F455842
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 502 | 244 | 502 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10117858|Ga0105239_101178583 |
| Length | 154 |
| Sequence | MQIFVFLLLRKTKQDNANLVSALEGIMHHSRLCTIVIDCRTDDLEAAANFWSQAFGKPVASYDVDDDGKYAELKTGDDEPIVLVQKVAHESRVHLDIETDDLEAEAKRLEALGAKRVEFVKDRWWVMEAPTGQRFCLVRRQRKEFGPHLNEWPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 94 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 95 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 157 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 158 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 159 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 162 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 163 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 164 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 165 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 166 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 167 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 168 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 169 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 170 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 180 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 184 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 185 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 186 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 187 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 188 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 189 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 192 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 193 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 233 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 234 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 235 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 236 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 237 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 238 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 239 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 240 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 241 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 242 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.59 |
| Nodule | 0 |
| Rhizoplane | 3.39 |
| Rhizosphere | 87.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000664 | 3300001915 | Bacteria | 10379 |
| 2 | JGI25153J46596_10000103 | 3300003215 | Bacteria | 96279 |
| 3 | rootH2_10223466 | 3300003320 | Bacteria | 1173 |
| 4 | Ga0055531_10013363 | 3300003794 | Bacteria | 3788 |
| 5 | Ga0070658_10104392 | 3300005327 | Bacteria | 2344 |
| 6 | Ga0070658_10182910 | 3300005327 | Bacteria | 1764 |
| 7 | Ga0070676_10008008 | 3300005328 | Bacteria | 5681 |
| 8 | Ga0070676_10008083 | 3300005328 | Bacteria | 5655 |
| 9 | Ga0070676_10087186 | 3300005328 | Unclassified | 1905 |
| 10 | Ga0070690_100081744 | 3300005330 | Bacteria | 2114 |
| 11 | Ga0070670_100219880 | 3300005331 | Bacteria | 1652 |
| 12 | Ga0070677_10285376 | 3300005333 | Bacteria | 833 |
| 13 | Ga0068869_100048141 | 3300005334 | Bacteria | 3081 |
| 14 | Ga0068869_100051553 | 3300005334 | Bacteria | 2986 |
| 15 | Ga0068869_100817651 | 3300005334 | Bacteria | 802 |
| 16 | Ga0068869_101700964 | 3300005334 | Bacteria | 563 |
| 17 | Ga0070666_10075812 | 3300005335 | Bacteria | 2293 |
| 18 | Ga0070666_10156717 | 3300005335 | Bacteria | 1591 |
| 19 | Ga0070689_100141210 | 3300005340 | Bacteria | 1937 |
| 20 | Ga0070661_100173828 | 3300005344 | Bacteria | 1637 |
| 21 | Ga0070661_100240945 | 3300005344 | Bacteria | 1393 |
| 22 | Ga0070692_10153184 | 3300005345 | Bacteria | 1315 |
| 23 | Ga0070668_100012560 | 3300005347 | Bacteria | 6306 |
| 24 | Ga0070668_100107357 | 3300005347 | Bacteria | 2219 |
| 25 | Ga0070669_100015224 | 3300005353 | Bacteria | 5478 |
| 26 | Ga0070669_100391347 | 3300005353 | Bacteria | 1135 |
| 27 | Ga0070671_100292831 | 3300005355 | Bacteria | 1385 |
| 28 | Ga0070671_100299690 | 3300005355 | Bacteria | 1369 |
| 29 | Ga0070674_100006500 | 3300005356 | Bacteria | 6826 |
| 30 | Ga0070674_100626668 | 3300005356 | Bacteria | 912 |
| 31 | Ga0070673_100173654 | 3300005364 | Bacteria | 1841 |
| 32 | Ga0070673_100192265 | 3300005364 | Bacteria | 1753 |
| 33 | Ga0070673_101593826 | 3300005364 | Bacteria | 617 |
| 34 | Ga0070659_101615106 | 3300005366 | Bacteria | 579 |
| 35 | Ga0070667_100001062 | 3300005367 | Bacteria | 25112 |
| 36 | Ga0070667_100005234 | 3300005367 | Bacteria | 10844 |
| 37 | Ga0070667_100173857 | 3300005367 | Bacteria | 1902 |
| 38 | Ga0070667_100343375 | 3300005367 | Bacteria | 1350 |
| 39 | Ga0070667_100651403 | 3300005367 | Bacteria | 972 |
| 40 | Ga0070709_10004644 | 3300005434 | Bacteria | 7415 |
| 41 | Ga0070714_100000073 | 3300005435 | Bacteria | 88847 |
| 42 | Ga0070714_100013475 | 3300005435 | Bacteria | 6553 |
| 43 | Ga0070713_100054871 | 3300005436 | Bacteria | 3308 |
| 44 | Ga0070710_11060481 | 3300005437 | Unclassified | 593 |
| 45 | Ga0070711_100025780 | 3300005439 | Bacteria | 3849 |
| 46 | Ga0070708_100001533 | 3300005445 | Bacteria | 17655 |
| 47 | Ga0070663_100000389 | 3300005455 | Bacteria | 23115 |
| 48 | Ga0070663_100027054 | 3300005455 | Bacteria | 3890 |
| 49 | Ga0070663_100074462 | 3300005455 | Bacteria | 2479 |
| 50 | Ga0070663_100086472 | 3300005455 | Bacteria | 2315 |
| 51 | Ga0070678_100052300 | 3300005456 | Bacteria | 2965 |
| 52 | Ga0070662_100029177 | 3300005457 | Bacteria | 3849 |
| 53 | Ga0070662_100036609 | 3300005457 | Bacteria | 3472 |
| 54 | Ga0070681_10692501 | 3300005458 | Bacteria | 935 |
| 55 | Ga0068867_100003306 | 3300005459 | Bacteria | 11358 |
| 56 | Ga0068867_100017466 | 3300005459 | Bacteria | 5096 |
| 57 | Ga0070706_100000058 | 3300005467 | Bacteria | 133347 |
| 58 | Ga0070707_100043874 | 3300005468 | Bacteria | 4280 |
| 59 | Ga0070698_100337860 | 3300005471 | Bacteria | 1438 |
| 60 | Ga0070699_100017797 | 3300005518 | Bacteria | 6102 |
| 61 | Ga0070699_100530040 | 3300005518 | Bacteria | 1071 |
| 62 | Ga0070684_101077929 | 3300005535 | Unclassified | 755 |
| 63 | Ga0070697_100001145 | 3300005536 | Bacteria | 20085 |
| 64 | Ga0070697_101209934 | 3300005536 | Bacteria | 673 |
| 65 | Ga0068853_100004116 | 3300005539 | Bacteria | 11211 |
| 66 | Ga0068853_100195713 | 3300005539 | Bacteria | 1838 |
| 67 | Ga0068853_101635909 | 3300005539 | Bacteria | 624 |
| 68 | Ga0068853_102475103 | 3300005539 | Bacteria | 503 |
| 69 | Ga0070672_100560687 | 3300005543 | Bacteria | 992 |
| 70 | Ga0070693_100256634 | 3300005547 | Bacteria | 1161 |
| 71 | Ga0070693_100262915 | 3300005547 | Bacteria | 1148 |
| 72 | Ga0070665_100000100 | 3300005548 | Bacteria | 160186 |
| 73 | Ga0070665_100052574 | 3300005548 | Bacteria | 4085 |
| 74 | Ga0070665_100076196 | 3300005548 | Bacteria | 3361 |
| 75 | Ga0068855_100426686 | 3300005563 | Bacteria | 1449 |
| 76 | Ga0070664_100656920 | 3300005564 | Bacteria | 975 |
| 77 | Ga0068857_100548740 | 3300005577 | Bacteria | 1089 |
| 78 | Ga0068854_100169116 | 3300005578 | Bacteria | 1699 |
| 79 | Ga0068854_100376644 | 3300005578 | Bacteria | 1168 |
| 80 | Ga0068854_101135256 | 3300005578 | Bacteria | 698 |
| 81 | Ga0068854_101391879 | 3300005578 | Bacteria | 634 |
| 82 | Ga0068856_100102161 | 3300005614 | Bacteria | 2860 |
| 83 | Ga0068856_100246415 | 3300005614 | Bacteria | 1802 |
| 84 | Ga0068856_101121933 | 3300005614 | Bacteria | 803 |
| 85 | Ga0068852_100013930 | 3300005616 | Bacteria | 6167 |
| 86 | Ga0068852_100136246 | 3300005616 | Bacteria | 2267 |
| 87 | Ga0068852_100372203 | 3300005616 | Bacteria | 1400 |
| 88 | Ga0068859_100001272 | 3300005617 | Bacteria | 25788 |
| 89 | Ga0068859_100015903 | 3300005617 | Bacteria | 7562 |
| 90 | Ga0068864_100059009 | 3300005618 | Bacteria | 3318 |
| 91 | Ga0068864_100231337 | 3300005618 | Bacteria | 1709 |
| 92 | Ga0068864_101066575 | 3300005618 | Bacteria | 803 |
| 93 | Ga0068861_100097778 | 3300005719 | Bacteria | 2329 |
| 94 | Ga0068851_10053881 | 3300005834 | Bacteria | 2048 |
| 95 | Ga0068851_10086384 | 3300005834 | Bacteria | 1646 |
| 96 | Ga0068870_10410425 | 3300005840 | Bacteria | 883 |
| 97 | Ga0068863_100129228 | 3300005841 | Bacteria | 2411 |
| 98 | Ga0068863_102020141 | 3300005841 | Bacteria | 586 |
| 99 | Ga0068858_100010674 | 3300005842 | Bacteria | 8689 |
| 100 | Ga0068860_100135206 | 3300005843 | Bacteria | 2367 |
| 101 | Ga0068860_100559956 | 3300005843 | Bacteria | 1146 |
| 102 | Ga0068860_100801035 | 3300005843 | Bacteria | 955 |
| 103 | Ga0068860_100937325 | 3300005843 | Bacteria | 883 |
| 104 | Ga0068862_100005379 | 3300005844 | Bacteria | 10713 |
| 105 | Ga0068862_100013778 | 3300005844 | Bacteria | 6701 |
| 106 | Ga0068862_100056017 | 3300005844 | Bacteria | 3377 |
| 107 | Ga0068862_100157790 | 3300005844 | Bacteria | 2024 |
| 108 | Ga0068862_100967592 | 3300005844 | Bacteria | 840 |
| 109 | Ga0081540_1014464 | 3300005983 | Bacteria | 5053 |
| 110 | Ga0070717_10028532 | 3300006028 | Bacteria | 4468 |
| 111 | Ga0070717_10549398 | 3300006028 | Bacteria | 1046 |
| 112 | Ga0097621_100078685 | 3300006237 | Bacteria | 2740 |
| 113 | Ga0097621_100569974 | 3300006237 | Bacteria | 1032 |
| 114 | Ga0097621_100832440 | 3300006237 | Bacteria | 856 |
| 115 | Ga0068871_100262909 | 3300006358 | Bacteria | 1506 |
| 116 | Ga0068871_100716355 | 3300006358 | Bacteria | 918 |
| 117 | Ga0075428_101249557 | 3300006844 | Bacteria | 782 |
| 118 | Ga0075429_100059181 | 3300006880 | Bacteria | 3337 |
| 119 | Ga0075429_101461859 | 3300006880 | Bacteria | 595 |
| 120 | Ga0075429_101910930 | 3300006880 | Bacteria | 514 |
| 121 | Ga0068865_100032603 | 3300006881 | Bacteria | 3481 |
| 122 | Ga0068865_100089104 | 3300006881 | Unclassified | 2234 |
| 123 | Ga0068865_100222447 | 3300006881 | Bacteria | 1476 |
| 124 | Ga0075436_100066705 | 3300006914 | Bacteria | 2488 |
| 125 | Ga0097620_100001272 | 3300006931 | Bacteria | 25788 |
| 126 | Ga0097620_100015903 | 3300006931 | Bacteria | 7562 |
| 127 | Ga0075435_100143968 | 3300007076 | Bacteria | 2001 |
| 128 | Ga0105240_10485930 | 3300009093 | Bacteria | 1376 |
| 129 | Ga0105240_11054212 | 3300009093 | Bacteria | 867 |
| 130 | Ga0105240_11606798 | 3300009093 | Unclassified | 680 |
| 131 | Ga0105245_11055971 | 3300009098 | Bacteria | 858 |
| 132 | Ga0105247_10084613 | 3300009101 | Bacteria | 2004 |
| 133 | Ga0105241_10874044 | 3300009174 | Bacteria | 833 |
| 134 | Ga0105241_11086475 | 3300009174 | Bacteria | 753 |
| 135 | Ga0105242_10668701 | 3300009176 | Bacteria | 1012 |
| 136 | Ga0105242_12951934 | 3300009176 | Bacteria | 526 |
| 137 | Ga0105248_10005464 | 3300009177 | Bacteria | 13962 |
| 138 | Ga0105248_10043012 | 3300009177 | Bacteria | 5065 |
| 139 | Ga0105248_10226740 | 3300009177 | Bacteria | 2103 |
| 140 | Ga0105248_11871663 | 3300009177 | Bacteria | 681 |
| 141 | Ga0105237_10005712 | 3300009545 | Bacteria | 13991 |
| 142 | Ga0105237_10335188 | 3300009545 | Bacteria | 1517 |
| 143 | Ga0105237_10395050 | 3300009545 | Bacteria | 1387 |
| 144 | Ga0105237_12391829 | 3300009545 | Bacteria | 538 |
| 145 | Ga0105238_10280086 | 3300009551 | Bacteria | 1649 |
| 146 | Ga0105238_11785563 | 3300009551 | Bacteria | 647 |
| 147 | Ga0105238_12002177 | 3300009551 | Bacteria | 613 |
| 148 | Ga0105238_12816439 | 3300009551 | Bacteria | 523 |
| 149 | Ga0105249_10000803 | 3300009553 | Bacteria | 28251 |
| 150 | Ga0105249_10021446 | 3300009553 | Bacteria | 5783 |
| 151 | Ga0105249_10093401 | 3300009553 | Bacteria | 2818 |
| 152 | Ga0105249_10903928 | 3300009553 | Bacteria | 950 |
| 153 | Ga0105147_103763 | 3300009982 | Bacteria | 1272 |
| 154 | Ga0105239_10000033 | 3300010375 | Bacteria | 223933 |
| 155 | Ga0105239_10077609 | 3300010375 | Bacteria | 3655 |
| 156 | Ga0105239_10117858 | 3300010375 | Bacteria | 2947 |
| 157 | Ga0105239_10172090 | 3300010375 | Bacteria | 2422 |
| 158 | Ga0105239_10469927 | 3300010375 | Unclassified | 1428 |
| 159 | Ga0105239_12140403 | 3300010375 | Bacteria | 650 |
| 160 | Ga0105246_10635144 | 3300011119 | Bacteria | 927 |
| 161 | Ga0157373_10791042 | 3300013100 | Bacteria | 699 |
| 162 | Ga0157371_10198496 | 3300013102 | Bacteria | 1438 |
| 163 | Ga0157371_10325502 | 3300013102 | Bacteria | 1116 |
| 164 | Ga0157371_11125012 | 3300013102 | Bacteria | 603 |
| 165 | Ga0157370_11573633 | 3300013104 | Bacteria | 591 |
| 166 | Ga0157369_10599383 | 3300013105 | Bacteria | 1137 |
| 167 | Ga0157374_10344405 | 3300013296 | Bacteria | 1480 |
| 168 | Ga0157374_10350999 | 3300013296 | Bacteria | 1466 |
| 169 | Ga0157378_10302918 | 3300013297 | Bacteria | 1547 |
| 170 | Ga0163162_10000716 | 3300013306 | Bacteria | 30803 |
| 171 | Ga0163162_10323223 | 3300013306 | Bacteria | 1675 |
| 172 | Ga0157372_10029438 | 3300013307 | Bacteria | 5996 |
| 173 | Ga0157372_10054298 | 3300013307 | Bacteria | 4468 |
| 174 | Ga0157372_10434263 | 3300013307 | Bacteria | 1530 |
| 175 | Ga0157375_10160997 | 3300013308 | Bacteria | 2386 |
| 176 | Ga0157375_10317538 | 3300013308 | Bacteria | 1722 |
| 177 | Ga0157375_10968507 | 3300013308 | Bacteria | 992 |
| 178 | Ga0163163_10147637 | 3300014325 | Bacteria | 2396 |
| 179 | Ga0163163_10215573 | 3300014325 | Bacteria | 1968 |
| 180 | Ga0157380_12340575 | 3300014326 | Bacteria | 599 |
| 181 | Ga0157379_11069203 | 3300014968 | Bacteria | 772 |
| 182 | Ga0157376_10034293 | 3300014969 | Bacteria | 4097 |
| 183 | Ga0157376_11067586 | 3300014969 | Bacteria | 832 |
| 184 | Ga0213871_10010854 | 3300021441 | Bacteria | 2077 |
| 185 | Ga0228598_1007421 | 3300024227 | Bacteria | 2233 |
| 186 | Ga0209758_1000239 | 3300025297 | Bacteria | 114761 |
| 187 | Ga0209758_1019994 | 3300025297 | Bacteria | 3194 |
| 188 | Ga0209050_1012953 | 3300025298 | Bacteria | 3767 |
| 189 | Ga0209257_1001119 | 3300025304 | Bacteria | 34613 |
| 190 | Ga0207656_10082737 | 3300025321 | Bacteria | 1445 |
| 191 | Ga0207656_10735679 | 3300025321 | Unclassified | 505 |
| 192 | Ga0207682_10248914 | 3300025893 | Bacteria | 827 |
| 193 | Ga0207682_10360128 | 3300025893 | Bacteria | 686 |
| 194 | Ga0207680_10615059 | 3300025903 | Bacteria | 777 |
| 195 | Ga0207647_10006826 | 3300025904 | Bacteria | 8274 |
| 196 | Ga0207647_10012642 | 3300025904 | Bacteria | 5867 |
| 197 | Ga0207699_11341596 | 3300025906 | Bacteria | 529 |
| 198 | Ga0207645_10013081 | 3300025907 | Bacteria | 5606 |
| 199 | Ga0207645_10079916 | 3300025907 | Bacteria | 2096 |
| 200 | Ga0207643_10183450 | 3300025908 | Bacteria | 1267 |
| 201 | Ga0207705_10196778 | 3300025909 | Bacteria | 1526 |
| 202 | Ga0207684_10000066 | 3300025910 | Bacteria | 193406 |
| 203 | Ga0207707_10257289 | 3300025912 | Bacteria | 1516 |
| 204 | Ga0207695_10000322 | 3300025913 | Bacteria | 114700 |
| 205 | Ga0207695_10003273 | 3300025913 | Bacteria | 23026 |
| 206 | Ga0207695_10024662 | 3300025913 | Bacteria | 6755 |
| 207 | Ga0207695_10221507 | 3300025913 | Bacteria | 1799 |
| 208 | Ga0207695_10750031 | 3300025913 | Bacteria | 856 |
| 209 | Ga0207671_10006234 | 3300025914 | Bacteria | 10687 |
| 210 | Ga0207671_10503913 | 3300025914 | Bacteria | 965 |
| 211 | Ga0207693_10076182 | 3300025915 | Bacteria | 2627 |
| 212 | Ga0207663_10113142 | 3300025916 | Unclassified | 1845 |
| 213 | Ga0207649_10277425 | 3300025920 | Bacteria | 1217 |
| 214 | Ga0207649_10906477 | 3300025920 | Bacteria | 691 |
| 215 | Ga0207649_11052275 | 3300025920 | Bacteria | 641 |
| 216 | Ga0207646_10040894 | 3300025922 | Bacteria | 4168 |
| 217 | Ga0207681_10003285 | 3300025923 | Bacteria | 10122 |
| 218 | Ga0207681_10006303 | 3300025923 | Bacteria | 7281 |
| 219 | Ga0207694_10593962 | 3300025924 | Bacteria | 931 |
| 220 | Ga0207650_10159869 | 3300025925 | Bacteria | 1784 |
| 221 | Ga0207650_10502008 | 3300025925 | Bacteria | 1014 |
| 222 | Ga0207650_10657467 | 3300025925 | Bacteria | 884 |
| 223 | Ga0207700_10805783 | 3300025928 | Bacteria | 840 |
| 224 | Ga0207700_10823655 | 3300025928 | Bacteria | 830 |
| 225 | Ga0207664_10000041 | 3300025929 | Bacteria | 154806 |
| 226 | Ga0207664_10010563 | 3300025929 | Bacteria | 6522 |
| 227 | Ga0207644_10067208 | 3300025931 | Bacteria | 2612 |
| 228 | Ga0207690_10000124 | 3300025932 | Bacteria | 63516 |
| 229 | Ga0207690_11030805 | 3300025932 | Bacteria | 685 |
| 230 | Ga0207706_10013686 | 3300025933 | Bacteria | 7363 |
| 231 | Ga0207706_10025799 | 3300025933 | Bacteria | 5264 |
| 232 | Ga0207706_10158551 | 3300025933 | Bacteria | 1990 |
| 233 | Ga0207686_10841113 | 3300025934 | Bacteria | 738 |
| 234 | Ga0207686_11013429 | 3300025934 | Bacteria | 674 |
| 235 | Ga0207669_10281979 | 3300025937 | Bacteria | 1253 |
| 236 | Ga0207669_10340976 | 3300025937 | Bacteria | 1154 |
| 237 | Ga0207669_10357641 | 3300025937 | Bacteria | 1130 |
| 238 | Ga0207704_10047183 | 3300025938 | Unclassified | 2573 |
| 239 | Ga0207704_10154993 | 3300025938 | Bacteria | 1622 |
| 240 | Ga0207704_10518912 | 3300025938 | Bacteria | 963 |
| 241 | Ga0207704_10709506 | 3300025938 | Bacteria | 833 |
| 242 | Ga0207665_10009764 | 3300025939 | Bacteria | 6301 |
| 243 | Ga0207665_10151107 | 3300025939 | Bacteria | 1663 |
| 244 | Ga0207691_10074226 | 3300025940 | Bacteria | 3068 |
| 245 | Ga0207691_10234229 | 3300025940 | Bacteria | 1589 |
| 246 | Ga0207711_10000539 | 3300025941 | Bacteria | 38710 |
| 247 | Ga0207711_10356691 | 3300025941 | Bacteria | 1354 |
| 248 | Ga0207711_10477453 | 3300025941 | Bacteria | 1161 |
| 249 | Ga0207689_10002311 | 3300025942 | Bacteria | 17851 |
| 250 | Ga0207689_10234532 | 3300025942 | Bacteria | 1517 |
| 251 | Ga0207689_10267644 | 3300025942 | Bacteria | 1415 |
| 252 | Ga0207679_10176541 | 3300025945 | Bacteria | 1764 |
| 253 | Ga0207679_11075694 | 3300025945 | Bacteria | 738 |
| 254 | Ga0207667_10401151 | 3300025949 | Bacteria | 1396 |
| 255 | Ga0207651_10153349 | 3300025960 | Bacteria | 1796 |
| 256 | Ga0207651_10651854 | 3300025960 | Bacteria | 924 |
| 257 | Ga0207712_10013427 | 3300025961 | Bacteria | 5250 |
| 258 | Ga0207712_10243634 | 3300025961 | Bacteria | 1449 |
| 259 | Ga0207712_10844905 | 3300025961 | Bacteria | 807 |
| 260 | Ga0207712_11366680 | 3300025961 | Bacteria | 633 |
| 261 | Ga0207668_10006717 | 3300025972 | Bacteria | 6805 |
| 262 | Ga0207668_10299007 | 3300025972 | Bacteria | 1327 |
| 263 | Ga0207640_10339529 | 3300025981 | Bacteria | 1203 |
| 264 | Ga0207640_10506574 | 3300025981 | Bacteria | 1006 |
| 265 | Ga0207640_11125254 | 3300025981 | Bacteria | 695 |
| 266 | Ga0207658_10000626 | 3300025986 | Bacteria | 31259 |
| 267 | Ga0207658_10002618 | 3300025986 | Bacteria | 13068 |
| 268 | Ga0207658_10044897 | 3300025986 | Bacteria | 3218 |
| 269 | Ga0207658_10186291 | 3300025986 | Bacteria | 1722 |
| 270 | Ga0207658_10582874 | 3300025986 | Bacteria | 1003 |
| 271 | Ga0207658_11746866 | 3300025986 | Bacteria | 568 |
| 272 | Ga0207677_10042234 | 3300026023 | Bacteria | 3022 |
| 273 | Ga0207677_10093726 | 3300026023 | Bacteria | 2190 |
| 274 | Ga0207677_12117209 | 3300026023 | Bacteria | 523 |
| 275 | Ga0207703_10226616 | 3300026035 | Bacteria | 1673 |
| 276 | Ga0207703_10936770 | 3300026035 | Bacteria | 830 |
| 277 | Ga0207703_11276670 | 3300026035 | Bacteria | 706 |
| 278 | Ga0207703_11378481 | 3300026035 | Bacteria | 678 |
| 279 | Ga0207639_10033535 | 3300026041 | Bacteria | 3788 |
| 280 | Ga0207639_10830032 | 3300026041 | Bacteria | 862 |
| 281 | Ga0207639_11011426 | 3300026041 | Bacteria | 779 |
| 282 | Ga0207678_10001238 | 3300026067 | Bacteria | 23529 |
| 283 | Ga0207678_10012496 | 3300026067 | Bacteria | 7456 |
| 284 | Ga0207678_10029809 | 3300026067 | Bacteria | 4764 |
| 285 | Ga0207641_10204328 | 3300026088 | Bacteria | 1823 |
| 286 | Ga0207641_10356724 | 3300026088 | Bacteria | 1395 |
| 287 | Ga0207641_11339686 | 3300026088 | Bacteria | 716 |
| 288 | Ga0207648_10006184 | 3300026089 | Bacteria | 11924 |
| 289 | Ga0207648_10015990 | 3300026089 | Bacteria | 6876 |
| 290 | Ga0207648_10225319 | 3300026089 | Bacteria | 1667 |
| 291 | Ga0207676_10075142 | 3300026095 | Bacteria | 2725 |
| 292 | Ga0207676_10110297 | 3300026095 | Bacteria | 2301 |
| 293 | Ga0207676_11972693 | 3300026095 | Bacteria | 582 |
| 294 | Ga0207674_10068204 | 3300026116 | Bacteria | 3580 |
| 295 | Ga0207675_100035871 | 3300026118 | Bacteria | 4626 |
| 296 | Ga0207675_100408609 | 3300026118 | Bacteria | 1339 |
| 297 | Ga0207683_10014586 | 3300026121 | Bacteria | 6692 |
| 298 | Ga0207698_10142480 | 3300026142 | Bacteria | 2067 |
| 299 | Ga0207698_11460006 | 3300026142 | Unclassified | 699 |
| 300 | Ga0268266_10000017 | 3300028379 | Bacteria | 607272 |
| 301 | Ga0268266_10107210 | 3300028379 | Bacteria | 2470 |
| 302 | Ga0268266_10206265 | 3300028379 | Bacteria | 1801 |
| 303 | Ga0268266_10211662 | 3300028379 | Bacteria | 1778 |
| 304 | Ga0268265_10001627 | 3300028380 | Bacteria | 18490 |
| 305 | Ga0268265_10146403 | 3300028380 | Bacteria | 1985 |
| 306 | Ga0268265_10273007 | 3300028380 | Bacteria | 1509 |
| 307 | Ga0268265_10309638 | 3300028380 | Bacteria | 1425 |
| 308 | Ga0268264_10427239 | 3300028381 | Bacteria | 1279 |
| 309 | Ga0268264_10855046 | 3300028381 | Bacteria | 911 |
| 310 | Ga0268264_12106361 | 3300028381 | Bacteria | 573 |
| 311 | Ga0307513_10122955 | 3300031456 | Bacteria | 2558 |
| 312 | Ga0307513_10498034 | 3300031456 | Bacteria | 936 |
| 313 | Ga0307508_10053263 | 3300031616 | Bacteria | 3592 |
| 314 | Ga0307412_10653250 | 3300031911 | Bacteria | 897 |
| 315 | Ga0307510_10576638 | 3300033180 | Bacteria | 574 |
| 316 | Ga0395899_0017037 | 3300037312 | Bacteria | 5536 |
| 317 | Ga0436365_0438639 | 3300039437 | Bacteria | 5320 |
| 318 | Ga0436360_0102030 | 3300039438 | Bacteria | 9249 |
| 319 | Ga0436360_0609938 | 3300039438 | Bacteria | 1695 |
| 320 | Ga0436361_0995122 | 3300039447 | Bacteria | 609 |
| 321 | Ga0436363_0166237 | 3300039450 | Bacteria | 1830 |
| 322 | Ga0436363_1473180 | 3300039450 | Unclassified | 591 |
| 323 | Ga0451795_1615648 | 3300041456 | Bacteria | 532 |
| 324 | Ga0451804_1152559 | 3300041463 | Bacteria | 516 |
| 325 | Ga0451841_1356420 | 3300041498 | Bacteria | 1260 |
| 326 | Ga0451849_0988518 | 3300041505 | Bacteria | 593 |
| 327 | Ga0439437_017097 | 3300042000 | Bacteria | 860 |
| 328 | Ga0439432_206180 | 3300042006 | Bacteria | 569 |
| 329 | Ga0439460_0027389 | 3300042461 | Unclassified | 1601 |
| 330 | Ga0466982_0000011 | 3300044672 | Bacteria | 175513 |
| 331 | Ga0466965_0056345 | 3300044683 | Bacteria | 1957 |
| 332 | Ga0466966_0003916 | 3300044684 | Bacteria | 9830 |
| 333 | Ga0466963_0927802 | 3300044694 | Bacteria | 613 |
| 334 | Ga0495650_0000134 | 3300046471 | Bacteria | 173331 |
| 335 | Ga0495632_0293735 | 3300046519 | Bacteria | 722 |
| 336 | Ga0495598_0039599 | 3300046537 | Bacteria | 1371 |
| 337 | Ga0495621_0008227 | 3300046539 | Bacteria | 3119 |
| 338 | Ga0495621_0286621 | 3300046539 | Bacteria | 680 |
| 339 | Ga0495625_0009321 | 3300046660 | Bacteria | 8226 |
| 340 | Ga0495649_0000573 | 3300046694 | Bacteria | 31036 |
| 341 | Ga0495686_0006212 | 3300047472 | Bacteria | 9211 |
| 342 | Ga0496100_0339560 | 3300048903 | Bacteria | 1132 |
| 343 | Ga0496100_0453346 | 3300048903 | Bacteria | 983 |
| 344 | Ga0496101_0014930 | 3300048904 | Bacteria | 5226 |
| 345 | Ga0496101_0530091 | 3300048904 | Bacteria | 931 |
| 346 | Ga0496102_0166195 | 3300048905 | Bacteria | 2076 |
| 347 | Ga0496103_0037210 | 3300048906 | Bacteria | 2981 |
| 348 | Ga0496103_0209272 | 3300048906 | Bacteria | 1254 |
| 349 | Ga0496104_0017876 | 3300048907 | Bacteria | 6465 |
| 350 | Ga0496104_0033922 | 3300048907 | Bacteria | 4758 |
| 351 | Ga0496104_0672802 | 3300048907 | Bacteria | 943 |
| 352 | Ga0496105_0044783 | 3300048908 | Bacteria | 3650 |
| 353 | Ga0496106_0792507 | 3300048909 | Bacteria | 752 |
| 354 | Ga0496115_0003509 | 3300048918 | Bacteria | 11266 |
| 355 | Ga0496115_0023942 | 3300048918 | Bacteria | 4742 |
| 356 | Ga0496115_0153987 | 3300048918 | Bacteria | 1899 |
| 357 | Ga0496116_0142325 | 3300048919 | Bacteria | 1347 |
| 358 | Ga0496117_0048897 | 3300048920 | Bacteria | 3014 |
| 359 | Ga0496117_0072463 | 3300048920 | Bacteria | 2302 |
| 360 | Ga0496118_0008500 | 3300048921 | Bacteria | 10597 |
| 361 | Ga0496118_0011773 | 3300048921 | Bacteria | 8499 |
| 362 | Ga0496118_0016719 | 3300048921 | Bacteria | 6713 |
| 363 | Ga0496119_0000776 | 3300048922 | Bacteria | 42684 |
| 364 | Ga0496120_0000874 | 3300048923 | Bacteria | 42572 |
| 365 | Ga0496121_0160198 | 3300048924 | Bacteria | 1646 |
| 366 | Ga0496122_0007208 | 3300048925 | Bacteria | 12447 |
| 367 | Ga0496123_0002900 | 3300048926 | Bacteria | 20063 |
| 368 | Ga0496125_0107607 | 3300048928 | Bacteria | 2031 |
| 369 | Ga0496126_0005390 | 3300048929 | Bacteria | 14603 |
| 370 | Ga0496126_0191029 | 3300048929 | Bacteria | 1734 |
| 371 | Ga0496126_0708902 | 3300048929 | Bacteria | 781 |
| 372 | Ga0501031_0087683 | 3300049568 | Bacteria | 2029 |
| 373 | Ga0501031_0089563 | 3300049568 | Bacteria | 2006 |
| 374 | Ga0501032_0016690 | 3300049569 | Bacteria | 5160 |
| 375 | Ga0501032_0063172 | 3300049569 | Bacteria | 2479 |
| 376 | Ga0501032_0075525 | 3300049569 | Bacteria | 2244 |
| 377 | Ga0501033_0003691 | 3300049570 | Bacteria | 12448 |
| 378 | Ga0501033_0021629 | 3300049570 | Bacteria | 4853 |
| 379 | Ga0501033_0323795 | 3300049570 | Bacteria | 1082 |
| 380 | Ga0501034_0019035 | 3300049571 | Bacteria | 7033 |
| 381 | Ga0501034_0474197 | 3300049571 | Bacteria | 1167 |
| 382 | Ga0501034_1132271 | 3300049571 | Bacteria | 663 |
| 383 | Ga0501036_0011209 | 3300049572 | Bacteria | 7416 |
| 384 | Ga0501036_0057702 | 3300049572 | Bacteria | 3288 |
| 385 | Ga0501036_0130130 | 3300049572 | Bacteria | 2125 |
| 386 | Ga0501036_0307928 | 3300049572 | Bacteria | 1325 |
| 387 | Ga0501037_0028837 | 3300049573 | Bacteria | 4101 |
| 388 | Ga0501037_0103873 | 3300049573 | Bacteria | 2049 |
| 389 | Ga0501037_0173902 | 3300049573 | Bacteria | 1530 |
| 390 | Ga0501037_0186038 | 3300049573 | Bacteria | 1472 |
| 391 | Ga0501037_0863824 | 3300049573 | Bacteria | 594 |
| 392 | Ga0501038_0025863 | 3300049574 | Bacteria | 5228 |
| 393 | Ga0501038_0031199 | 3300049574 | Bacteria | 4711 |
| 394 | Ga0501038_0387838 | 3300049574 | Bacteria | 1082 |
| 395 | Ga0501039_0013281 | 3300049575 | Bacteria | 6297 |
| 396 | Ga0501039_0187938 | 3300049575 | Bacteria | 1624 |
| 397 | Ga0501039_1235737 | 3300049575 | Unclassified | 577 |
| 398 | Ga0501040_0435785 | 3300049576 | Bacteria | 943 |
| 399 | Ga0501041_0121156 | 3300049577 | Bacteria | 1626 |
| 400 | Ga0501042_0424316 | 3300049578 | Bacteria | 964 |
| 401 | Ga0501043_0027454 | 3300049579 | Bacteria | 4469 |
| 402 | Ga0501043_0138802 | 3300049579 | Bacteria | 1904 |
| 403 | Ga0501043_0296442 | 3300049579 | Bacteria | 1237 |
| 404 | Ga0501043_0442242 | 3300049579 | Bacteria | 978 |
| 405 | Ga0501043_0507231 | 3300049579 | Bacteria | 900 |
| 406 | Ga0501046_0007041 | 3300049580 | Bacteria | 9906 |
| 407 | Ga0501046_0091702 | 3300049580 | Bacteria | 2336 |
| 408 | Ga0501047_0071111 | 3300049581 | Bacteria | 3349 |
| 409 | Ga0501047_0157450 | 3300049581 | Bacteria | 2144 |
| 410 | Ga0501047_0169697 | 3300049581 | Bacteria | 2051 |
| 411 | Ga0501047_0194816 | 3300049581 | Bacteria | 1889 |
| 412 | Ga0501047_0502958 | 3300049581 | Bacteria | 1038 |
| 413 | Ga0501047_0742521 | 3300049581 | Bacteria | 798 |
| 414 | Ga0501047_0755200 | 3300049581 | Bacteria | 788 |
| 415 | Ga0501048_0208506 | 3300049582 | Bacteria | 1386 |
| 416 | Ga0501048_0224279 | 3300049582 | Bacteria | 1333 |
| 417 | Ga0501048_0387841 | 3300049582 | Bacteria | 998 |
| 418 | Ga0501067_0052713 | 3300049583 | Bacteria | 2254 |
| 419 | Ga0501067_0060768 | 3300049583 | Bacteria | 2091 |
| 420 | Ga0501068_0071918 | 3300049584 | Bacteria | 2111 |
| 421 | Ga0501068_0225676 | 3300049584 | Bacteria | 1191 |
| 422 | Ga0501069_0028683 | 3300049585 | Bacteria | 3052 |
| 423 | Ga0501069_0203422 | 3300049585 | Bacteria | 1148 |
| 424 | Ga0501070_0063367 | 3300049586 | Bacteria | 3062 |
| 425 | Ga0501070_0229878 | 3300049586 | Bacteria | 1520 |
| 426 | Ga0501070_0411009 | 3300049586 | Bacteria | 1093 |
| 427 | Ga0501070_0456505 | 3300049586 | Bacteria | 1030 |
| 428 | Ga0501070_0555003 | 3300049586 | Bacteria | 919 |
| 429 | Ga0501070_1202637 | 3300049586 | Bacteria | 581 |
| 430 | Ga0501071_0113753 | 3300049587 | Bacteria | 2001 |
| 431 | Ga0501071_0246756 | 3300049587 | Unclassified | 1347 |
| 432 | Ga0501071_0565868 | 3300049587 | Bacteria | 873 |
| 433 | Ga0501071_1395877 | 3300049587 | Bacteria | 541 |
| 434 | Ga0501072_0018149 | 3300049588 | Bacteria | 5412 |
| 435 | Ga0501072_0447122 | 3300049588 | Bacteria | 1024 |
| 436 | Ga0501072_0507028 | 3300049588 | Bacteria | 954 |
| 437 | Ga0501073_0034081 | 3300049589 | Bacteria | 3624 |
| 438 | Ga0501073_0096935 | 3300049589 | Bacteria | 2048 |
| 439 | Ga0501073_0167916 | 3300049589 | Bacteria | 1519 |
| 440 | Ga0501073_0222024 | 3300049589 | Bacteria | 1305 |
| 441 | Ga0501073_0236729 | 3300049589 | Bacteria | 1261 |
| 442 | Ga0501074_0007753 | 3300049590 | Bacteria | 7773 |
| 443 | Ga0501074_0015472 | 3300049590 | Bacteria | 5544 |
| 444 | Ga0501074_0374967 | 3300049590 | Bacteria | 1009 |
| 445 | Ga0501075_0015011 | 3300049591 | Bacteria | 5557 |
| 446 | Ga0501076_0018645 | 3300049592 | Bacteria | 5295 |
| 447 | Ga0501076_0228232 | 3300049592 | Bacteria | 1522 |
| 448 | Ga0501077_0008086 | 3300049593 | Bacteria | 6501 |
| 449 | Ga0501077_0764171 | 3300049593 | Bacteria | 621 |
| 450 | Ga0501079_0070790 | 3300049741 | Bacteria | 2693 |
| 451 | Ga0501079_0373890 | 3300049741 | Bacteria | 1117 |
| 452 | Ga0501079_0736142 | 3300049741 | Bacteria | 776 |
| 453 | Ga0501080_0014008 | 3300049742 | Bacteria | 7381 |
| 454 | Ga0501080_0101040 | 3300049742 | Bacteria | 2675 |
| 455 | Ga0501080_0483150 | 3300049742 | Bacteria | 1108 |
| 456 | Ga0501080_0593891 | 3300049742 | Bacteria | 983 |
| 457 | Ga0501080_0654275 | 3300049742 | Bacteria | 929 |
| 458 | Ga0501080_0824171 | 3300049742 | Bacteria | 812 |
| 459 | Ga0501080_0954959 | 3300049742 | Bacteria | 745 |
| 460 | Ga0501081_0019909 | 3300049743 | Bacteria | 4470 |
| 461 | Ga0501083_0041496 | 3300049744 | Bacteria | 3120 |
| 462 | Ga0501083_0134146 | 3300049744 | Bacteria | 1623 |
| 463 | Ga0501035_0000967 | 3300049822 | Bacteria | 30354 |
| 464 | Ga0501035_0029308 | 3300049822 | Bacteria | 5019 |
| 465 | Ga0501035_0072397 | 3300049822 | Bacteria | 3050 |
| 466 | Ga0501035_0315065 | 3300049822 | Bacteria | 1315 |
| 467 | Ga0501035_0368998 | 3300049822 | Bacteria | 1198 |
| 468 | Ga0501044_0016858 | 3300049823 | Bacteria | 7837 |
| 469 | Ga0501044_0039386 | 3300049823 | Bacteria | 4931 |
| 470 | Ga0501044_0047280 | 3300049823 | Bacteria | 4450 |
| 471 | Ga0501044_0153823 | 3300049823 | Bacteria | 2281 |
| 472 | Ga0501044_0169789 | 3300049823 | Bacteria | 2153 |
| 473 | Ga0501044_0242275 | 3300049823 | Bacteria | 1746 |
| 474 | Ga0501044_0449742 | 3300049823 | Bacteria | 1195 |
| 475 | Ga0501044_0640726 | 3300049823 | Bacteria | 952 |
| 476 | Ga0501044_0803328 | 3300049823 | Bacteria | 820 |
| 477 | Ga0501045_0017582 | 3300049824 | Bacteria | 5077 |
| 478 | Ga0501045_0063864 | 3300049824 | Bacteria | 2702 |
| 479 | Ga0501045_0139254 | 3300049824 | Bacteria | 1804 |
| 480 | nmdc:mga09592_267408_c1 | 3300050508 | Bacteria | 1483 |
| 481 | nmdc:mga0rr50_131718_c1 | 3300050513 | Bacteria | 2003 |
| 482 | nmdc:mga08x19_25132_c1 | 3300050514 | Bacteria | 3709 |
| 483 | Ga0495655_0334615 | 3300053083 | Bacteria | 527 |
| 484 | Ga0500644_0118355 | 3300053088 | Bacteria | 1029 |
| 485 | Ga0500646_0007308 | 3300053090 | Bacteria | 2822 |
| 486 | Ga0500651_0772833 | 3300053093 | Bacteria | 509 |
| 487 | Ga0500594_0059405 | 3300053118 | Bacteria | 1098 |
| 488 | Ga0500597_000799 | 3300053120 | Bacteria | 7167 |
| 489 | Ga0500642_0000378 | 3300053130 | Bacteria | 14992 |
| 490 | Ga0500658_0295296 | 3300053134 | Bacteria | 745 |
| 491 | Ga0500568_0002415 | 3300053139 | Bacteria | 11014 |
| 492 | Ga0500568_0002932 | 3300053139 | Bacteria | 9780 |
| 493 | Ga0500577_0051215 | 3300053142 | Bacteria | 1552 |
| 494 | Ga0500577_0057970 | 3300053142 | Bacteria | 1480 |
| 495 | Ga0500588_0001270 | 3300053146 | Bacteria | 4716 |
| 496 | Ga0501084_0266110 | 3300054114 | Bacteria | 1447 |
| 497 | Ga0501084_0316722 | 3300054114 | Bacteria | 1318 |
| 498 | Ga0501082_0069588 | 3300060353 | Bacteria | 3030 |
| 499 | Ga0501082_0101875 | 3300060353 | Bacteria | 2484 |
| 500 | Ga0501082_0290871 | 3300060353 | Bacteria | 1422 |
| 501 | Ga0530510_0043773 | 3300061734 | Bacteria | 3234 |
| 502 | Ga0530510_0465507 | 3300061734 | Bacteria | 957 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041456 | Ga0451795_1615648 | Ga0451795_1615648_80_433 | 114 |
| 2 | 3300010375 | Ga0105239_12140403 | Ga0105239_121404032 | 115 |
| 3 | 3300025939 | Ga0207665_10151107 | Ga0207665_101511072 | 119 |
| 4 | 3300005328 | Ga0070676_10008008 | Ga0070676_100080084 | 122 |
| 5 | 3300005333 | Ga0070677_10285376 | Ga0070677_102853761 | 122 |
| 6 | 3300005353 | Ga0070669_100015224 | Ga0070669_1000152247 | 122 |
| 7 | 3300005434 | Ga0070709_10004644 | Ga0070709_100046448 | 122 |
| 8 | 3300005435 | Ga0070714_100013475 | Ga0070714_1000134755 | 122 |
| 9 | 3300005436 | Ga0070713_100054871 | Ga0070713_1000548712 | 122 |
| 10 | 3300005439 | Ga0070711_100025780 | Ga0070711_1000257802 | 122 |
| 11 | 3300005459 | Ga0068867_100017466 | Ga0068867_1000174667 | 122 |
| 12 | 3300005467 | Ga0070706_100000058 | Ga0070706_10000005874 | 122 |
| 13 | 3300005468 | Ga0070707_100043874 | Ga0070707_1000438746 | 122 |
| 14 | 3300005471 | Ga0070698_100337860 | Ga0070698_1003378601 | 122 |
| 15 | 3300005518 | Ga0070699_100530040 | Ga0070699_1005300402 | 122 |
| 16 | 3300005536 | Ga0070697_100001145 | Ga0070697_1000011457 | 122 |
| 17 | 3300005547 | Ga0070693_100256634 | Ga0070693_1002566342 | 122 |
| 18 | 3300005578 | Ga0068854_100376644 | Ga0068854_1003766442 | 122 |
| 19 | 3300005614 | Ga0068856_100246415 | Ga0068856_1002464152 | 122 |
| 20 | 3300005618 | Ga0068864_101066575 | Ga0068864_1010665752 | 122 |
| 21 | 3300005840 | Ga0068870_10410425 | Ga0068870_104104252 | 122 |
| 22 | 3300006028 | Ga0070717_10028532 | Ga0070717_100285326 | 122 |
| 23 | 3300006028 | Ga0070717_10549398 | Ga0070717_105493982 | 122 |
| 24 | 3300006844 | Ga0075428_101249557 | Ga0075428_1012495571 | 122 |
| 25 | 3300006880 | Ga0075429_101910930 | Ga0075429_1019109301 | 122 |
| 26 | 3300006881 | Ga0068865_100089104 | Ga0068865_1000891043 | 122 |
| 27 | 3300006914 | Ga0075436_100066705 | Ga0075436_1000667052 | 122 |
| 28 | 3300007076 | Ga0075435_100143968 | Ga0075435_1001439682 | 122 |
| 29 | 3300010375 | Ga0105239_10469927 | Ga0105239_104699273 | 122 |
| 30 | 3300011119 | Ga0105246_10635144 | Ga0105246_106351442 | 122 |
| 31 | 3300021441 | Ga0213871_10010854 | Ga0213871_100108542 | 122 |
| 32 | 3300025893 | Ga0207682_10360128 | Ga0207682_103601281 | 122 |
| 33 | 3300025904 | Ga0207647_10012642 | Ga0207647_100126422 | 122 |
| 34 | 3300025906 | Ga0207699_11341596 | Ga0207699_113415961 | 122 |
| 35 | 3300025907 | Ga0207645_10013081 | Ga0207645_100130816 | 122 |
| 36 | 3300025908 | Ga0207643_10183450 | Ga0207643_101834502 | 122 |
| 37 | 3300025910 | Ga0207684_10000066 | Ga0207684_1000006648 | 122 |
| 38 | 3300025915 | Ga0207693_10076182 | Ga0207693_100761822 | 122 |
| 39 | 3300025916 | Ga0207663_10113142 | Ga0207663_101131422 | 122 |
| 40 | 3300025922 | Ga0207646_10040894 | Ga0207646_100408943 | 122 |
| 41 | 3300025923 | Ga0207681_10006303 | Ga0207681_100063035 | 122 |
| 42 | 3300025928 | Ga0207700_10805783 | Ga0207700_108057832 | 122 |
| 43 | 3300025928 | Ga0207700_10823655 | Ga0207700_108236552 | 122 |
| 44 | 3300025929 | Ga0207664_10010563 | Ga0207664_100105631 | 122 |
| 45 | 3300025937 | Ga0207669_10357641 | Ga0207669_103576412 | 122 |
| 46 | 3300025938 | Ga0207704_10047183 | Ga0207704_100471833 | 122 |
| 47 | 3300025939 | Ga0207665_10009764 | Ga0207665_100097643 | 122 |
| 48 | 3300025940 | Ga0207691_10234229 | Ga0207691_102342292 | 122 |
| 49 | 3300025945 | Ga0207679_10176541 | Ga0207679_101765413 | 122 |
| 50 | 3300025961 | Ga0207712_10243634 | Ga0207712_102436342 | 122 |
| 51 | 3300026023 | Ga0207677_10042234 | Ga0207677_100422341 | 122 |
| 52 | 3300026035 | Ga0207703_10226616 | Ga0207703_102266163 | 122 |
| 53 | 3300026089 | Ga0207648_10015990 | Ga0207648_100159906 | 122 |
| 54 | 3300026118 | Ga0207675_100408609 | Ga0207675_1004086092 | 122 |
| 55 | 3300039438 | Ga0436360_0102030 | Ga0436360_0102030_1834_2214 | 122 |
| 56 | 3300039438 | Ga0436360_0609938 | Ga0436360_0609938_310_690 | 122 |
| 57 | 3300039450 | Ga0436363_0166237 | Ga0436363_0166237_1030_1410 | 122 |
| 58 | 3300042461 | Ga0439460_0027389 | Ga0439460_0027389_701_1102 | 122 |
| 59 | 3300044694 | Ga0466963_0927802 | Ga0466963_0927802_126_506 | 122 |
| 60 | 3300048903 | Ga0496100_0339560 | Ga0496100_0339560_283_663 | 122 |
| 61 | 3300048904 | Ga0496101_0530091 | Ga0496101_0530091_88_468 | 122 |
| 62 | 3300048905 | Ga0496102_0166195 | Ga0496102_0166195_90_470 | 122 |
| 63 | 3300048906 | Ga0496103_0037210 | Ga0496103_0037210_2412_2792 | 122 |
| 64 | 3300048907 | Ga0496104_0017876 | Ga0496104_0017876_5232_5612 | 122 |
| 65 | 3300048909 | Ga0496106_0792507 | Ga0496106_0792507_338_718 | 122 |
| 66 | 3300048921 | Ga0496118_0016719 | Ga0496118_0016719_5017_5397 | 122 |
| 67 | 3300048928 | Ga0496125_0107607 | Ga0496125_0107607_1431_1811 | 122 |
| 68 | 3300050513 | nmdc:mga0rr50_131718_c1 | nmdc:mga0rr50_131718_c1_408_788 | 122 |
| 69 | 3300050514 | nmdc:mga08x19_25132_c1 | nmdc:mga08x19_25132_c1_523_903 | 122 |
| 70 | 3300003215 | JGI25153J46596_10000103 | JGI25153J46596_1000010374 | 123 |
| 71 | 3300003320 | rootH2_10223466 | rootH2_102234663 | 123 |
| 72 | 3300003794 | Ga0055531_10013363 | Ga0055531_100133636 | 123 |
| 73 | 3300005327 | Ga0070658_10104392 | Ga0070658_101043926 | 123 |
| 74 | 3300005327 | Ga0070658_10182910 | Ga0070658_101829102 | 123 |
| 75 | 3300005328 | Ga0070676_10008083 | Ga0070676_100080834 | 123 |
| 76 | 3300005328 | Ga0070676_10087186 | Ga0070676_100871863 | 123 |
| 77 | 3300005330 | Ga0070690_100081744 | Ga0070690_1000817444 | 123 |
| 78 | 3300005331 | Ga0070670_100219880 | Ga0070670_1002198802 | 123 |
| 79 | 3300005334 | Ga0068869_100048141 | Ga0068869_1000481412 | 123 |
| 80 | 3300005334 | Ga0068869_100051553 | Ga0068869_1000515532 | 123 |
| 81 | 3300005334 | Ga0068869_100817651 | Ga0068869_1008176512 | 123 |
| 82 | 3300005334 | Ga0068869_101700964 | Ga0068869_1017009641 | 123 |
| 83 | 3300005335 | Ga0070666_10075812 | Ga0070666_100758122 | 123 |
| 84 | 3300005335 | Ga0070666_10156717 | Ga0070666_101567173 | 123 |
| 85 | 3300005340 | Ga0070689_100141210 | Ga0070689_1001412103 | 123 |
| 86 | 3300005344 | Ga0070661_100173828 | Ga0070661_1001738282 | 123 |
| 87 | 3300005344 | Ga0070661_100240945 | Ga0070661_1002409451 | 123 |
| 88 | 3300005345 | Ga0070692_10153184 | Ga0070692_101531843 | 123 |
| 89 | 3300005347 | Ga0070668_100012560 | Ga0070668_1000125602 | 123 |
| 90 | 3300005347 | Ga0070668_100107357 | Ga0070668_1001073573 | 123 |
| 91 | 3300005353 | Ga0070669_100391347 | Ga0070669_1003913473 | 123 |
| 92 | 3300005355 | Ga0070671_100292831 | Ga0070671_1002928312 | 123 |
| 93 | 3300005355 | Ga0070671_100299690 | Ga0070671_1002996901 | 123 |
| 94 | 3300005356 | Ga0070674_100006500 | Ga0070674_10000650013 | 123 |
| 95 | 3300005356 | Ga0070674_100626668 | Ga0070674_1006266681 | 123 |
| 96 | 3300005364 | Ga0070673_100173654 | Ga0070673_1001736543 | 123 |
| 97 | 3300005364 | Ga0070673_100192265 | Ga0070673_1001922653 | 123 |
| 98 | 3300005364 | Ga0070673_101593826 | Ga0070673_1015938261 | 123 |
| 99 | 3300005366 | Ga0070659_101615106 | Ga0070659_1016151061 | 123 |
| 100 | 3300005367 | Ga0070667_100001062 | Ga0070667_1000010622 | 123 |
| 101 | 3300005367 | Ga0070667_100005234 | Ga0070667_1000052345 | 123 |
| 102 | 3300005367 | Ga0070667_100173857 | Ga0070667_1001738572 | 123 |
| 103 | 3300005367 | Ga0070667_100343375 | Ga0070667_1003433752 | 123 |
| 104 | 3300005367 | Ga0070667_100651403 | Ga0070667_1006514032 | 123 |
| 105 | 3300005435 | Ga0070714_100000073 | Ga0070714_10000007391 | 123 |
| 106 | 3300005437 | Ga0070710_11060481 | Ga0070710_110604811 | 123 |
| 107 | 3300005445 | Ga0070708_100001533 | Ga0070708_1000015334 | 123 |
| 108 | 3300005455 | Ga0070663_100000389 | Ga0070663_1000003893 | 123 |
| 109 | 3300005455 | Ga0070663_100027054 | Ga0070663_1000270545 | 123 |
| 110 | 3300005455 | Ga0070663_100074462 | Ga0070663_1000744622 | 123 |
| 111 | 3300005455 | Ga0070663_100086472 | Ga0070663_1000864723 | 123 |
| 112 | 3300005456 | Ga0070678_100052300 | Ga0070678_1000523006 | 123 |
| 113 | 3300005457 | Ga0070662_100029177 | Ga0070662_1000291774 | 123 |
| 114 | 3300005457 | Ga0070662_100036609 | Ga0070662_1000366093 | 123 |
| 115 | 3300005458 | Ga0070681_10692501 | Ga0070681_106925012 | 123 |
| 116 | 3300005459 | Ga0068867_100003306 | Ga0068867_1000033066 | 123 |
| 117 | 3300005518 | Ga0070699_100017797 | Ga0070699_1000177976 | 123 |
| 118 | 3300005535 | Ga0070684_101077929 | Ga0070684_1010779292 | 123 |
| 119 | 3300005536 | Ga0070697_101209934 | Ga0070697_1012099341 | 123 |
| 120 | 3300005539 | Ga0068853_100004116 | Ga0068853_10000411610 | 123 |
| 121 | 3300005539 | Ga0068853_100195713 | Ga0068853_1001957133 | 123 |
| 122 | 3300005539 | Ga0068853_101635909 | Ga0068853_1016359091 | 123 |
| 123 | 3300005539 | Ga0068853_102475103 | Ga0068853_1024751031 | 123 |
| 124 | 3300005543 | Ga0070672_100560687 | Ga0070672_1005606873 | 123 |
| 125 | 3300005547 | Ga0070693_100262915 | Ga0070693_1002629152 | 123 |
| 126 | 3300005548 | Ga0070665_100000100 | Ga0070665_10000010060 | 123 |
| 127 | 3300005548 | Ga0070665_100052574 | Ga0070665_1000525744 | 123 |
| 128 | 3300005548 | Ga0070665_100076196 | Ga0070665_1000761964 | 123 |
| 129 | 3300005563 | Ga0068855_100426686 | Ga0068855_1004266862 | 123 |
| 130 | 3300005564 | Ga0070664_100656920 | Ga0070664_1006569202 | 123 |
| 131 | 3300005577 | Ga0068857_100548740 | Ga0068857_1005487402 | 123 |
| 132 | 3300005578 | Ga0068854_100169116 | Ga0068854_1001691164 | 123 |
| 133 | 3300005578 | Ga0068854_101135256 | Ga0068854_1011352562 | 123 |
| 134 | 3300005578 | Ga0068854_101391879 | Ga0068854_1013918791 | 123 |
| 135 | 3300005614 | Ga0068856_100102161 | Ga0068856_1001021614 | 123 |
| 136 | 3300005614 | Ga0068856_101121933 | Ga0068856_1011219332 | 123 |
| 137 | 3300005616 | Ga0068852_100013930 | Ga0068852_1000139308 | 123 |
| 138 | 3300005616 | Ga0068852_100136246 | Ga0068852_1001362462 | 123 |
| 139 | 3300005616 | Ga0068852_100372203 | Ga0068852_1003722032 | 123 |
| 140 | 3300005617 | Ga0068859_100001272 | Ga0068859_1000012724 | 123 |
| 141 | 3300005617 | Ga0068859_100015903 | Ga0068859_1000159039 | 123 |
| 142 | 3300005618 | Ga0068864_100059009 | Ga0068864_1000590094 | 123 |
| 143 | 3300005618 | Ga0068864_100231337 | Ga0068864_1002313374 | 123 |
| 144 | 3300005719 | Ga0068861_100097778 | Ga0068861_1000977783 | 123 |
| 145 | 3300005834 | Ga0068851_10053881 | Ga0068851_100538813 | 123 |
| 146 | 3300005834 | Ga0068851_10086384 | Ga0068851_100863842 | 123 |
| 147 | 3300005841 | Ga0068863_100129228 | Ga0068863_1001292284 | 123 |
| 148 | 3300005841 | Ga0068863_102020141 | Ga0068863_1020201411 | 123 |
| 149 | 3300005842 | Ga0068858_100010674 | Ga0068858_10001067414 | 123 |
| 150 | 3300005843 | Ga0068860_100135206 | Ga0068860_1001352063 | 123 |
| 151 | 3300005843 | Ga0068860_100559956 | Ga0068860_1005599562 | 123 |
| 152 | 3300005843 | Ga0068860_100801035 | Ga0068860_1008010352 | 123 |
| 153 | 3300005843 | Ga0068860_100937325 | Ga0068860_1009373252 | 123 |
| 154 | 3300005844 | Ga0068862_100005379 | Ga0068862_1000053795 | 123 |
| 155 | 3300005844 | Ga0068862_100013778 | Ga0068862_1000137782 | 123 |
| 156 | 3300005844 | Ga0068862_100056017 | Ga0068862_1000560172 | 123 |
| 157 | 3300005844 | Ga0068862_100157790 | Ga0068862_1001577904 | 123 |
| 158 | 3300005844 | Ga0068862_100967592 | Ga0068862_1009675922 | 123 |
| 159 | 3300005983 | Ga0081540_1014464 | Ga0081540_10144643 | 123 |
| 160 | 3300006237 | Ga0097621_100078685 | Ga0097621_1000786853 | 123 |
| 161 | 3300006237 | Ga0097621_100569974 | Ga0097621_1005699742 | 123 |
| 162 | 3300006237 | Ga0097621_100832440 | Ga0097621_1008324402 | 123 |
| 163 | 3300006358 | Ga0068871_100262909 | Ga0068871_1002629093 | 123 |
| 164 | 3300006358 | Ga0068871_100716355 | Ga0068871_1007163552 | 123 |
| 165 | 3300006880 | Ga0075429_100059181 | Ga0075429_1000591815 | 123 |
| 166 | 3300006880 | Ga0075429_101461859 | Ga0075429_1014618592 | 123 |
| 167 | 3300006881 | Ga0068865_100032603 | Ga0068865_1000326033 | 123 |
| 168 | 3300006881 | Ga0068865_100222447 | Ga0068865_1002224471 | 123 |
| 169 | 3300006931 | Ga0097620_100001272 | Ga0097620_1000012724 | 123 |
| 170 | 3300006931 | Ga0097620_100015903 | Ga0097620_1000159036 | 123 |
| 171 | 3300009093 | Ga0105240_10485930 | Ga0105240_104859302 | 123 |
| 172 | 3300009093 | Ga0105240_11054212 | Ga0105240_110542122 | 123 |
| 173 | 3300009093 | Ga0105240_11606798 | Ga0105240_116067981 | 123 |
| 174 | 3300009098 | Ga0105245_11055971 | Ga0105245_110559712 | 123 |
| 175 | 3300009101 | Ga0105247_10084613 | Ga0105247_100846132 | 123 |
| 176 | 3300009174 | Ga0105241_10874044 | Ga0105241_108740442 | 123 |
| 177 | 3300009174 | Ga0105241_11086475 | Ga0105241_110864751 | 123 |
| 178 | 3300009176 | Ga0105242_10668701 | Ga0105242_106687012 | 123 |
| 179 | 3300009176 | Ga0105242_12951934 | Ga0105242_129519341 | 123 |
| 180 | 3300009177 | Ga0105248_10005464 | Ga0105248_100054644 | 123 |
| 181 | 3300009177 | Ga0105248_10043012 | Ga0105248_100430125 | 123 |
| 182 | 3300009177 | Ga0105248_10226740 | Ga0105248_102267403 | 123 |
| 183 | 3300009177 | Ga0105248_11871663 | Ga0105248_118716632 | 123 |
| 184 | 3300009545 | Ga0105237_10005712 | Ga0105237_100057123 | 123 |
| 185 | 3300009545 | Ga0105237_10335188 | Ga0105237_103351881 | 123 |
| 186 | 3300009545 | Ga0105237_10395050 | Ga0105237_103950502 | 123 |
| 187 | 3300009545 | Ga0105237_12391829 | Ga0105237_123918291 | 123 |
| 188 | 3300009551 | Ga0105238_10280086 | Ga0105238_102800862 | 123 |
| 189 | 3300009551 | Ga0105238_11785563 | Ga0105238_117855631 | 123 |
| 190 | 3300009551 | Ga0105238_12002177 | Ga0105238_120021771 | 123 |
| 191 | 3300009551 | Ga0105238_12816439 | Ga0105238_128164391 | 123 |
| 192 | 3300009553 | Ga0105249_10000803 | Ga0105249_100008033 | 123 |
| 193 | 3300009553 | Ga0105249_10021446 | Ga0105249_100214462 | 123 |
| 194 | 3300009553 | Ga0105249_10093401 | Ga0105249_100934013 | 123 |
| 195 | 3300009553 | Ga0105249_10903928 | Ga0105249_109039282 | 123 |
| 196 | 3300009982 | Ga0105147_103763 | Ga0105147_1037631 | 123 |
| 197 | 3300010375 | Ga0105239_10000033 | Ga0105239_10000033176 | 123 |
| 198 | 3300010375 | Ga0105239_10077609 | Ga0105239_100776094 | 123 |
| 199 | 3300010375 | Ga0105239_10117858 | Ga0105239_101178583 | 123 |
| 200 | 3300010375 | Ga0105239_10172090 | Ga0105239_101720904 | 123 |
| 201 | 3300013100 | Ga0157373_10791042 | Ga0157373_107910422 | 123 |
| 202 | 3300013102 | Ga0157371_10198496 | Ga0157371_101984962 | 123 |
| 203 | 3300013102 | Ga0157371_10325502 | Ga0157371_103255022 | 123 |
| 204 | 3300013102 | Ga0157371_11125012 | Ga0157371_111250122 | 123 |
| 205 | 3300013104 | Ga0157370_11573633 | Ga0157370_115736332 | 123 |
| 206 | 3300013105 | Ga0157369_10599383 | Ga0157369_105993832 | 123 |
| 207 | 3300013296 | Ga0157374_10344405 | Ga0157374_103444052 | 123 |
| 208 | 3300013296 | Ga0157374_10350999 | Ga0157374_103509992 | 123 |
| 209 | 3300013297 | Ga0157378_10302918 | Ga0157378_103029182 | 123 |
| 210 | 3300013306 | Ga0163162_10000716 | Ga0163162_100007167 | 123 |
| 211 | 3300013306 | Ga0163162_10323223 | Ga0163162_103232233 | 123 |
| 212 | 3300013307 | Ga0157372_10029438 | Ga0157372_100294383 | 123 |
| 213 | 3300013307 | Ga0157372_10054298 | Ga0157372_100542986 | 123 |
| 214 | 3300013307 | Ga0157372_10434263 | Ga0157372_104342632 | 123 |
| 215 | 3300013308 | Ga0157375_10160997 | Ga0157375_101609973 | 123 |
| 216 | 3300013308 | Ga0157375_10317538 | Ga0157375_103175383 | 123 |
| 217 | 3300013308 | Ga0157375_10968507 | Ga0157375_109685072 | 123 |
| 218 | 3300014325 | Ga0163163_10147637 | Ga0163163_101476373 | 123 |
| 219 | 3300014325 | Ga0163163_10215573 | Ga0163163_102155733 | 123 |
| 220 | 3300014326 | Ga0157380_12340575 | Ga0157380_123405752 | 123 |
| 221 | 3300014968 | Ga0157379_11069203 | Ga0157379_110692032 | 123 |
| 222 | 3300014969 | Ga0157376_10034293 | Ga0157376_100342934 | 123 |
| 223 | 3300014969 | Ga0157376_11067586 | Ga0157376_110675862 | 123 |
| 224 | 3300024227 | Ga0228598_1007421 | Ga0228598_10074212 | 123 |
| 225 | 3300025297 | Ga0209758_1000239 | Ga0209758_100023995 | 123 |
| 226 | 3300025297 | Ga0209758_1019994 | Ga0209758_10199942 | 123 |
| 227 | 3300025298 | Ga0209050_1012953 | Ga0209050_10129535 | 123 |
| 228 | 3300025304 | Ga0209257_1001119 | Ga0209257_100111938 | 123 |
| 229 | 3300025321 | Ga0207656_10082737 | Ga0207656_100827372 | 123 |
| 230 | 3300025321 | Ga0207656_10735679 | Ga0207656_107356791 | 123 |
| 231 | 3300025893 | Ga0207682_10248914 | Ga0207682_102489142 | 123 |
| 232 | 3300025903 | Ga0207680_10615059 | Ga0207680_106150592 | 123 |
| 233 | 3300025904 | Ga0207647_10006826 | Ga0207647_100068266 | 123 |
| 234 | 3300025907 | Ga0207645_10079916 | Ga0207645_100799164 | 123 |
| 235 | 3300025909 | Ga0207705_10196778 | Ga0207705_101967782 | 123 |
| 236 | 3300025912 | Ga0207707_10257289 | Ga0207707_102572892 | 123 |
| 237 | 3300025913 | Ga0207695_10000322 | Ga0207695_1000032217 | 123 |
| 238 | 3300025913 | Ga0207695_10003273 | Ga0207695_1000327316 | 123 |
| 239 | 3300025913 | Ga0207695_10024662 | Ga0207695_100246622 | 123 |
| 240 | 3300025913 | Ga0207695_10221507 | Ga0207695_102215071 | 123 |
| 241 | 3300025913 | Ga0207695_10750031 | Ga0207695_107500311 | 123 |
| 242 | 3300025914 | Ga0207671_10006234 | Ga0207671_100062344 | 123 |
| 243 | 3300025914 | Ga0207671_10503913 | Ga0207671_105039132 | 123 |
| 244 | 3300025920 | Ga0207649_10277425 | Ga0207649_102774252 | 123 |
| 245 | 3300025920 | Ga0207649_10906477 | Ga0207649_109064771 | 123 |
| 246 | 3300025920 | Ga0207649_11052275 | Ga0207649_110522751 | 123 |
| 247 | 3300025923 | Ga0207681_10003285 | Ga0207681_100032854 | 123 |
| 248 | 3300025924 | Ga0207694_10593962 | Ga0207694_105939622 | 123 |
| 249 | 3300025925 | Ga0207650_10159869 | Ga0207650_101598692 | 123 |
| 250 | 3300025925 | Ga0207650_10502008 | Ga0207650_105020082 | 123 |
| 251 | 3300025925 | Ga0207650_10657467 | Ga0207650_106574672 | 123 |
| 252 | 3300025929 | Ga0207664_10000041 | Ga0207664_10000041142 | 123 |
| 253 | 3300025931 | Ga0207644_10067208 | Ga0207644_100672084 | 123 |
| 254 | 3300025932 | Ga0207690_10000124 | Ga0207690_1000012437 | 123 |
| 255 | 3300025932 | Ga0207690_11030805 | Ga0207690_110308051 | 123 |
| 256 | 3300025933 | Ga0207706_10013686 | Ga0207706_100136864 | 123 |
| 257 | 3300025933 | Ga0207706_10025799 | Ga0207706_100257992 | 123 |
| 258 | 3300025933 | Ga0207706_10158551 | Ga0207706_101585513 | 123 |
| 259 | 3300025934 | Ga0207686_10841113 | Ga0207686_108411131 | 123 |
| 260 | 3300025934 | Ga0207686_11013429 | Ga0207686_110134292 | 123 |
| 261 | 3300025937 | Ga0207669_10281979 | Ga0207669_102819792 | 123 |
| 262 | 3300025937 | Ga0207669_10340976 | Ga0207669_103409762 | 123 |
| 263 | 3300025938 | Ga0207704_10154993 | Ga0207704_101549932 | 123 |
| 264 | 3300025938 | Ga0207704_10518912 | Ga0207704_105189122 | 123 |
| 265 | 3300025938 | Ga0207704_10709506 | Ga0207704_107095062 | 123 |
| 266 | 3300025940 | Ga0207691_10074226 | Ga0207691_100742262 | 123 |
| 267 | 3300025941 | Ga0207711_10000539 | Ga0207711_1000053933 | 123 |
| 268 | 3300025941 | Ga0207711_10356691 | Ga0207711_103566912 | 123 |
| 269 | 3300025941 | Ga0207711_10477453 | Ga0207711_104774532 | 123 |
| 270 | 3300025942 | Ga0207689_10002311 | Ga0207689_1000231124 | 123 |
| 271 | 3300025942 | Ga0207689_10234532 | Ga0207689_102345322 | 123 |
| 272 | 3300025942 | Ga0207689_10267644 | Ga0207689_102676442 | 123 |
| 273 | 3300025945 | Ga0207679_11075694 | Ga0207679_110756942 | 123 |
| 274 | 3300025949 | Ga0207667_10401151 | Ga0207667_104011511 | 123 |
| 275 | 3300025960 | Ga0207651_10153349 | Ga0207651_101533495 | 123 |
| 276 | 3300025960 | Ga0207651_10651854 | Ga0207651_106518543 | 123 |
| 277 | 3300025961 | Ga0207712_10013427 | Ga0207712_100134272 | 123 |
| 278 | 3300025961 | Ga0207712_10844905 | Ga0207712_108449052 | 123 |
| 279 | 3300025961 | Ga0207712_11366680 | Ga0207712_113666801 | 123 |
| 280 | 3300025972 | Ga0207668_10006717 | Ga0207668_1000671711 | 123 |
| 281 | 3300025972 | Ga0207668_10299007 | Ga0207668_102990072 | 123 |
| 282 | 3300025981 | Ga0207640_10339529 | Ga0207640_103395292 | 123 |
| 283 | 3300025981 | Ga0207640_10506574 | Ga0207640_105065742 | 123 |
| 284 | 3300025981 | Ga0207640_11125254 | Ga0207640_111252541 | 123 |
| 285 | 3300025986 | Ga0207658_10000626 | Ga0207658_1000062621 | 123 |
| 286 | 3300025986 | Ga0207658_10002618 | Ga0207658_100026186 | 123 |
| 287 | 3300025986 | Ga0207658_10044897 | Ga0207658_100448972 | 123 |
| 288 | 3300025986 | Ga0207658_10186291 | Ga0207658_101862912 | 123 |
| 289 | 3300025986 | Ga0207658_10582874 | Ga0207658_105828742 | 123 |
| 290 | 3300025986 | Ga0207658_11746866 | Ga0207658_117468661 | 123 |
| 291 | 3300026023 | Ga0207677_10093726 | Ga0207677_100937265 | 123 |
| 292 | 3300026023 | Ga0207677_12117209 | Ga0207677_121172091 | 123 |
| 293 | 3300026035 | Ga0207703_10936770 | Ga0207703_109367702 | 123 |
| 294 | 3300026035 | Ga0207703_11276670 | Ga0207703_112766701 | 123 |
| 295 | 3300026035 | Ga0207703_11378481 | Ga0207703_113784811 | 123 |
| 296 | 3300026041 | Ga0207639_10033535 | Ga0207639_100335355 | 123 |
| 297 | 3300026041 | Ga0207639_10830032 | Ga0207639_108300321 | 123 |
| 298 | 3300026041 | Ga0207639_11011426 | Ga0207639_110114261 | 123 |
| 299 | 3300026067 | Ga0207678_10001238 | Ga0207678_100012383 | 123 |
| 300 | 3300026067 | Ga0207678_10012496 | Ga0207678_100124965 | 123 |
| 301 | 3300026067 | Ga0207678_10029809 | Ga0207678_100298097 | 123 |
| 302 | 3300026088 | Ga0207641_10204328 | Ga0207641_102043282 | 123 |
| 303 | 3300026088 | Ga0207641_10356724 | Ga0207641_103567242 | 123 |
| 304 | 3300026088 | Ga0207641_11339686 | Ga0207641_113396861 | 123 |
| 305 | 3300026089 | Ga0207648_10006184 | Ga0207648_100061844 | 123 |
| 306 | 3300026089 | Ga0207648_10225319 | Ga0207648_102253192 | 123 |
| 307 | 3300026095 | Ga0207676_10075142 | Ga0207676_100751422 | 123 |
| 308 | 3300026095 | Ga0207676_10110297 | Ga0207676_101102971 | 123 |
| 309 | 3300026095 | Ga0207676_11972693 | Ga0207676_119726931 | 123 |
| 310 | 3300026116 | Ga0207674_10068204 | Ga0207674_100682044 | 123 |
| 311 | 3300026118 | Ga0207675_100035871 | Ga0207675_1000358715 | 123 |
| 312 | 3300026121 | Ga0207683_10014586 | Ga0207683_100145863 | 123 |
| 313 | 3300026142 | Ga0207698_10142480 | Ga0207698_101424802 | 123 |
| 314 | 3300026142 | Ga0207698_11460006 | Ga0207698_114600062 | 123 |
| 315 | 3300028379 | Ga0268266_10000017 | Ga0268266_1000001788 | 123 |
| 316 | 3300028379 | Ga0268266_10107210 | Ga0268266_101072102 | 123 |
| 317 | 3300028379 | Ga0268266_10206265 | Ga0268266_102062653 | 123 |
| 318 | 3300028379 | Ga0268266_10211662 | Ga0268266_102116621 | 123 |
| 319 | 3300028380 | Ga0268265_10001627 | Ga0268265_100016275 | 123 |
| 320 | 3300028380 | Ga0268265_10146403 | Ga0268265_101464031 | 123 |
| 321 | 3300028380 | Ga0268265_10273007 | Ga0268265_102730073 | 123 |
| 322 | 3300028380 | Ga0268265_10309638 | Ga0268265_103096382 | 123 |
| 323 | 3300028381 | Ga0268264_10427239 | Ga0268264_104272393 | 123 |
| 324 | 3300028381 | Ga0268264_10855046 | Ga0268264_108550461 | 123 |
| 325 | 3300028381 | Ga0268264_12106361 | Ga0268264_121063612 | 123 |
| 326 | 3300031456 | Ga0307513_10122955 | Ga0307513_101229553 | 123 |
| 327 | 3300031456 | Ga0307513_10498034 | Ga0307513_104980341 | 123 |
| 328 | 3300031616 | Ga0307508_10053263 | Ga0307508_100532632 | 123 |
| 329 | 3300033180 | Ga0307510_10576638 | Ga0307510_105766381 | 123 |
| 330 | 3300037312 | Ga0395899_0017037 | Ga0395899_0017037_4734_5117 | 123 |
| 331 | 3300039437 | Ga0436365_0438639 | Ga0436365_0438639_2729_3109 | 123 |
| 332 | 3300039447 | Ga0436361_0995122 | Ga0436361_0995122_153_536 | 123 |
| 333 | 3300039450 | Ga0436363_1473180 | Ga0436363_1473180_130_510 | 123 |
| 334 | 3300041463 | Ga0451804_1152559 | Ga0451804_1152559_12_392 | 123 |
| 335 | 3300041498 | Ga0451841_1356420 | Ga0451841_1356420_330_746 | 123 |
| 336 | 3300041505 | Ga0451849_0988518 | Ga0451849_0988518_178_561 | 123 |
| 337 | 3300042000 | Ga0439437_017097 | Ga0439437_017097_375_758 | 123 |
| 338 | 3300042006 | Ga0439432_206180 | Ga0439432_206180_99_482 | 123 |
| 339 | 3300044672 | Ga0466982_0000011 | Ga0466982_0000011_32376_32762 | 123 |
| 340 | 3300044683 | Ga0466965_0056345 | Ga0466965_0056345_47_433 | 123 |
| 341 | 3300044684 | Ga0466966_0003916 | Ga0466966_0003916_7809_8195 | 123 |
| 342 | 3300046471 | Ga0495650_0000134 | Ga0495650_0000134_54669_55127 | 123 |
| 343 | 3300046519 | Ga0495632_0293735 | Ga0495632_0293735_157_546 | 123 |
| 344 | 3300046537 | Ga0495598_0039599 | Ga0495598_0039599_792_1175 | 123 |
| 345 | 3300046539 | Ga0495621_0008227 | Ga0495621_0008227_1831_2214 | 123 |
| 346 | 3300046539 | Ga0495621_0286621 | Ga0495621_0286621_269_652 | 123 |
| 347 | 3300046660 | Ga0495625_0009321 | Ga0495625_0009321_5064_5522 | 123 |
| 348 | 3300046694 | Ga0495649_0000573 | Ga0495649_0000573_26485_26895 | 123 |
| 349 | 3300047472 | Ga0495686_0006212 | Ga0495686_0006212_7529_7918 | 123 |
| 350 | 3300048903 | Ga0496100_0453346 | Ga0496100_0453346_232_615 | 123 |
| 351 | 3300048904 | Ga0496101_0014930 | Ga0496101_0014930_2758_3141 | 123 |
| 352 | 3300048906 | Ga0496103_0209272 | Ga0496103_0209272_240_638 | 123 |
| 353 | 3300048907 | Ga0496104_0033922 | Ga0496104_0033922_2845_3243 | 123 |
| 354 | 3300048908 | Ga0496105_0044783 | Ga0496105_0044783_26_424 | 123 |
| 355 | 3300048918 | Ga0496115_0003509 | Ga0496115_0003509_8193_8603 | 123 |
| 356 | 3300048918 | Ga0496115_0023942 | Ga0496115_0023942_1386_1769 | 123 |
| 357 | 3300048918 | Ga0496115_0153987 | Ga0496115_0153987_450_833 | 123 |
| 358 | 3300048919 | Ga0496116_0142325 | Ga0496116_0142325_452_850 | 123 |
| 359 | 3300048920 | Ga0496117_0048897 | Ga0496117_0048897_670_1053 | 123 |
| 360 | 3300048920 | Ga0496117_0072463 | Ga0496117_0072463_1359_1757 | 123 |
| 361 | 3300048921 | Ga0496118_0008500 | Ga0496118_0008500_3636_4034 | 123 |
| 362 | 3300048921 | Ga0496118_0011773 | Ga0496118_0011773_6616_6999 | 123 |
| 363 | 3300048922 | Ga0496119_0000776 | Ga0496119_0000776_38570_38968 | 123 |
| 364 | 3300048923 | Ga0496120_0000874 | Ga0496120_0000874_38570_38968 | 123 |
| 365 | 3300048924 | Ga0496121_0160198 | Ga0496121_0160198_221_604 | 123 |
| 366 | 3300048925 | Ga0496122_0007208 | Ga0496122_0007208_8531_8917 | 123 |
| 367 | 3300048926 | Ga0496123_0002900 | Ga0496123_0002900_16118_16504 | 123 |
| 368 | 3300048929 | Ga0496126_0005390 | Ga0496126_0005390_2652_3035 | 123 |
| 369 | 3300048929 | Ga0496126_0191029 | Ga0496126_0191029_65_475 | 123 |
| 370 | 3300048929 | Ga0496126_0708902 | Ga0496126_0708902_172_558 | 123 |
| 371 | 3300049568 | Ga0501031_0087683 | Ga0501031_0087683_422_811 | 123 |
| 372 | 3300049568 | Ga0501031_0089563 | Ga0501031_0089563_281_670 | 123 |
| 373 | 3300049569 | Ga0501032_0016690 | Ga0501032_0016690_4141_4530 | 123 |
| 374 | 3300049569 | Ga0501032_0063172 | Ga0501032_0063172_1268_1651 | 123 |
| 375 | 3300049569 | Ga0501032_0075525 | Ga0501032_0075525_826_1215 | 123 |
| 376 | 3300049570 | Ga0501033_0003691 | Ga0501033_0003691_8522_8911 | 123 |
| 377 | 3300049570 | Ga0501033_0021629 | Ga0501033_0021629_1278_1661 | 123 |
| 378 | 3300049570 | Ga0501033_0323795 | Ga0501033_0323795_34_423 | 123 |
| 379 | 3300049571 | Ga0501034_0019035 | Ga0501034_0019035_3351_3740 | 123 |
| 380 | 3300049571 | Ga0501034_0474197 | Ga0501034_0474197_567_950 | 123 |
| 381 | 3300049572 | Ga0501036_0011209 | Ga0501036_0011209_4507_4896 | 123 |
| 382 | 3300049572 | Ga0501036_0057702 | Ga0501036_0057702_2240_2629 | 123 |
| 383 | 3300049572 | Ga0501036_0130130 | Ga0501036_0130130_566_949 | 123 |
| 384 | 3300049573 | Ga0501037_0028837 | Ga0501037_0028837_2174_2563 | 123 |
| 385 | 3300049573 | Ga0501037_0103873 | Ga0501037_0103873_444_824 | 123 |
| 386 | 3300049573 | Ga0501037_0173902 | Ga0501037_0173902_615_998 | 123 |
| 387 | 3300049573 | Ga0501037_0863824 | Ga0501037_0863824_34_423 | 123 |
| 388 | 3300049574 | Ga0501038_0025863 | Ga0501038_0025863_2948_3337 | 123 |
| 389 | 3300049574 | Ga0501038_0387838 | Ga0501038_0387838_34_423 | 123 |
| 390 | 3300049575 | Ga0501039_0013281 | Ga0501039_0013281_1563_1952 | 123 |
| 391 | 3300049575 | Ga0501039_0187938 | Ga0501039_0187938_379_768 | 123 |
| 392 | 3300049575 | Ga0501039_1235737 | Ga0501039_1235737_46_426 | 123 |
| 393 | 3300049576 | Ga0501040_0435785 | Ga0501040_0435785_460_849 | 123 |
| 394 | 3300049577 | Ga0501041_0121156 | Ga0501041_0121156_990_1370 | 123 |
| 395 | 3300049578 | Ga0501042_0424316 | Ga0501042_0424316_464_853 | 123 |
| 396 | 3300049579 | Ga0501043_0027454 | Ga0501043_0027454_3858_4241 | 123 |
| 397 | 3300049579 | Ga0501043_0138802 | Ga0501043_0138802_210_653 | 123 |
| 398 | 3300049579 | Ga0501043_0442242 | Ga0501043_0442242_576_965 | 123 |
| 399 | 3300049579 | Ga0501043_0507231 | Ga0501043_0507231_409_798 | 123 |
| 400 | 3300049580 | Ga0501046_0007041 | Ga0501046_0007041_5758_6147 | 123 |
| 401 | 3300049580 | Ga0501046_0091702 | Ga0501046_0091702_1288_1677 | 123 |
| 402 | 3300049581 | Ga0501047_0071111 | Ga0501047_0071111_788_1171 | 123 |
| 403 | 3300049581 | Ga0501047_0157450 | Ga0501047_0157450_534_923 | 123 |
| 404 | 3300049581 | Ga0501047_0194816 | Ga0501047_0194816_431_811 | 123 |
| 405 | 3300049581 | Ga0501047_0502958 | Ga0501047_0502958_462_851 | 123 |
| 406 | 3300049581 | Ga0501047_0755200 | Ga0501047_0755200_309_698 | 123 |
| 407 | 3300049582 | Ga0501048_0208506 | Ga0501048_0208506_85_474 | 123 |
| 408 | 3300049582 | Ga0501048_0224279 | Ga0501048_0224279_283_672 | 123 |
| 409 | 3300049582 | Ga0501048_0387841 | Ga0501048_0387841_46_426 | 123 |
| 410 | 3300049583 | Ga0501067_0052713 | Ga0501067_0052713_335_724 | 123 |
| 411 | 3300049583 | Ga0501067_0060768 | Ga0501067_0060768_787_1176 | 123 |
| 412 | 3300049584 | Ga0501068_0071918 | Ga0501068_0071918_805_1194 | 123 |
| 413 | 3300049584 | Ga0501068_0225676 | Ga0501068_0225676_113_493 | 123 |
| 414 | 3300049585 | Ga0501069_0028683 | Ga0501069_0028683_286_675 | 123 |
| 415 | 3300049586 | Ga0501070_0063367 | Ga0501070_0063367_2026_2415 | 123 |
| 416 | 3300049586 | Ga0501070_0229878 | Ga0501070_0229878_750_1133 | 123 |
| 417 | 3300049586 | Ga0501070_0411009 | Ga0501070_0411009_45_434 | 123 |
| 418 | 3300049586 | Ga0501070_0456505 | Ga0501070_0456505_154_543 | 123 |
| 419 | 3300049586 | Ga0501070_0555003 | Ga0501070_0555003_80_460 | 123 |
| 420 | 3300049587 | Ga0501071_0113753 | Ga0501071_0113753_1204_1593 | 123 |
| 421 | 3300049587 | Ga0501071_0246756 | Ga0501071_0246756_907_1287 | 123 |
| 422 | 3300049587 | Ga0501071_0565868 | Ga0501071_0565868_407_796 | 123 |
| 423 | 3300049588 | Ga0501072_0018149 | Ga0501072_0018149_4566_4946 | 123 |
| 424 | 3300049588 | Ga0501072_0447122 | Ga0501072_0447122_518_907 | 123 |
| 425 | 3300049588 | Ga0501072_0507028 | Ga0501072_0507028_237_626 | 123 |
| 426 | 3300049589 | Ga0501073_0034081 | Ga0501073_0034081_2046_2435 | 123 |
| 427 | 3300049589 | Ga0501073_0096935 | Ga0501073_0096935_1594_1974 | 123 |
| 428 | 3300049589 | Ga0501073_0167916 | Ga0501073_0167916_647_1027 | 123 |
| 429 | 3300049589 | Ga0501073_0236729 | Ga0501073_0236729_148_591 | 123 |
| 430 | 3300049590 | Ga0501074_0015472 | Ga0501074_0015472_4568_4957 | 123 |
| 431 | 3300049590 | Ga0501074_0374967 | Ga0501074_0374967_430_810 | 123 |
| 432 | 3300049591 | Ga0501075_0015011 | Ga0501075_0015011_3544_3924 | 123 |
| 433 | 3300049592 | Ga0501076_0018645 | Ga0501076_0018645_390_770 | 123 |
| 434 | 3300049592 | Ga0501076_0228232 | Ga0501076_0228232_38_427 | 123 |
| 435 | 3300049593 | Ga0501077_0008086 | Ga0501077_0008086_3842_4222 | 123 |
| 436 | 3300049593 | Ga0501077_0764171 | Ga0501077_0764171_144_533 | 123 |
| 437 | 3300049741 | Ga0501079_0070790 | Ga0501079_0070790_432_821 | 123 |
| 438 | 3300049741 | Ga0501079_0373890 | Ga0501079_0373890_580_969 | 123 |
| 439 | 3300049741 | Ga0501079_0736142 | Ga0501079_0736142_23_403 | 123 |
| 440 | 3300049742 | Ga0501080_0014008 | Ga0501080_0014008_4538_4927 | 123 |
| 441 | 3300049742 | Ga0501080_0101040 | Ga0501080_0101040_911_1291 | 123 |
| 442 | 3300049742 | Ga0501080_0483150 | Ga0501080_0483150_341_721 | 123 |
| 443 | 3300049742 | Ga0501080_0593891 | Ga0501080_0593891_46_429 | 123 |
| 444 | 3300049742 | Ga0501080_0824171 | Ga0501080_0824171_128_517 | 123 |
| 445 | 3300049742 | Ga0501080_0954959 | Ga0501080_0954959_200_583 | 123 |
| 446 | 3300049743 | Ga0501081_0019909 | Ga0501081_0019909_2831_3211 | 123 |
| 447 | 3300049744 | Ga0501083_0041496 | Ga0501083_0041496_1999_2388 | 123 |
| 448 | 3300049744 | Ga0501083_0134146 | Ga0501083_0134146_85_474 | 123 |
| 449 | 3300049822 | Ga0501035_0029308 | Ga0501035_0029308_4220_4603 | 123 |
| 450 | 3300049822 | Ga0501035_0315065 | Ga0501035_0315065_540_929 | 123 |
| 451 | 3300049822 | Ga0501035_0368998 | Ga0501035_0368998_671_1060 | 123 |
| 452 | 3300049823 | Ga0501044_0016858 | Ga0501044_0016858_5580_5969 | 123 |
| 453 | 3300049823 | Ga0501044_0039386 | Ga0501044_0039386_1435_1818 | 123 |
| 454 | 3300049823 | Ga0501044_0047280 | Ga0501044_0047280_660_1049 | 123 |
| 455 | 3300049823 | Ga0501044_0169789 | Ga0501044_0169789_352_732 | 123 |
| 456 | 3300049823 | Ga0501044_0242275 | Ga0501044_0242275_1223_1612 | 123 |
| 457 | 3300049823 | Ga0501044_0449742 | Ga0501044_0449742_780_1169 | 123 |
| 458 | 3300049823 | Ga0501044_0803328 | Ga0501044_0803328_339_719 | 123 |
| 459 | 3300049824 | Ga0501045_0017582 | Ga0501045_0017582_1890_2279 | 123 |
| 460 | 3300049824 | Ga0501045_0063864 | Ga0501045_0063864_995_1375 | 123 |
| 461 | 3300049824 | Ga0501045_0139254 | Ga0501045_0139254_1385_1774 | 123 |
| 462 | 3300050508 | nmdc:mga09592_267408_c1 | nmdc:mga09592_267408_c1_805_1182 | 123 |
| 463 | 3300053083 | Ga0495655_0334615 | Ga0495655_0334615_90_473 | 123 |
| 464 | 3300053088 | Ga0500644_0118355 | Ga0500644_0118355_586_966 | 123 |
| 465 | 3300053090 | Ga0500646_0007308 | Ga0500646_0007308_84_464 | 123 |
| 466 | 3300053093 | Ga0500651_0772833 | Ga0500651_0772833_118_498 | 123 |
| 467 | 3300053118 | Ga0500594_0059405 | Ga0500594_0059405_621_1001 | 123 |
| 468 | 3300053120 | Ga0500597_000799 | Ga0500597_000799_3304_3693 | 123 |
| 469 | 3300053130 | Ga0500642_0000378 | Ga0500642_0000378_10971_11351 | 123 |
| 470 | 3300053134 | Ga0500658_0295296 | Ga0500658_0295296_203_583 | 123 |
| 471 | 3300053139 | Ga0500568_0002415 | Ga0500568_0002415_10479_10862 | 123 |
| 472 | 3300053139 | Ga0500568_0002932 | Ga0500568_0002932_5161_5541 | 123 |
| 473 | 3300053142 | Ga0500577_0051215 | Ga0500577_0051215_986_1366 | 123 |
| 474 | 3300053142 | Ga0500577_0057970 | Ga0500577_0057970_530_910 | 123 |
| 475 | 3300053146 | Ga0500588_0001270 | Ga0500588_0001270_516_896 | 123 |
| 476 | 3300054114 | Ga0501084_0266110 | Ga0501084_0266110_221_610 | 123 |
| 477 | 3300060353 | Ga0501082_0069588 | Ga0501082_0069588_1885_2265 | 123 |
| 478 | 3300060353 | Ga0501082_0101875 | Ga0501082_0101875_907_1296 | 123 |
| 479 | 3300060353 | Ga0501082_0290871 | Ga0501082_0290871_952_1341 | 123 |
| 480 | 3300061734 | Ga0530510_0043773 | Ga0530510_0043773_1330_1710 | 123 |
| 481 | 3300061734 | Ga0530510_0465507 | Ga0530510_0465507_473_862 | 123 |
| 482 | 3300001915 | JGI24741J21665_1000664 | JGI24741J21665_10006645 | 124 |
| 483 | 3300031911 | Ga0307412_10653250 | Ga0307412_106532501 | 124 |
| 484 | 3300048907 | Ga0496104_0672802 | Ga0496104_0672802_405_806 | 124 |
| 485 | 3300049571 | Ga0501034_1132271 | Ga0501034_1132271_229_603 | 124 |
| 486 | 3300049572 | Ga0501036_0307928 | Ga0501036_0307928_885_1259 | 124 |
| 487 | 3300049573 | Ga0501037_0186038 | Ga0501037_0186038_811_1185 | 124 |
| 488 | 3300049574 | Ga0501038_0031199 | Ga0501038_0031199_4161_4535 | 124 |
| 489 | 3300049579 | Ga0501043_0296442 | Ga0501043_0296442_843_1217 | 124 |
| 490 | 3300049581 | Ga0501047_0169697 | Ga0501047_0169697_1603_1977 | 124 |
| 491 | 3300049581 | Ga0501047_0742521 | Ga0501047_0742521_193_567 | 124 |
| 492 | 3300049585 | Ga0501069_0203422 | Ga0501069_0203422_569_943 | 124 |
| 493 | 3300049586 | Ga0501070_1202637 | Ga0501070_1202637_61_435 | 124 |
| 494 | 3300049587 | Ga0501071_1395877 | Ga0501071_1395877_142_516 | 124 |
| 495 | 3300049589 | Ga0501073_0222024 | Ga0501073_0222024_801_1175 | 124 |
| 496 | 3300049590 | Ga0501074_0007753 | Ga0501074_0007753_1562_1936 | 124 |
| 497 | 3300049742 | Ga0501080_0654275 | Ga0501080_0654275_244_618 | 124 |
| 498 | 3300049822 | Ga0501035_0000967 | Ga0501035_0000967_1398_1772 | 124 |
| 499 | 3300049822 | Ga0501035_0072397 | Ga0501035_0072397_1562_1936 | 124 |
| 500 | 3300049823 | Ga0501044_0153823 | Ga0501044_0153823_634_1008 | 124 |
| 501 | 3300049823 | Ga0501044_0640726 | Ga0501044_0640726_147_521 | 124 |
| 502 | 3300054114 | Ga0501084_0316722 | Ga0501084_0316722_42_416 | 124 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rm3-assembly1.cif.gz_SE0 | evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome | 0.8971 | 85 | 108 |
| 1d1c-assembly1.cif.gz_A | dictyostelium myosin s1dc (motor domain fragment) complexed with n-methyl-o-nitrophenyl aminoethyldiphosphate beryllium trifluoride. | 0.8966 | 85 | 108 |
| 7b1a-assembly1.cif.gz_A | myosin-ii-aa mutant motor domain | 0.8852 | 85 | 108 |
| 3mjx-assembly1.cif.gz_A | crystal structure of myosin-2 motor domain in complex with adp-metavanadate and blebbistatin | 0.8813 | 85 | 108 |
| 3mnq-assembly1.cif.gz_A | crystal structure of myosin-2 motor domain in complex with adp-metavanadate and resveratrol | 0.8762 | 85 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IIS3_1222_1271_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.9347 | 85 | 108 | 2.30.30.60 |
| af_P75783_574_621_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.899 | 85 | 108 | 2.30.30.60 |
| af_A0A1D6LPC7_212_432_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8987 | 84 | 108 | 3.50.50.60 |
| 1d1cA01 | Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal | 0.8966 | 85 | 108 | 2.30.30.360 |
| af_A0A0R4IJY6_29_78_2.30.30.360 | Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal | 0.8932 | 85 | 108 | 2.30.30.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R6WB84-F1-model_v4 | deleted | 0.9641 | 74 | 108 |
|
| AF-A0A7K0CTN1-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9604 | 63 | 110 |
|
| AF-A0A848QBT6-F1-model_v4 | deleted | 0.9587 | 1 | 84 |
|
| AF-A0A4R8FQV6-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9524 | 2 | 113 |
|
| AF-A0A2W2E0A7-F1-model_v4 | Glyoxalase | 0.9494 | 65 | 111 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar