_1002346 3300002126 Bacteria 1765
3 JGI25406J46586_10000023 3300003203 Bacteria 76640
4 Ga0065704_10162264 3300005289 Unclassified 1346
5 Ga0065712_10007547 3300005290 Bacteria 2507
6 Ga0065712_10115221 3300005290 Bacteria 1755
7 Ga0065712_10151695 3300005290 Unclassified 1365
8 Ga0065715_10001773 3300005293 Bacteria 9408
9 Ga0065707_10006006 3300005295 Bacteria 3277
10 Ga0070658_10020004 3300005327 Bacteria 5361
11 Ga0070658_10029659 3300005327 Bacteria 4396
12 Ga0070658_10134476 3300005327 Bacteria 2062
13 Ga0070658_10159233 3300005327 Bacteria 1894
14 Ga0070676_10002923 3300005328 Bacteria 8823
15 Ga0070676_10012692 3300005328 Bacteria 4606
16 Ga0070676_10018442 3300005328 Bacteria 3868
17 Ga0070676_10065346 3300005328 Bacteria 2172
18 Ga0070683_100053148 3300005329 Bacteria 3754
19 Ga0070690_100097786 3300005330 Unclassified 1942
20 Ga0070690_100568227 3300005330 Bacteria 857
21 Ga0070670_100005320 3300005331 Bacteria 10856
22 Ga0070670_100006708 3300005331 Bacteria 9755
23 Ga0070670_100026824 3300005331 Bacteria 4955
24 Ga0070670_100112690 3300005331 Viruses 2344
25 Ga0070670_100210319 3300005331 Bacteria 1691
26 Ga0070677_10023490 3300005333 Bacteria 2284
27 Ga0070677_10138660 3300005333 Bacteria 1119
28 Ga0068869_100270956 3300005334 Bacteria 1362
29 Ga0070666_10005510 3300005335 Bacteria 7764
30 Ga0070666_10061459 3300005335 Bacteria 2543
31 Ga0070666_10122269 3300005335 Bacteria 1806
32 Ga0070666_10425795 3300005335 Bacteria 956
33 Ga0068868_100076108 3300005338 Bacteria 2683
34 Ga0068868_100159304 3300005338 Bacteria 1863
35 Ga0068868_100165307 3300005338 Bacteria 1830
36 Ga0068868_100251472 3300005338 Bacteria 1488
37 Ga0068868_100493100 3300005338 Bacteria 1072
38 Ga0070660_100046737 3300005339 Bacteria 3319
39 Ga0070660_100064592 3300005339 Bacteria 2848
40 Ga0070689_100292044 3300005340 Bacteria 1355
41 Ga0070691_10145511 3300005341 Bacteria 1211
42 Ga0070661_100113246 3300005344 Bacteria 2027
43 Ga0070668_100002392 3300005347 Bacteria 13794
44 Ga0070668_100017294 3300005347 Bacteria 5398
45 Ga0070668_100025289 3300005347 Bacteria 4500
46 Ga0070669_100009421 3300005353 Bacteria 6953
47 Ga0070669_100012301 3300005353 Bacteria 6072
48 Ga0070669_100304104 3300005353 Bacteria 1283
49 Ga0070675_100010789 3300005354 Bacteria 7145
50 Ga0070675_100059781 3300005354 Bacteria 3145
51 Ga0070675_100108573 3300005354 Bacteria 2343
52 Ga0070675_100143007 3300005354 Bacteria 2046
53 Ga0070675_100158210 3300005354 Bacteria 1947
54 Ga0070671_100004750 3300005355 Bacteria 10792
55 Ga0070671_100069906 3300005355 Bacteria 2928
56 Ga0070671_100247898 3300005355 Bacteria 1513
57 Ga0070671_100313908 3300005355 Bacteria 1335
58 Ga0070674_100003820 3300005356 Bacteria 8521
59 Ga0070674_100016618 3300005356 Bacteria 4615
60 Ga0070674_100239453 3300005356 Unclassified 1420
61 Ga0070674_100356650 3300005356 Bacteria 1183
62 Ga0070673_100019760 3300005364 Bacteria 4844
63 Ga0070673_100020468 3300005364 Bacteria 4773
64 Ga0070673_100240659 3300005364 Bacteria 1573
65 Ga0070688_100009213 3300005365 Bacteria 5388
66 Ga0070688_100198870 3300005365 Bacteria 1401
67 Ga0070667_100014735 3300005367 Bacteria 6459
68 Ga0070667_100035329 3300005367 Bacteria 4186
69 Ga0070667_100035605 3300005367 Bacteria 4171
70 Ga0070667_100079668 3300005367 Bacteria 2800
71 Ga0070667_100109467 3300005367 Bacteria 2394
72 Ga0070714_100098117 3300005435 Bacteria 2577
73 Ga0070714_100208400 3300005435 Bacteria 1791
74 Ga0070714_100209009 3300005435 Bacteria 1788
75 Ga0070714_100272972 3300005435 Bacteria 1568
76 Ga0070714_100624726 3300005435 Bacteria 1036
77 Ga0070713_100175055 3300005436 Bacteria 1925
78 Ga0070713_100677211 3300005436 Bacteria 984
79 Ga0070711_100025400 3300005439 Unclassified 3876
80 Ga0070711_100033883 3300005439 Bacteria 3403
81 Ga0070711_100201566 3300005439 Bacteria 1536
82 Ga0070700_100528666 3300005441 Bacteria 912
83 Ga0070708_100055215 3300005445 Bacteria 3531
84 Ga0070708_100343544 3300005445 Bacteria 1406
85 Ga0070708_100398383 3300005445 Bacteria 1298
86 Ga0070678_100134973 3300005456 Bacteria 1967
87 Ga0070678_100139834 3300005456 Unclassified 1936
88 Ga0070678_100240186 3300005456 Bacteria 1514
89 Ga0070662_100278330 3300005457 Bacteria 1353
90 Ga0068867_100006507 3300005459 Bacteria 8255
91 Ga0070706_100000973 3300005467 Bacteria 31247
92 Ga0070706_100025763 3300005467 Bacteria 5412
93 Ga0070706_100085389 3300005467 Bacteria 2925
94 Ga0070706_100086118 3300005467 Bacteria 2911
95 Ga0070706_100086901 3300005467 Unclassified 2898
96 Ga0070706_100152683 3300005467 Unclassified 2156
97 Ga0070706_100192325 3300005467 Unclassified 1906
98 Ga0070706_100208369 3300005467 Bacteria 1825
99 Ga0070706_100334651 3300005467 Unclassified 1412
100 Ga0070707_100019586 3300005468 Bacteria 6377
101 Ga0070707_100035472 3300005468 Bacteria 4758
102 Ga0070707_100053866 3300005468 Bacteria 3857
103 Ga0070707_100060619 3300005468 Unclassified 3628
104 Ga0070707_100125541 3300005468 Unclassified 2493
105 Ga0070707_100143743 3300005468 Bacteria 2322
106 Ga0070707_100764700 3300005468 Unclassified 929
107 Ga0070698_100001144 3300005471 Bacteria 29368
108 Ga0070698_100004844 3300005471 Bacteria 14775
109 Ga0070698_100026631 3300005471 Bacteria 6017
110 Ga0070698_100037336 3300005471 Bacteria 5010
111 Ga0070698_100395986 3300005471 Unclassified 1314
112 Ga0070699_100091499 3300005518 Bacteria 2660
113 Ga0070699_100206480 3300005518 Bacteria 1748
114 Ga0070679_100765796 3300005530 Bacteria 908
115 Ga0070697_100001763 3300005536 Bacteria 16519
116 Ga0070697_100006844 3300005536 Bacteria 8855
117 Ga0070697_100025379 3300005536 Bacteria 4728
118 Ga0070697_100045936 3300005536 Bacteria 3540
119 Ga0070697_100179633 3300005536 Unclassified 1794
120 Ga0070697_100273453 3300005536 Bacteria 1448
121 Ga0070697_100296765 3300005536 Bacteria 1389
122 Ga0068853_100000011 3300005539 Bacteria 246709
123 Ga0070672_100011259 3300005543 Bacteria 6237
124 Ga0070695_100247823 3300005545 Bacteria 1295
125 Ga0070696_100327680 3300005546 Bacteria 1180
126 Ga0070665_100000772 3300005548 Bacteria 42151
127 Ga0070665_100004925 3300005548 Bacteria 13852
128 Ga0070665_100008642 3300005548 Bacteria 10307
129 Ga0070665_100099861 3300005548 Bacteria 2907
130 Ga0070665_100732598 3300005548 Bacteria 1002
131 Ga0068855_100057644 3300005563 Bacteria 4552
132 Ga0068855_100080775 3300005563 Bacteria 3770
133 Ga0068855_100327224 3300005563 Bacteria 1692
134 Ga0068855_100855140 3300005563 Bacteria 964
135 Ga0070664_100136539 3300005564 Bacteria 2157
136 Ga0068856_100340662 3300005614 Bacteria 1517
137 Ga0068859_100874871 3300005617 Bacteria 984
138 Ga0068864_100031014 3300005618 Bacteria 4534
139 Ga0068866_10003045 3300005718 Bacteria 6917
140 Ga0068866_10077663 3300005718 Bacteria 1774
141 Ga0068861_100075982 3300005719 Bacteria 2616
142 Ga0068863_100107086 3300005841 Bacteria 2660
143 Ga0068863_100126845 3300005841 Bacteria 2435
144 Ga0068858_100041846 3300005842 Bacteria 4247
145 Ga0068858_100099131 3300005842 Bacteria 2717
146 Ga0068858_100667818 3300005842 Bacteria 1010
147 Ga0068862_100084148 3300005844 Bacteria 2763
148 Ga0068862_100634234 3300005844 Bacteria 1029
149 Ga0081539_10000014 3300005985 Bacteria 411270
150 Ga0081539_10000710 3300005985 Bacteria 66710
151 Ga0081539_10006328 3300005985 Bacteria 11428
152 Ga0070717_10013229 3300006028 Bacteria 6315
153 Ga0070717_10043561 3300006028 Unclassified 3664
154 Ga0070717_10086635 3300006028 Bacteria 2637
155 Ga0070717_10131430 3300006028 Bacteria 2153
156 Ga0070717_10199955 3300006028 Bacteria 1750
157 Ga0070716_100058213 3300006173 Bacteria 2223
158 Ga0070712_100009931 3300006175 Bacteria 6000
159 Ga0070712_100022325 3300006175 Unclassified 4168
160 Ga0070712_100052217 3300006175 Unclassified 2850
161 Ga0070712_100112065 3300006175 Bacteria 2038
162 Ga0070712_100239676 3300006175 Bacteria 1444
163 Ga0070712_100316698 3300006175 Bacteria 1267
164 Ga0097621_100004502 3300006237 Bacteria 9716
165 Ga0097621_100081762 3300006237 Bacteria 2689
166 Ga0097621_100308188 3300006237 Bacteria 1400
167 Ga0097621_100388288 3300006237 Bacteria 1248
168 Ga0068871_100040008 3300006358 Bacteria 3754
169 Ga0068871_100195222 3300006358 Unclassified 1745
170 Ga0068871_100303880 3300006358 Bacteria 1401
171 Ga0075430_100021635 3300006846 Bacteria 5465
172 Ga0075434_100197461 3300006871 Bacteria 2032
173 Ga0068865_100098170 3300006881 Bacteria 2139
174 Ga0068865_100238865 3300006881 Bacteria 1429
175 Ga0097620_100874702 3300006931 Bacteria 984
176 Ga0099795_10003993 3300007788 Bacteria 3744
177 Ga0099795_10077478 3300007788 Unclassified 1266
178 Ga0105240_10000057 3300009093 Bacteria 222664
179 Ga0105240_10018462 3300009093 Bacteria 9365
180 Ga0111539_10112062 3300009094 Bacteria 3200
181 Ga0111539_10298822 3300009094 Bacteria 1874
182 Ga0105245_10024665 3300009098 Bacteria 5283
183 Ga0105245_10084114 3300009098 Bacteria 2914
184 Ga0105245_10150385 3300009098 Bacteria 2201
185 Ga0105245_10205710 3300009098 Bacteria 1892
186 Ga0105247_10042622 3300009101 Bacteria 2780
187 Ga0114129_10907403 3300009147 Bacteria 1116
188 Ga0105241_10352370 3300009174 Bacteria 1278
189 Ga0105242_10007257 3300009176 Bacteria 8547
190 Ga0105242_10016185 3300009176 Bacteria 5794
191 Ga0105237_10005488 3300009545 Bacteria 14297
192 Ga0105249_10285746 3300009553 Bacteria 1649
193 Ga0099796_10021508 3300010159 Bacteria 1987
194 Ga0105239_10035778 3300010375 Bacteria 5453
195 Ga0105239_10201434 3300010375 Bacteria 2230
196 Ga0105239_10279156 3300010375 Bacteria 1880
197 Ga0157373_10127739 3300013100 Bacteria 1788
198 Ga0157371_10187751 3300013102 Unclassified 1479
199 Ga0157370_10095063 3300013104 Bacteria 2796
200 Ga0157370_10199597 3300013104 Bacteria 1856
201 Ga0157369_10100533 3300013105 Bacteria 3082
202 Ga0157369_10188536 3300013105 Bacteria 2167
203 Ga0157369_10242375 3300013105 Bacteria 1883
204 Ga0157374_10011892 3300013296 Bacteria 7552
205 Ga0157374_10033019 3300013296 Bacteria 4719
206 Ga0157374_10054807 3300013296 Unclassified 3720
207 Ga0157374_10447850 3300013296 Unclassified 1292
208 Ga0157378_10032112 3300013297 Bacteria 4638
209 Ga0157378_10039368 3300013297 Bacteria 4193
210 Ga0157378_10177214 3300013297 Unclassified 2003
211 Ga0157378_10180162 3300013297 Unclassified 1987
212 Ga0163162_10020938 3300013306 Bacteria 6432
213 Ga0163162_10026233 3300013306 Bacteria 5759
214 Ga0163162_10157827 3300013306 Bacteria 2389
215 Ga0163162_10818274 3300013306 Bacteria 1048
216 Ga0157372_10067032 3300013307 Bacteria 4033
217 Ga0157372_10131216 3300013307 Bacteria 2883
218 Ga0157372_10426175 3300013307 Bacteria 1546
219 Ga0157375_10003770 3300013308 Bacteria 13135
220 Ga0157375_10009538 3300013308 Bacteria 8522
221 Ga0157375_10034179 3300013308 Bacteria 4841
222 Ga0157375_10112623 3300013308 Bacteria 2821
223 Ga0157375_10166101 3300013308 Bacteria 2352
224 Ga0157375_10235877 3300013308 Bacteria 1988
225 Ga0157375_10383176 3300013308 Bacteria 1573
226 Ga0163163_10121331 3300014325 Bacteria 2648
227 Ga0157379_10636717 3300014968 Bacteria 997
228 Ga0157376_10007798 3300014969 Bacteria 7672
229 Ga0163161_10000942 3300017792 Bacteria 22392
230 Ga0213872_10011117 3300021361 Bacteria 4265
231 Ga0213872_10021749 3300021361 Unclassified 2954
232 Ga0213872_10043134 3300021361 Unclassified 2056
233 Ga0213872_10081131 3300021361 Bacteria 1457
234 Ga0213872_10100578 3300021361 Unclassified 1289
235 Ga0213874_10015345 3300021377 Bacteria 2019
236 Ga0213876_10001438 3300021384 Bacteria 14813
237 Ga0213876_10015390 3300021384 Bacteria 4048
238 Ga0213871_10004130 3300021441 Bacteria 2876
239 Ga0213871_10015935 3300021441 Unclassified 1804
240 Ga0207673_1003719 3300025290 Bacteria 1797
241 Ga0207697_10000238 3300025315 Bacteria 29919
242 Ga0207697_10000262 3300025315 Bacteria 28988
243 Ga0207697_10018575 3300025315 Bacteria 2851
244 Ga0207697_10099162 3300025315 Bacteria 1241
245 Ga0207642_10139221 3300025899 Bacteria 1277
246 Ga0207688_10000429 3300025901 Bacteria 19807
247 Ga0207688_10000823 3300025901 Bacteria 15526
248 Ga0207680_10026298 3300025903 Bacteria 3224
249 Ga0207680_10031477 3300025903 Bacteria 3005
250 Ga0207680_10040126 3300025903 Bacteria 2721
251 Ga0207680_10156307 3300025903 Bacteria 1525
252 Ga0207699_10004399 3300025906 Bacteria 6739
253 Ga0207699_10183450 3300025906 Bacteria 1408
254 Ga0207699_10315003 3300025906 Bacteria 1096
255 Ga0207699_10349132 3300025906 Bacteria 1044
256 Ga0207645_10000823 3300025907 Bacteria 25996
257 Ga0207645_10015174 3300025907 Bacteria 5130
258 Ga0207645_10040071 3300025907 Bacteria 3000
259 Ga0207645_10091809 3300025907 Bacteria 1953
260 Ga0207705_10058972 3300025909 Bacteria 2769
261 Ga0207684_10001687 3300025910 Bacteria 23476
262 Ga0207684_10049137 3300025910 Bacteria 3579
263 Ga0207684_10120686 3300025910 Bacteria 2247
264 Ga0207684_10152052 3300025910 Bacteria 1991
265 Ga0207684_10188176 3300025910 Unclassified 1780
266 Ga0207684_10214002 3300025910 Unclassified 1662
267 Ga0207684_10238014 3300025910 Bacteria 1570
268 Ga0207684_10307092 3300025910 Viruses 1367
269 Ga0207695_10000072 3300025913 Bacteria 312795
270 Ga0207695_10000450 3300025913 Bacteria 89495
271 Ga0207671_10039468 3300025914 Unclassified 3495
272 Ga0207693_10002474 3300025915 Bacteria 16059
273 Ga0207693_10006817 3300025915 Bacteria 9431
274 Ga0207693_10070160 3300025915 Bacteria 2742
275 Ga0207693_10101281 3300025915 Unclassified 2258
276 Ga0207693_10119018 3300025915 Bacteria 2074
277 Ga0207663_10001758 3300025916 Bacteria 10214
278 Ga0207663_10138907 3300025916 Bacteria 1690
279 Ga0207663_10155606 3300025916 Bacteria 1608
280 Ga0207663_10533298 3300025916 Bacteria 916
281 Ga0207662_10064006 3300025918 Bacteria 2212
282 Ga0207657_10106039 3300025919 Bacteria 2326
283 Ga0207649_10329054 3300025920 Bacteria 1125
284 Ga0207646_10000513 3300025922 Bacteria 51606
285 Ga0207646_10066818 3300025922 Unclassified 3210
286 Ga0207646_10104602 3300025922 Unclassified 2539
287 Ga0207646_10447152 3300025922 Unclassified 1166
288 Ga0207681_10011020 3300025923 Bacteria 5552
289 Ga0207681_10022182 3300025923 Bacteria 4046
290 Ga0207650_10021161 3300025925 Bacteria 4597
291 Ga0207650_10048973 3300025925 Bacteria 3118
292 Ga0207650_10147270 3300025925 Bacteria 1855
293 Ga0207650_10215342 3300025925 Bacteria 1544
294 Ga0207659_10007927 3300025926 Bacteria 6567
295 Ga0207659_10063229 3300025926 Bacteria 2675
296 Ga0207659_10063739 3300025926 Bacteria 2666
297 Ga0207659_10098013 3300025926 Bacteria 2204
298 Ga0207687_10037865 3300025927 Bacteria 3293
299 Ga0207687_10150507 3300025927 Bacteria 1775
300 Ga0207700_10034697 3300025928 Bacteria 3625
301 Ga0207700_10075642 3300025928 Bacteria 2610
302 Ga0207664_10139724 3300025929 Bacteria 2048
303 Ga0207664_10146017 3300025929 Unclassified 2006
304 Ga0207664_10197020 3300025929 Bacteria 1737
305 Ga0207664_10207085 3300025929 Bacteria 1695
306 Ga0207664_10218473 3300025929 Bacteria 1652
307 Ga0207644_10005188 3300025931 Bacteria 8512
308 Ga0207644_10034397 3300025931 Bacteria 3545
309 Ga0207644_10086924 3300025931 Bacteria 2322
310 Ga0207644_10106055 3300025931 Bacteria 2118
311 Ga0207644_10178446 3300025931 Bacteria 1663
312 Ga0207644_10279564 3300025931 Bacteria 1340
313 Ga0207644_10532932 3300025931 Bacteria 971
314 Ga0207690_10108432 3300025932 Bacteria 1996
315 Ga0207706_10036106 3300025933 Bacteria 4391
316 Ga0207706_10084820 3300025933 Bacteria 2785
317 Ga0207706_10151613 3300025933 Unclassified 2038
318 Ga0207686_10008278 3300025934 Bacteria 5611
319 Ga0207686_10311426 3300025934 Unclassified 1173
320 Ga0207670_10553891 3300025936 Bacteria 940
321 Ga0207669_10009962 3300025937 Bacteria 4555
322 Ga0207669_10012468 3300025937 Unclassified 4181
323 Ga0207669_10062587 3300025937 Bacteria 2292
324 Ga0207669_10081094 3300025937 Bacteria 2077
325 Ga0207669_10277044 3300025937 Unclassified 1263
326 Ga0207704_10032009 3300025938 Bacteria 2971
327 Ga0207704_10393596 3300025938 Bacteria 1091
328 Ga0207665_10010290 3300025939 Bacteria 6141
329 Ga0207691_10000306 3300025940 Bacteria 48746
330 Ga0207691_10003086 3300025940 Bacteria 16247
331 Ga0207691_10003406 3300025940 Bacteria 15457
332 Ga0207691_10036248 3300025940 Bacteria 4570
333 Ga0207691_10358566 3300025940 Unclassified 1247
334 Ga0207679_10118737 3300025945 Bacteria 2101
335 Ga0207667_10025782 3300025949 Bacteria 6431
336 Ga0207651_10045287 3300025960 Bacteria 2950
337 Ga0207651_10052267 3300025960 Bacteria 2785
338 Ga0207651_10105071 3300025960 Bacteria 2105
339 Ga0207651_10253309 3300025960 Bacteria 1441
340 Ga0207668_10011447 3300025972 Bacteria 5391
341 Ga0207668_10021024 3300025972 Bacteria 4156
342 Ga0207668_10025525 3300025972 Bacteria 3825
343 Ga0207668_10227849 3300025972 Bacteria 1500
344 Ga0207668_10536475 3300025972 Bacteria 1012
345 Ga0207658_10146322 3300025986 Bacteria 1919
346 Ga0207658_10488118 3300025986 Bacteria 1095
347 Ga0207677_10007188 3300026023 Bacteria 6136
348 Ga0207677_10054821 3300026023 Bacteria 2723
349 Ga0207703_10026174 3300026035 Bacteria 4590
350 Ga0207703_10347165 3300026035 Bacteria 1365
351 Ga0207703_10709336 3300026035 Bacteria 957
352 Ga0207639_10000019 3300026041 Bacteria 246728
353 Ga0207678_10618252 3300026067 Bacteria 950
354 Ga0207702_10045597 3300026078 Bacteria 3688
355 Ga0207702_10148752 3300026078 Bacteria 2128
356 Ga0207641_10025333 3300026088 Bacteria 4891
357 Ga0207641_10136286 3300026088 Bacteria 2210
358 Ga0207648_10014184 3300026089 Bacteria 7369
359 Ga0207676_10102430 3300026095 Bacteria 2377
360 Ga0207674_10003625 3300026116 Bacteria 18829
361 Ga0207683_10002031 3300026121 Bacteria 17894
362 Ga0207683_10019180 3300026121 Bacteria 5840
363 Ga0207683_10021171 3300026121 Bacteria 5565
364 Ga0268266_10010104 3300028379 Bacteria 8274
365 Ga0268266_10020958 3300028379 Bacteria 5572
366 Ga0268266_10279768 3300028379 Bacteria 1551
367 Ga0268266_10342542 3300028379 Bacteria 1403
368 Ga0268266_10428906 3300028379 Bacteria 1254
369 Ga0268265_10049204 3300028380 Bacteria 3169
370 Ga0268265_10575427 3300028380 Bacteria 1073
371 Ga0268264_10043163 3300028381 Bacteria 3736
372 Ga0265330_10150754 3300031235 Bacteria 988
373 Ga0265316_10208554 3300031344 Bacteria 1446
374 Ga0307513_10137766 3300031456 Bacteria 2373
375 Ga0307413_10307916 3300031824 Bacteria 1204
376 Ga0307410_10025821 3300031852 Bacteria 3690
377 Ga0307409_100118727 3300031995 Bacteria 2234
378 Ga0307409_100433081 3300031995 Bacteria 1265
379 Ga0307416_100082683 3300032002 Bacteria 2721
380 Ga0307416_100557434 3300032002 Bacteria 1220
381 Ga0307416_100973830 3300032002 Bacteria 951
382 Ga0307411_10141997 3300032005 Bacteria 1772
383 Ga0373926_0048133 3300035083 Bacteria 1533
384 Ga0373954_0204689 3300035118 Bacteria 970
385 Ga0373943_0128896 3300035170 Bacteria 1352
386 Ga0373946_0011788 3300035171 Bacteria 3268
387 Ga0373955_0020926 3300035172 Bacteria 3294
388 Ga0373924_0036750 3300035410 Bacteria 1992
389 Ga0373931_0214025 3300035691 Bacteria 1157
390 Ga0373935_0010731 3300035692 Bacteria 5504
391 Ga0373935_0076518 3300035692 Bacteria 2167
392 Ga0373947_0033533 3300035725 Bacteria 3032
393 Ga0373937_0007726 3300036401 Bacteria 9320
394 Ga0373937_0142912 3300036401 Bacteria 2239
395 Ga0373937_0393484 3300036401 Bacteria 1315
396 Ga0373925_0174691 3300037068 Bacteria 1697
397 Ga0373925_0539072 3300037068 Bacteria 959
398 Ga0395899_0190865 3300037312 Bacteria 1434
399 Ga0395900_0387631 3300037418 Bacteria 1364
400 Ga0436364_0367939 3300037853 Bacteria 2351
401 Ga0436364_1196405 3300037853 Bacteria 2969
402 Ga0395901_0012233 3300038443 Bacteria 8710
403 Ga0395901_0103973 3300038443 Bacteria 2980
404 Ga0436365_0071258 3300039437 Bacteria 37638
405 Ga0436365_0761885 3300039437 Bacteria 4673
406 Ga0436365_0818660 3300039437 Bacteria 34963
407 Ga0436365_0831869 3300039437 Unclassified 3457
408 Ga0436365_1923965 3300039437 Bacteria 20645
409 Ga0436360_0105884 3300039438 Bacteria 9726
410 Ga0436360_0554333 3300039438 Bacteria 6664
411 Ga0436360_0829103 3300039438 Bacteria 1943
412 Ga0436360_0832359 3300039438 Bacteria 4519
413 Ga0436360_0981398 3300039438 Unclassified 2894
414 Ga0436361_0132728 3300039447 Bacteria 1619
415 Ga0436361_0138991 3300039447 Bacteria 1710
416 Ga0436361_0172514 3300039447 Bacteria 2421
417 Ga0436361_0266084 3300039447 Bacteria 1102
418 Ga0436361_0381704 3300039447 Unclassified 3538
419 Ga0436361_0432650 3300039447 Unclassified 1672
420 Ga0436361_0523568 3300039447 Bacteria 6663
421 Ga0436361_0955202 3300039447 Bacteria 2608
422 Ga0436361_1041738 3300039447 Bacteria 4500
423 Ga0436361_1194033 3300039447 Bacteria 6040
424 Ga0436363_0639431 3300039450 Bacteria 4729
425 Ga0436363_1682874 3300039450 Bacteria 1552
426 Ga0436362_0402008 3300039453 Unclassified 2380
427 Ga0436362_0556011 3300039453 Unclassified 963
428 Ga0451807_0876074 3300041486 Viruses 1087
429 Ga0451576_0033056 3300045051 Bacteria 5500
430 Ga0451576_0803002 3300045051 Bacteria 988
431 Ga0466967_0316681 3300045976 Bacteria 1504
432 Ga0495592_0048276 3300046454 Bacteria 3167
433 Ga0495608_0240038 3300046511 Bacteria 1132
434 Ga0495630_0000483 3300046517 Bacteria 29587
435 Ga0495630_0041259 3300046517 Bacteria 3446
436 Ga0495643_0000105 3300046522 Bacteria 139396
437 Ga0495652_0020595 3300046529 Bacteria 5861
438 Ga0495640_0039060 3300046533 Bacteria 3334
439 Ga0495640_0254874 3300046533 Bacteria 1098
440 Ga0495586_0122231 3300046535 Bacteria 1455
441 Ga0495645_0051896 3300046543 Bacteria 2984
442 Ga0495667_0311402 3300046559 Bacteria 997
443 Ga0495656_0088395 3300046615 Bacteria 1412
444 Ga0495634_0125553 3300046642 Bacteria 1640
445 Ga0495659_0117514 3300046664 Bacteria 1044
446 Ga0495657_0212005 3300046675 Bacteria 1177
447 Ga0495646_0072704 3300046680 Bacteria 2022
448 Ga0495658_0170572 3300046683 Bacteria 1346
449 Ga0495613_0002425 3300046689 Bacteria 14076
450 Ga0495613_0105084 3300046689 Bacteria 2039
451 Ga0495624_0081404 3300046690 Bacteria 2005
452 Ga0495600_0076220 3300046809 Bacteria 2190
453 Ga0495581_0041815 3300047315 Bacteria 2653
454 Ga0495674_0017129 3300047319 Bacteria 6749
455 Ga0495674_0179986 3300047319 Bacteria 1761
456 Ga0495684_0002085 3300047471 Bacteria 16076
457 Ga0495684_0084626 3300047471 Bacteria 2406
458 Ga0495684_0105987 3300047471 Bacteria 2124
459 Ga0495684_0249450 3300047471 Bacteria 1292
460 Ga0496100_0002986 3300048903 Bacteria 8708
461 Ga0496100_0034627 3300048903 Bacteria 3171
462 Ga0496101_0045884 3300048904 Bacteria 3132
463 Ga0496102_0679097 3300048905 Bacteria 953
464 Ga0496103_0003746 3300048906 Bacteria 9248
465 Ga0496104_0014922 3300048907 Bacteria 7024
466 Ga0496104_0141459 3300048907 Unclassified 2311
467 Ga0496104_0224590 3300048907 Bacteria 1790
468 Ga0496106_0000430 3300048909 Bacteria 29885
469 Ga0496107_0000174 3300048910 Bacteria 33216
470 Ga0496108_0017250 3300048911 Bacteria 5905
471 Ga0496108_0452049 3300048911 Bacteria 1122
472 Ga0496108_0627917 3300048911 Unclassified 935
473 Ga0496109_0055891 3300048912 Bacteria 3601
474 Ga0496109_0104354 3300048912 Bacteria 2632
475 Ga0496109_0149302 3300048912 Bacteria 2188
476 Ga0496109_0548937 3300048912 Unclassified 1090
477 Ga0496111_0303169 3300048914 Bacteria 1184
478 Ga0496112_0006024 3300048915 Bacteria 10583
479 Ga0496112_0010611 3300048915 Bacteria 8370
480 Ga0496112_0011331 3300048915 Bacteria 8137
481 Ga0496112_0016762 3300048915 Bacteria 6871
482 Ga0496112_0019136 3300048915 Bacteria 6457
483 Ga0496113_0042830 3300048916 Unclassified 3347
484 Ga0496113_0141403 3300048916 Bacteria 1894
485 Ga0496114_0024795 3300048917 Bacteria 4897
486 Ga0496115_0003485 3300048918 Bacteria 11311
487 Ga0496115_0035536 3300048918 Bacteria 3942
488 Ga0496115_0338787 3300048918 Bacteria 1228
489 Ga0501032_0039123 3300049569 Bacteria 3227
490 Ga0501034_0003936 3300049571 Bacteria 16694
491 Ga0501037_0019049 3300049573 Bacteria 5060
492 Ga0501047_0006754 3300049581 Bacteria 10783
493 Ga0501080_0013875 3300049742 Bacteria 7417
494 Ga0501080_0039506 3300049742 Bacteria 4404
495 Ga0501044_0000774 3300049823 Bacteria 38751
496 Ga0501044_0140375 3300049823 Bacteria 2405
497 nmdc:mga08y16_280607_c1 3300050511 Bacteria 1718
498 nmdc:mga08y16_315830_c1 3300050511 Bacteria 1609
499 nmdc:mga0n895_38298_c1 3300050512 Unclassified 4644
500 nmdc:mga0rr50_261729_c1 3300050513 Unclassified 1439
501 Ga0495601_0134467 3300053077 Bacteria 1611
502 Ga0495619_0116979 3300053085 Bacteria 1825

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046533 Ga0495640_0254874 Ga0495640_0254874_10_756 240
2 3300005844 Ga0068862_100634234 Ga0068862_1006342342 242
3 3300026067 Ga0207678_10618252 Ga0207678_106182522 244
4 3300005327 Ga0070658_10029659 Ga0070658_100296593 245
5 3300005617 Ga0068859_100874871 Ga0068859_1008748712 246
6 3300006931 Ga0097620_100874702 Ga0097620_1008747021 246
7 3300005539 Ga0068853_100000011 Ga0068853_10000001141 248
8 3300026041 Ga0207639_10000019 Ga0207639_10000019151 248
9 3300005435 Ga0070714_100098117 Ga0070714_1000981172 249
10 3300005563 Ga0068855_100327224 Ga0068855_1003272242 249
11 3300005563 Ga0068855_100855140 Ga0068855_1008551401 249
12 3300009093 Ga0105240_10018462 Ga0105240_100184622 249
13 3300009098 Ga0105245_10024665 Ga0105245_100246653 249
14 3300010375 Ga0105239_10279156 Ga0105239_102791562 249
15 3300013104 Ga0157370_10199597 Ga0157370_101995972 249
16 3300013105 Ga0157369_10100533 Ga0157369_101005332 249
17 3300013307 Ga0157372_10131216 Ga0157372_101312162 249
18 3300025913 Ga0207695_10000450 Ga0207695_1000045038 249
19 3300025927 Ga0207687_10037865 Ga0207687_100378653 249
20 3300025929 Ga0207664_10139724 Ga0207664_101397242 249
21 3300025929 Ga0207664_10197020 Ga0207664_101970201 249
22 3300026078 Ga0207702_10045597 Ga0207702_100455975 249
23 3300039447 Ga0436361_0955202 Ga0436361_0955202_433_1218 249
24 3300005436 Ga0070713_100677211 Ga0070713_1006772111 250
25 3300009093 Ga0105240_10000057 Ga0105240_1000005722 250
26 3300009553 Ga0105249_10285746 Ga0105249_102857463 250
27 3300025913 Ga0207695_10000072 Ga0207695_1000007222 250
28 3300025933 Ga0207706_10084820 Ga0207706_100848203 250
29 3300049742 Ga0501080_0039506 Ga0501080_0039506_904_1674 250
30 3300005290 Ga0065712_10151695 Ga0065712_101516952 251
31 3300005327 Ga0070658_10020004 Ga0070658_100200042 251
32 3300005339 Ga0070660_100064592 Ga0070660_1000645922 251
33 3300005842 Ga0068858_100041846 Ga0068858_1000418462 251
34 3300006028 Ga0070717_10131430 Ga0070717_101314302 251
35 3300006358 Ga0068871_100195222 Ga0068871_1001952222 251
36 3300009174 Ga0105241_10352370 Ga0105241_103523702 251
37 3300009545 Ga0105237_10005488 Ga0105237_1000548813 251
38 3300013105 Ga0157369_10242375 Ga0157369_102423752 251
39 3300025914 Ga0207671_10039468 Ga0207671_100394682 251
40 3300026035 Ga0207703_10026174 Ga0207703_100261743 251
41 3300046689 Ga0495613_0105084 Ga0495613_0105084_1103_1903 251
42 3300005327 Ga0070658_10134476 Ga0070658_101344762 252
43 3300005338 Ga0068868_100493100 Ga0068868_1004931001 252
44 3300005344 Ga0070661_100113246 Ga0070661_1001132462 252
45 3300005548 Ga0070665_100732598 Ga0070665_1007325981 252
46 3300005563 Ga0068855_100080775 Ga0068855_1000807753 252
47 3300006846 Ga0075430_100021635 Ga0075430_1000216355 252
48 3300009098 Ga0105245_10150385 Ga0105245_101503852 252
49 3300009098 Ga0105245_10205710 Ga0105245_102057102 252
50 3300013100 Ga0157373_10127739 Ga0157373_101277392 252
51 3300013104 Ga0157370_10095063 Ga0157370_100950632 252
52 3300013105 Ga0157369_10188536 Ga0157369_101885362 252
53 3300013307 Ga0157372_10067032 Ga0157372_100670322 252
54 3300025920 Ga0207649_10329054 Ga0207649_103290542 252
55 3300025927 Ga0207687_10150507 Ga0207687_101505072 252
56 3300025929 Ga0207664_10218473 Ga0207664_102184732 252
57 3300026116 Ga0207674_10003625 Ga0207674_100036258 252
58 3300028379 Ga0268266_10279768 Ga0268266_102797681 252
59 3300037312 Ga0395899_0190865 Ga0395899_0190865_496_1299 252
60 3300038443 Ga0395901_0103973 Ga0395901_0103973_1635_2438 252
61 3300046517 Ga0495630_0000483 Ga0495630_0000483_10627_11430 252
62 3300046522 Ga0495643_0000105 Ga0495643_0000105_38488_39267 252
63 3300046615 Ga0495656_0088395 Ga0495656_0088395_544_1350 252
64 3300046642 Ga0495634_0125553 Ga0495634_0125553_51_854 252
65 3300046680 Ga0495646_0072704 Ga0495646_0072704_1007_1810 252
66 3300046690 Ga0495624_0081404 Ga0495624_0081404_1129_1932 252
67 3300047315 Ga0495581_0041815 Ga0495581_0041815_669_1472 252
68 3300047319 Ga0495674_0017129 Ga0495674_0017129_5691_6494 252
69 3300047471 Ga0495684_0002085 Ga0495684_0002085_12814_13617 252
70 3300005354 Ga0070675_100158210 Ga0070675_1001582102 253
71 3300005367 Ga0070667_100035329 Ga0070667_1000353294 253
72 3300005842 Ga0068858_100667818 Ga0068858_1006678182 253
73 3300005985 Ga0081539_10006328 Ga0081539_100063282 253
74 3300025903 Ga0207680_10156307 Ga0207680_101563071 253
75 3300025907 Ga0207645_10091809 Ga0207645_100918092 253
76 3300025926 Ga0207659_10063229 Ga0207659_100632292 253
77 3300025937 Ga0207669_10081094 Ga0207669_100810942 253
78 3300025940 Ga0207691_10036248 Ga0207691_100362485 253
79 3300025960 Ga0207651_10045287 Ga0207651_100452872 253
80 3300025972 Ga0207668_10536475 Ga0207668_105364751 253
81 3300025986 Ga0207658_10146322 Ga0207658_101463223 253
82 3300026035 Ga0207703_10709336 Ga0207703_107093361 253
83 3300031995 Ga0307409_100118727 Ga0307409_1001187272 253
84 3300032002 Ga0307416_100082683 Ga0307416_1000826832 253
85 3300037418 Ga0395900_0387631 Ga0395900_0387631_25_828 253
86 3300047471 Ga0495684_0249450 Ga0495684_0249450_345_1172 253
87 3300005327 Ga0070658_10159233 Ga0070658_101592332 254
88 3300005548 Ga0070665_100000772 Ga0070665_1000007724 254
89 3300005563 Ga0068855_100057644 Ga0068855_1000576442 254
90 3300005618 Ga0068864_100031014 Ga0068864_1000310141 254
91 3300005841 Ga0068863_100126845 Ga0068863_1001268452 254
92 3300009147 Ga0114129_10907403 Ga0114129_109074032 254
93 3300010375 Ga0105239_10201434 Ga0105239_102014343 254
94 3300013306 Ga0163162_10818274 Ga0163162_108182741 254
95 3300013307 Ga0157372_10426175 Ga0157372_104261752 254
96 3300013308 Ga0157375_10383176 Ga0157375_103831762 254
97 3300025909 Ga0207705_10058972 Ga0207705_100589723 254
98 3300025949 Ga0207667_10025782 Ga0207667_100257822 254
99 3300026088 Ga0207641_10025333 Ga0207641_100253333 254
100 3300026095 Ga0207676_10102430 Ga0207676_101024301 254
101 3300028379 Ga0268266_10010104 Ga0268266_100101042 254
102 3300028380 Ga0268265_10575427 Ga0268265_105754272 254
103 3300031235 Ga0265330_10150754 Ga0265330_101507541 254
104 3300031344 Ga0265316_10208554 Ga0265316_102085541 254
105 3300032002 Ga0307416_100973830 Ga0307416_1009738301 254
106 3300036401 Ga0373937_0142912 Ga0373937_0142912_33_836 254
107 3300039437 Ga0436365_0831869 Ga0436365_0831869_1279_2058 254
108 3300039450 Ga0436363_1682874 Ga0436363_1682874_563_1342 254
109 3300045051 Ga0451576_0033056 Ga0451576_0033056_4145_4921 254
110 3300046511 Ga0495608_0240038 Ga0495608_0240038_156_959 254
111 3300046535 Ga0495586_0122231 Ga0495586_0122231_222_1025 254
112 3300046689 Ga0495613_0002425 Ga0495613_0002425_6054_6857 254
113 3300046809 Ga0495600_0076220 Ga0495600_0076220_355_1158 254
114 3300047319 Ga0495674_0179986 Ga0495674_0179986_181_984 254
115 3300047471 Ga0495684_0084626 Ga0495684_0084626_29_832 254
116 3300047471 Ga0495684_0105987 Ga0495684_0105987_611_1414 254
117 3300049569 Ga0501032_0039123 Ga0501032_0039123_2048_2851 254
118 3300049571 Ga0501034_0003936 Ga0501034_0003936_15852_16655 254
119 3300049573 Ga0501037_0019049 Ga0501037_0019049_3686_4489 254
120 3300049581 Ga0501047_0006754 Ga0501047_0006754_7264_8067 254
121 3300049742 Ga0501080_0013875 Ga0501080_0013875_303_1106 254
122 3300049823 Ga0501044_0000774 Ga0501044_0000774_33303_34106 254
123 3300049823 Ga0501044_0140375 Ga0501044_0140375_1477_2280 254
124 3300005333 Ga0070677_10138660 Ga0070677_101386602 255
125 3300005354 Ga0070675_100010789 Ga0070675_1000107894 255
126 3300005467 Ga0070706_100000973 Ga0070706_10000097310 255
127 3300005471 Ga0070698_100001144 Ga0070698_10000114425 255
128 3300005471 Ga0070698_100395986 Ga0070698_1003959862 255
129 3300005530 Ga0070679_100765796 Ga0070679_1007657961 255
130 3300005536 Ga0070697_100001763 Ga0070697_10000176312 255
131 3300005536 Ga0070697_100045936 Ga0070697_1000459363 255
132 3300005546 Ga0070696_100327680 Ga0070696_1003276801 255
133 3300006028 Ga0070717_10086635 Ga0070717_100866352 255
134 3300006173 Ga0070716_100058213 Ga0070716_1000582132 255
135 3300006175 Ga0070712_100052217 Ga0070712_1000522173 255
136 3300007788 Ga0099795_10077478 Ga0099795_100774782 255
137 3300009094 Ga0111539_10112062 Ga0111539_101120624 255
138 3300021361 Ga0213872_10011117 Ga0213872_100111173 255
139 3300021361 Ga0213872_10043134 Ga0213872_100431342 255
140 3300021377 Ga0213874_10015345 Ga0213874_100153452 255
141 3300021384 Ga0213876_10015390 Ga0213876_100153902 255
142 3300021441 Ga0213871_10004130 Ga0213871_100041302 255
143 3300021441 Ga0213871_10015935 Ga0213871_100159352 255
144 3300025906 Ga0207699_10183450 Ga0207699_101834502 255
145 3300025910 Ga0207684_10001687 Ga0207684_1000168711 255
146 3300025910 Ga0207684_10238014 Ga0207684_102380142 255
147 3300025928 Ga0207700_10034697 Ga0207700_100346972 255
148 3300025928 Ga0207700_10075642 Ga0207700_100756423 255
149 3300028381 Ga0268264_10043163 Ga0268264_100431633 255
150 3300031824 Ga0307413_10307916 Ga0307413_103079162 255
151 3300031852 Ga0307410_10025821 Ga0307410_100258214 255
152 3300031995 Ga0307409_100433081 Ga0307409_1004330812 255
153 3300032002 Ga0307416_100557434 Ga0307416_1005574341 255
154 3300032005 Ga0307411_10141997 Ga0307411_101419971 255
155 3300037853 Ga0436364_0367939 Ga0436364_0367939_1183_1965 255
156 3300039437 Ga0436365_0071258 Ga0436365_0071258_17116_17898 255
157 3300039437 Ga0436365_0761885 Ga0436365_0761885_2424_3311 255
158 3300039438 Ga0436360_0554333 Ga0436360_0554333_2544_3326 255
159 3300039438 Ga0436360_0981398 Ga0436360_0981398_1479_2261 255
160 3300039447 Ga0436361_0172514 Ga0436361_0172514_334_1116 255
161 3300039447 Ga0436361_0381704 Ga0436361_0381704_1791_2573 255
162 3300039447 Ga0436361_0432650 Ga0436361_0432650_485_1267 255
163 3300039447 Ga0436361_1194033 Ga0436361_1194033_1606_2388 255
164 3300039450 Ga0436363_0639431 Ga0436363_0639431_3031_3810 255
165 3300039453 Ga0436362_0402008 Ga0436362_0402008_634_1416 255
166 3300046664 Ga0495659_0117514 Ga0495659_0117514_46_915 255
167 3300048911 Ga0496108_0627917 Ga0496108_0627917_156_923 255
168 3300050511 nmdc:mga08y16_315830_c1 nmdc:mga08y16_315830_c1_770_1576 255
169 3300002126 JGI24035J26624_1002346 JGI24035J26624_10023462 256
170 3300003203 JGI25406J46586_10000023 JGI25406J46586_1000002379 256
171 3300005289 Ga0065704_10162264 Ga0065704_101622641 256
172 3300005290 Ga0065712_10007547 Ga0065712_100075472 256
173 3300005293 Ga0065715_10001773 Ga0065715_100017732 256
174 3300005295 Ga0065707_10006006 Ga0065707_100060063 256
175 3300005328 Ga0070676_10002923 Ga0070676_100029237 256
176 3300005328 Ga0070676_10012692 Ga0070676_100126924 256
177 3300005331 Ga0070670_100112690 Ga0070670_1001126903 256
178 3300005333 Ga0070677_10023490 Ga0070677_100234903 256
179 3300005335 Ga0070666_10061459 Ga0070666_100614592 256
180 3300005338 Ga0068868_100251472 Ga0068868_1002514722 256
181 3300005339 Ga0070660_100046737 Ga0070660_1000467372 256
182 3300005341 Ga0070691_10145511 Ga0070691_101455112 256
183 3300005347 Ga0070668_100002392 Ga0070668_1000023927 256
184 3300005347 Ga0070668_100025289 Ga0070668_1000252893 256
185 3300005353 Ga0070669_100012301 Ga0070669_1000123017 256
186 3300005353 Ga0070669_100304104 Ga0070669_1003041042 256
187 3300005354 Ga0070675_100059781 Ga0070675_1000597814 256
188 3300005354 Ga0070675_100108573 Ga0070675_1001085732 256
189 3300005355 Ga0070671_100313908 Ga0070671_1003139081 256
190 3300005356 Ga0070674_100003820 Ga0070674_1000038202 256
191 3300005356 Ga0070674_100239453 Ga0070674_1002394531 256
192 3300005364 Ga0070673_100240659 Ga0070673_1002406592 256
193 3300005365 Ga0070688_100198870 Ga0070688_1001988702 256
194 3300005367 Ga0070667_100035605 Ga0070667_1000356053 256
195 3300005367 Ga0070667_100079668 Ga0070667_1000796682 256
196 3300005435 Ga0070714_100209009 Ga0070714_1002090092 256
197 3300005435 Ga0070714_100272972 Ga0070714_1002729722 256
198 3300005439 Ga0070711_100025400 Ga0070711_1000254004 256
199 3300005445 Ga0070708_100055215 Ga0070708_1000552152 256
200 3300005456 Ga0070678_100139834 Ga0070678_1001398342 256
201 3300005456 Ga0070678_100240186 Ga0070678_1002401862 256
202 3300005457 Ga0070662_100278330 Ga0070662_1002783302 256
203 3300005467 Ga0070706_100025763 Ga0070706_1000257633 256
204 3300005467 Ga0070706_100085389 Ga0070706_1000853893 256
205 3300005467 Ga0070706_100086901 Ga0070706_1000869013 256
206 3300005467 Ga0070706_100334651 Ga0070706_1003346512 256
207 3300005468 Ga0070707_100035472 Ga0070707_1000354722 256
208 3300005468 Ga0070707_100053866 Ga0070707_1000538662 256
209 3300005468 Ga0070707_100125541 Ga0070707_1001255412 256
210 3300005471 Ga0070698_100004844 Ga0070698_1000048445 256
211 3300005471 Ga0070698_100037336 Ga0070698_1000373364 256
212 3300005536 Ga0070697_100179633 Ga0070697_1001796332 256
213 3300005545 Ga0070695_100247823 Ga0070695_1002478232 256
214 3300005548 Ga0070665_100099861 Ga0070665_1000998613 256
215 3300005564 Ga0070664_100136539 Ga0070664_1001365392 256
216 3300005614 Ga0068856_100340662 Ga0068856_1003406622 256
217 3300005718 Ga0068866_10003045 Ga0068866_100030456 256
218 3300005719 Ga0068861_100075982 Ga0068861_1000759822 256
219 3300005844 Ga0068862_100084148 Ga0068862_1000841482 256
220 3300005985 Ga0081539_10000014 Ga0081539_1000001488 256
221 3300006028 Ga0070717_10043561 Ga0070717_100435615 256
222 3300006028 Ga0070717_10199955 Ga0070717_101999552 256
223 3300006175 Ga0070712_100009931 Ga0070712_1000099314 256
224 3300006175 Ga0070712_100022325 Ga0070712_1000223252 256
225 3300006175 Ga0070712_100239676 Ga0070712_1002396762 256
226 3300006175 Ga0070712_100316698 Ga0070712_1003166982 256
227 3300006237 Ga0097621_100388288 Ga0097621_1003882881 256
228 3300006871 Ga0075434_100197461 Ga0075434_1001974612 256
229 3300006881 Ga0068865_100098170 Ga0068865_1000981702 256
230 3300007788 Ga0099795_10003993 Ga0099795_100039933 256
231 3300009098 Ga0105245_10084114 Ga0105245_100841142 256
232 3300009101 Ga0105247_10042622 Ga0105247_100426222 256
233 3300009176 Ga0105242_10007257 Ga0105242_100072576 256
234 3300010159 Ga0099796_10021508 Ga0099796_100215082 256
235 3300010375 Ga0105239_10035778 Ga0105239_100357786 256
236 3300013102 Ga0157371_10187751 Ga0157371_101877512 256
237 3300013296 Ga0157374_10054807 Ga0157374_100548072 256
238 3300013296 Ga0157374_10447850 Ga0157374_104478501 256
239 3300013297 Ga0157378_10180162 Ga0157378_101801622 256
240 3300013306 Ga0163162_10020938 Ga0163162_100209382 256
241 3300013308 Ga0157375_10009538 Ga0157375_100095386 256
242 3300013308 Ga0157375_10112623 Ga0157375_101126234 256
243 3300013308 Ga0157375_10166101 Ga0157375_101661012 256
244 3300014325 Ga0163163_10121331 Ga0163163_101213313 256
245 3300014968 Ga0157379_10636717 Ga0157379_106367172 256
246 3300017792 Ga0163161_10000942 Ga0163161_1000094220 256
247 3300021361 Ga0213872_10021749 Ga0213872_100217492 256
248 3300021361 Ga0213872_10081131 Ga0213872_100811312 256
249 3300021361 Ga0213872_10100578 Ga0213872_101005782 256
250 3300025315 Ga0207697_10000262 Ga0207697_1000026211 256
251 3300025901 Ga0207688_10000823 Ga0207688_100008239 256
252 3300025906 Ga0207699_10004399 Ga0207699_100043994 256
253 3300025906 Ga0207699_10315003 Ga0207699_103150031 256
254 3300025906 Ga0207699_10349132 Ga0207699_103491322 256
255 3300025907 Ga0207645_10000823 Ga0207645_1000082323 256
256 3300025910 Ga0207684_10120686 Ga0207684_101206862 256
257 3300025910 Ga0207684_10152052 Ga0207684_101520522 256
258 3300025910 Ga0207684_10214002 Ga0207684_102140022 256
259 3300025915 Ga0207693_10002474 Ga0207693_100024746 256
260 3300025915 Ga0207693_10006817 Ga0207693_100068177 256
261 3300025915 Ga0207693_10070160 Ga0207693_100701603 256
262 3300025916 Ga0207663_10001758 Ga0207663_100017587 256
263 3300025916 Ga0207663_10138907 Ga0207663_101389073 256
264 3300025916 Ga0207663_10533298 Ga0207663_105332982 256
265 3300025918 Ga0207662_10064006 Ga0207662_100640062 256
266 3300025919 Ga0207657_10106039 Ga0207657_101060393 256
267 3300025922 Ga0207646_10066818 Ga0207646_100668184 256
268 3300025922 Ga0207646_10104602 Ga0207646_101046022 256
269 3300025923 Ga0207681_10011020 Ga0207681_100110204 256
270 3300025925 Ga0207650_10021161 Ga0207650_100211614 256
271 3300025926 Ga0207659_10007927 Ga0207659_100079272 256
272 3300025929 Ga0207664_10207085 Ga0207664_102070852 256
273 3300025931 Ga0207644_10034397 Ga0207644_100343971 256
274 3300025931 Ga0207644_10178446 Ga0207644_101784462 256
275 3300025932 Ga0207690_10108432 Ga0207690_101084322 256
276 3300025933 Ga0207706_10036106 Ga0207706_100361064 256
277 3300025933 Ga0207706_10151613 Ga0207706_101516132 256
278 3300025934 Ga0207686_10008278 Ga0207686_100082786 256
279 3300025937 Ga0207669_10012468 Ga0207669_100124682 256
280 3300025937 Ga0207669_10277044 Ga0207669_102770441 256
281 3300025938 Ga0207704_10393596 Ga0207704_103935962 256
282 3300025939 Ga0207665_10010290 Ga0207665_100102904 256
283 3300025940 Ga0207691_10003086 Ga0207691_1000308614 256
284 3300025960 Ga0207651_10253309 Ga0207651_102533091 256
285 3300025972 Ga0207668_10011447 Ga0207668_100114472 256
286 3300025972 Ga0207668_10025525 Ga0207668_100255254 256
287 3300025986 Ga0207658_10488118 Ga0207658_104881182 256
288 3300026023 Ga0207677_10007188 Ga0207677_100071883 256
289 3300026078 Ga0207702_10148752 Ga0207702_101487522 256
290 3300026121 Ga0207683_10019180 Ga0207683_100191802 256
291 3300026121 Ga0207683_10021171 Ga0207683_100211712 256
292 3300028379 Ga0268266_10428906 Ga0268266_104289062 256
293 3300028380 Ga0268265_10049204 Ga0268265_100492042 256
294 3300031456 Ga0307513_10137766 Ga0307513_101377662 256
295 3300035083 Ga0373926_0048133 Ga0373926_0048133_367_1155 256
296 3300035171 Ga0373946_0011788 Ga0373946_0011788_996_1778 256
297 3300035691 Ga0373931_0214025 Ga0373931_0214025_343_1113 256
298 3300035692 Ga0373935_0010731 Ga0373935_0010731_3163_3933 256
299 3300035692 Ga0373935_0076518 Ga0373935_0076518_175_963 256
300 3300035725 Ga0373947_0033533 Ga0373947_0033533_761_1549 256
301 3300037068 Ga0373925_0174691 Ga0373925_0174691_670_1458 256
302 3300037853 Ga0436364_1196405 Ga0436364_1196405_2161_2949 256
303 3300038443 Ga0395901_0012233 Ga0395901_0012233_974_1756 256
304 3300039437 Ga0436365_0818660 Ga0436365_0818660_25046_25837 256
305 3300039438 Ga0436360_0105884 Ga0436360_0105884_1601_2386 256
306 3300039438 Ga0436360_0829103 Ga0436360_0829103_707_1492 256
307 3300039438 Ga0436360_0832359 Ga0436360_0832359_1369_2154 256
308 3300039447 Ga0436361_0132728 Ga0436361_0132728_723_1508 256
309 3300039447 Ga0436361_0138991 Ga0436361_0138991_781_1566 256
310 3300039447 Ga0436361_0266084 Ga0436361_0266084_18_803 256
311 3300039447 Ga0436361_0523568 Ga0436361_0523568_1081_1866 256
312 3300039447 Ga0436361_1041738 Ga0436361_1041738_1046_1831 256
313 3300039453 Ga0436362_0556011 Ga0436362_0556011_117_902 256
314 3300041486 Ga0451807_0876074 Ga0451807_0876074_39_827 256
315 3300045051 Ga0451576_0803002 Ga0451576_0803002_183_953 256
316 3300048903 Ga0496100_0002986 Ga0496100_0002986_311_1099 256
317 3300048906 Ga0496103_0003746 Ga0496103_0003746_3132_3920 256
318 3300048907 Ga0496104_0141459 Ga0496104_0141459_376_1158 256
319 3300048907 Ga0496104_0224590 Ga0496104_0224590_345_1115 256
320 3300048909 Ga0496106_0000430 Ga0496106_0000430_21286_22074 256
321 3300048910 Ga0496107_0000174 Ga0496107_0000174_10426_11214 256
322 3300048911 Ga0496108_0017250 Ga0496108_0017250_1460_2248 256
323 3300048912 Ga0496109_0149302 Ga0496109_0149302_831_1601 256
324 3300048912 Ga0496109_0548937 Ga0496109_0548937_198_980 256
325 3300048914 Ga0496111_0303169 Ga0496111_0303169_201_989 256
326 3300048915 Ga0496112_0006024 Ga0496112_0006024_9288_10070 256
327 3300048915 Ga0496112_0011331 Ga0496112_0011331_3449_4237 256
328 3300048915 Ga0496112_0016762 Ga0496112_0016762_4525_5307 256
329 3300048916 Ga0496113_0042830 Ga0496113_0042830_2041_2823 256
330 3300048916 Ga0496113_0141403 Ga0496113_0141403_471_1259 256
331 3300048918 Ga0496115_0035536 Ga0496115_0035536_137_925 256
332 3300048918 Ga0496115_0338787 Ga0496115_0338787_325_1110 256
333 3300050512 nmdc:mga0n895_38298_c1 nmdc:mga0n895_38298_c1_3603_4385 256
334 3300050513 nmdc:mga0rr50_261729_c1 nmdc:mga0rr50_261729_c1_205_993 256
335 3300000545 CNXas_1000382 CNXas_10003825 257
336 3300005290 Ga0065712_10115221 Ga0065712_101152212 257
337 3300005328 Ga0070676_10018442 Ga0070676_100184422 257
338 3300005328 Ga0070676_10065346 Ga0070676_100653462 257
339 3300005329 Ga0070683_100053148 Ga0070683_1000531483 257
340 3300005330 Ga0070690_100097786 Ga0070690_1000977862 257
341 3300005330 Ga0070690_100568227 Ga0070690_1005682271 257
342 3300005331 Ga0070670_100005320 Ga0070670_10000532011 257
343 3300005331 Ga0070670_100006708 Ga0070670_1000067084 257
344 3300005331 Ga0070670_100026824 Ga0070670_1000268242 257
345 3300005331 Ga0070670_100210319 Ga0070670_1002103192 257
346 3300005334 Ga0068869_100270956 Ga0068869_1002709562 257
347 3300005335 Ga0070666_10005510 Ga0070666_100055107 257
348 3300005335 Ga0070666_10122269 Ga0070666_101222692 257
349 3300005335 Ga0070666_10425795 Ga0070666_104257951 257
350 3300005338 Ga0068868_100076108 Ga0068868_1000761083 257
351 3300005338 Ga0068868_100159304 Ga0068868_1001593042 257
352 3300005338 Ga0068868_100165307 Ga0068868_1001653072 257
353 3300005340 Ga0070689_100292044 Ga0070689_1002920441 257
354 3300005347 Ga0070668_100017294 Ga0070668_1000172946 257
355 3300005353 Ga0070669_100009421 Ga0070669_1000094216 257
356 3300005354 Ga0070675_100143007 Ga0070675_1001430072 257
357 3300005355 Ga0070671_100004750 Ga0070671_1000047505 257
358 3300005355 Ga0070671_100069906 Ga0070671_1000699062 257
359 3300005355 Ga0070671_100247898 Ga0070671_1002478982 257
360 3300005356 Ga0070674_100016618 Ga0070674_1000166185 257
361 3300005356 Ga0070674_100356650 Ga0070674_1003566501 257
362 3300005364 Ga0070673_100019760 Ga0070673_1000197604 257
363 3300005364 Ga0070673_100020468 Ga0070673_1000204685 257
364 3300005365 Ga0070688_100009213 Ga0070688_1000092135 257
365 3300005367 Ga0070667_100014735 Ga0070667_1000147357 257
366 3300005367 Ga0070667_100109467 Ga0070667_1001094672 257
367 3300005435 Ga0070714_100208400 Ga0070714_1002084002 257
368 3300005435 Ga0070714_100624726 Ga0070714_1006247262 257
369 3300005436 Ga0070713_100175055 Ga0070713_1001750552 257
370 3300005439 Ga0070711_100033883 Ga0070711_1000338833 257
371 3300005439 Ga0070711_100201566 Ga0070711_1002015662 257
372 3300005441 Ga0070700_100528666 Ga0070700_1005286661 257
373 3300005445 Ga0070708_100343544 Ga0070708_1003435442 257
374 3300005445 Ga0070708_100398383 Ga0070708_1003983832 257
375 3300005456 Ga0070678_100134973 Ga0070678_1001349732 257
376 3300005459 Ga0068867_100006507 Ga0068867_1000065078 257
377 3300005467 Ga0070706_100086118 Ga0070706_1000861183 257
378 3300005467 Ga0070706_100152683 Ga0070706_1001526833 257
379 3300005467 Ga0070706_100192325 Ga0070706_1001923253 257
380 3300005467 Ga0070706_100208369 Ga0070706_1002083692 257
381 3300005468 Ga0070707_100019586 Ga0070707_1000195864 257
382 3300005468 Ga0070707_100060619 Ga0070707_1000606193 257
383 3300005468 Ga0070707_100143743 Ga0070707_1001437432 257
384 3300005468 Ga0070707_100764700 Ga0070707_1007647002 257
385 3300005471 Ga0070698_100026631 Ga0070698_1000266312 257
386 3300005518 Ga0070699_100091499 Ga0070699_1000914992 257
387 3300005518 Ga0070699_100206480 Ga0070699_1002064802 257
388 3300005536 Ga0070697_100006844 Ga0070697_1000068445 257
389 3300005536 Ga0070697_100025379 Ga0070697_1000253794 257
390 3300005536 Ga0070697_100273453 Ga0070697_1002734532 257
391 3300005536 Ga0070697_100296765 Ga0070697_1002967651 257
392 3300005543 Ga0070672_100011259 Ga0070672_1000112593 257
393 3300005548 Ga0070665_100004925 Ga0070665_1000049253 257
394 3300005548 Ga0070665_100008642 Ga0070665_1000086422 257
395 3300005718 Ga0068866_10077663 Ga0068866_100776632 257
396 3300005841 Ga0068863_100107086 Ga0068863_1001070862 257
397 3300005842 Ga0068858_100099131 Ga0068858_1000991313 257
398 3300005985 Ga0081539_10000710 Ga0081539_1000071058 257
399 3300006028 Ga0070717_10013229 Ga0070717_100132293 257
400 3300006175 Ga0070712_100112065 Ga0070712_1001120652 257
401 3300006237 Ga0097621_100004502 Ga0097621_10000450211 257
402 3300006237 Ga0097621_100081762 Ga0097621_1000817623 257
403 3300006237 Ga0097621_100308188 Ga0097621_1003081882 257
404 3300006358 Ga0068871_100040008 Ga0068871_1000400083 257
405 3300006358 Ga0068871_100303880 Ga0068871_1003038802 257
406 3300006881 Ga0068865_100238865 Ga0068865_1002388652 257
407 3300009094 Ga0111539_10298822 Ga0111539_102988222 257
408 3300009176 Ga0105242_10016185 Ga0105242_100161853 257
409 3300013296 Ga0157374_10011892 Ga0157374_100118926 257
410 3300013296 Ga0157374_10033019 Ga0157374_100330192 257
411 3300013297 Ga0157378_10032112 Ga0157378_100321123 257
412 3300013297 Ga0157378_10039368 Ga0157378_100393682 257
413 3300013297 Ga0157378_10177214 Ga0157378_101772142 257
414 3300013306 Ga0163162_10026233 Ga0163162_100262337 257
415 3300013306 Ga0163162_10157827 Ga0163162_101578273 257
416 3300013308 Ga0157375_10003770 Ga0157375_100037704 257
417 3300013308 Ga0157375_10034179 Ga0157375_100341795 257
418 3300013308 Ga0157375_10235877 Ga0157375_102358772 257
419 3300014969 Ga0157376_10007798 Ga0157376_100077983 257
420 3300021384 Ga0213876_10001438 Ga0213876_1000143811 257
421 3300025290 Ga0207673_1003719 Ga0207673_10037191 257
422 3300025315 Ga0207697_10000238 Ga0207697_1000023812 257
423 3300025315 Ga0207697_10018575 Ga0207697_100185752 257
424 3300025315 Ga0207697_10099162 Ga0207697_100991622 257
425 3300025899 Ga0207642_10139221 Ga0207642_101392211 257
426 3300025901 Ga0207688_10000429 Ga0207688_1000042915 257
427 3300025903 Ga0207680_10026298 Ga0207680_100262984 257
428 3300025903 Ga0207680_10031477 Ga0207680_100314772 257
429 3300025903 Ga0207680_10040126 Ga0207680_100401262 257
430 3300025907 Ga0207645_10015174 Ga0207645_100151743 257
431 3300025907 Ga0207645_10040071 Ga0207645_100400712 257
432 3300025910 Ga0207684_10049137 Ga0207684_100491373 257
433 3300025910 Ga0207684_10188176 Ga0207684_101881762 257
434 3300025910 Ga0207684_10307092 Ga0207684_103070922 257
435 3300025915 Ga0207693_10101281 Ga0207693_101012813 257
436 3300025915 Ga0207693_10119018 Ga0207693_101190182 257
437 3300025916 Ga0207663_10155606 Ga0207663_101556062 257
438 3300025922 Ga0207646_10000513 Ga0207646_100005136 257
439 3300025922 Ga0207646_10447152 Ga0207646_104471522 257
440 3300025923 Ga0207681_10022182 Ga0207681_100221822 257
441 3300025925 Ga0207650_10048973 Ga0207650_100489733 257
442 3300025925 Ga0207650_10147270 Ga0207650_101472702 257
443 3300025925 Ga0207650_10215342 Ga0207650_102153422 257
444 3300025926 Ga0207659_10063739 Ga0207659_100637392 257
445 3300025926 Ga0207659_10098013 Ga0207659_100980132 257
446 3300025929 Ga0207664_10146017 Ga0207664_101460172 257
447 3300025931 Ga0207644_10005188 Ga0207644_100051889 257
448 3300025931 Ga0207644_10086924 Ga0207644_100869242 257
449 3300025931 Ga0207644_10106055 Ga0207644_101060552 257
450 3300025931 Ga0207644_10279564 Ga0207644_102795642 257
451 3300025931 Ga0207644_10532932 Ga0207644_105329321 257
452 3300025934 Ga0207686_10311426 Ga0207686_103114261 257
453 3300025936 Ga0207670_10553891 Ga0207670_105538912 257
454 3300025937 Ga0207669_10009962 Ga0207669_100099623 257
455 3300025937 Ga0207669_10062587 Ga0207669_100625872 257
456 3300025938 Ga0207704_10032009 Ga0207704_100320092 257
457 3300025940 Ga0207691_10000306 Ga0207691_1000030623 257
458 3300025940 Ga0207691_10003406 Ga0207691_1000340613 257
459 3300025940 Ga0207691_10358566 Ga0207691_103585662 257
460 3300025945 Ga0207679_10118737 Ga0207679_101187372 257
461 3300025960 Ga0207651_10052267 Ga0207651_100522672 257
462 3300025960 Ga0207651_10105071 Ga0207651_101050712 257
463 3300025972 Ga0207668_10021024 Ga0207668_100210242 257
464 3300025972 Ga0207668_10227849 Ga0207668_102278492 257
465 3300026023 Ga0207677_10054821 Ga0207677_100548212 257
466 3300026035 Ga0207703_10347165 Ga0207703_103471652 257
467 3300026088 Ga0207641_10136286 Ga0207641_101362862 257
468 3300026089 Ga0207648_10014184 Ga0207648_100141842 257
469 3300026121 Ga0207683_10002031 Ga0207683_1000203112 257
470 3300028379 Ga0268266_10020958 Ga0268266_100209583 257
471 3300028379 Ga0268266_10342542 Ga0268266_103425422 257
472 3300035118 Ga0373954_0204689 Ga0373954_0204689_88_879 257
473 3300035170 Ga0373943_0128896 Ga0373943_0128896_48_839 257
474 3300035172 Ga0373955_0020926 Ga0373955_0020926_2154_2945 257
475 3300035410 Ga0373924_0036750 Ga0373924_0036750_573_1364 257
476 3300036401 Ga0373937_0007726 Ga0373937_0007726_4669_5460 257
477 3300036401 Ga0373937_0393484 Ga0373937_0393484_302_1093 257
478 3300037068 Ga0373925_0539072 Ga0373925_0539072_43_834 257
479 3300039437 Ga0436365_1923965 Ga0436365_1923965_8910_9833 257
480 3300045976 Ga0466967_0316681 Ga0466967_0316681_255_1046 257
481 3300046454 Ga0495592_0048276 Ga0495592_0048276_1577_2368 257
482 3300046517 Ga0495630_0041259 Ga0495630_0041259_218_1009 257
483 3300046529 Ga0495652_0020595 Ga0495652_0020595_4629_5420 257
484 3300046533 Ga0495640_0039060 Ga0495640_0039060_827_1618 257
485 3300046543 Ga0495645_0051896 Ga0495645_0051896_1855_2646 257
486 3300046559 Ga0495667_0311402 Ga0495667_0311402_172_963 257
487 3300046675 Ga0495657_0212005 Ga0495657_0212005_175_966 257
488 3300046683 Ga0495658_0170572 Ga0495658_0170572_408_1199 257
489 3300048903 Ga0496100_0034627 Ga0496100_0034627_846_1637 257
490 3300048904 Ga0496101_0045884 Ga0496101_0045884_1870_2661 257
491 3300048905 Ga0496102_0679097 Ga0496102_0679097_126_917 257
492 3300048907 Ga0496104_0014922 Ga0496104_0014922_1958_2749 257
493 3300048911 Ga0496108_0452049 Ga0496108_0452049_127_918 257
494 3300048912 Ga0496109_0055891 Ga0496109_0055891_1583_2374 257
495 3300048912 Ga0496109_0104354 Ga0496109_0104354_303_1094 257
496 3300048915 Ga0496112_0010611 Ga0496112_0010611_2182_2973 257
497 3300048915 Ga0496112_0019136 Ga0496112_0019136_2620_3411 257
498 3300048917 Ga0496114_0024795 Ga0496114_0024795_2626_3417 257
499 3300048918 Ga0496115_0003485 Ga0496115_0003485_2103_2894 257
500 3300050511 nmdc:mga08y16_280607_c1 nmdc:mga08y16_280607_c1_248_1039 257
501 3300053077 Ga0495601_0134467 Ga0495601_0134467_639_1430 257
502 3300053085 Ga0495619_0116979 Ga0495619_0116979_317_1108 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

58

207

0.92

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

126

240

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9763 4 246
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9719 4 246
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9717 4 245
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9677 4 246
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9628 4 245
ID Description Score Start End Superfamily
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9894 4 245 3.40.50.300
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9846 1 246 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9657 4 245 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9624 17 242 3.40.50.300
af_P16678_3_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9596 4 240 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1G0E135-F1-model_v4 ABC transporter ATP-binding protein 0.9924 4 244 GO:0005524
GO:0016887
AF-A0A640P064-F1-model_v4 ABC transporter ATP-binding protein 0.9903 4 245 GO:0005524
GO:0016887
AF-A0A5C7SZM3-F1-model_v4 ABC transporter ATP-binding protein 0.9897 4 246 GO:0005524
GO:0005886
GO:0016887
AF-A0A2N7JK81-F1-model_v4 ABC transporter ATP-binding protein 0.9883 4 246 GO:0005524
GO:0016887
AF-A0A0A8XEL2-F1-model_v4 Toluene tolerance efflux transporter ABC superfamily, ATP-bind 0.9866 4 245 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.46 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map