F455842

General Info

Members Datasets Scaffolds Average Seq Length
502 244 502 127

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10117858|Ga0105239_101178583
Length 154
Sequence MQIFVFLLLRKTKQDNANLVSALEGIMHHSRLCTIVIDCRTDDLEAAANFWSQAFGKPVASYDVDDDGKYAELKTGDDEPIVLVQKVAHESRVHLDIETDDLEAEAKRLEALGAKRVEFVKDRWWVMEAPTGQRFCLVRRQRKEFGPHLNEWPD

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
162 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
163 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
236 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
241 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 3.39
Rhizosphere 87.85
Stem 0
Stem Tuber 0
Unclassified 5.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000664 3300001915 Bacteria 10379
2 JGI25153J46596_10000103 3300003215 Bacteria 96279
3 rootH2_10223466 3300003320 Bacteria 1173
4 Ga0055531_10013363 3300003794 Bacteria 3788
5 Ga0070658_10104392 3300005327 Bacteria 2344
6 Ga0070658_10182910 3300005327 Bacteria 1764
7 Ga0070676_10008008 3300005328 Bacteria 5681
8 Ga0070676_10008083 3300005328 Bacteria 5655
9 Ga0070676_10087186 3300005328 Unclassified 1905
10 Ga0070690_100081744 3300005330 Bacteria 2114
11 Ga0070670_100219880 3300005331 Bacteria 1652
12 Ga0070677_10285376 3300005333 Bacteria 833
13 Ga0068869_100048141 3300005334 Bacteria 3081
14 Ga0068869_100051553 3300005334 Bacteria 2986
15 Ga0068869_100817651 3300005334 Bacteria 802
16 Ga0068869_101700964 3300005334 Bacteria 563
17 Ga0070666_10075812 3300005335 Bacteria 2293
18 Ga0070666_10156717 3300005335 Bacteria 1591
19 Ga0070689_100141210 3300005340 Bacteria 1937
20 Ga0070661_100173828 3300005344 Bacteria 1637
21 Ga0070661_100240945 3300005344 Bacteria 1393
22 Ga0070692_10153184 3300005345 Bacteria 1315
23 Ga0070668_100012560 3300005347 Bacteria 6306
24 Ga0070668_100107357 3300005347 Bacteria 2219
25 Ga0070669_100015224 3300005353 Bacteria 5478
26 Ga0070669_100391347 3300005353 Bacteria 1135
27 Ga0070671_100292831 3300005355 Bacteria 1385
28 Ga0070671_100299690 3300005355 Bacteria 1369
29 Ga0070674_100006500 3300005356 Bacteria 6826
30 Ga0070674_100626668 3300005356 Bacteria 912
31 Ga0070673_100173654 3300005364 Bacteria 1841
32 Ga0070673_100192265 3300005364 Bacteria 1753
33 Ga0070673_101593826 3300005364 Bacteria 617
34 Ga0070659_101615106 3300005366 Bacteria 579
35 Ga0070667_100001062 3300005367 Bacteria 25112
36 Ga0070667_100005234 3300005367 Bacteria 10844
37 Ga0070667_100173857 3300005367 Bacteria 1902
38 Ga0070667_100343375 3300005367 Bacteria 1350
39 Ga0070667_100651403 3300005367 Bacteria 972
40 Ga0070709_10004644 3300005434 Bacteria 7415
41 Ga0070714_100000073 3300005435 Bacteria 88847
42 Ga0070714_100013475 3300005435 Bacteria 6553
43 Ga0070713_100054871 3300005436 Bacteria 3308
44 Ga0070710_11060481 3300005437 Unclassified 593
45 Ga0070711_100025780 3300005439 Bacteria 3849
46 Ga0070708_100001533 3300005445 Bacteria 17655
47 Ga0070663_100000389 3300005455 Bacteria 23115
48 Ga0070663_100027054 3300005455 Bacteria 3890
49 Ga0070663_100074462 3300005455 Bacteria 2479
50 Ga0070663_100086472 3300005455 Bacteria 2315
51 Ga0070678_100052300 3300005456 Bacteria 2965
52 Ga0070662_100029177 3300005457 Bacteria 3849
53 Ga0070662_100036609 3300005457 Bacteria 3472
54 Ga0070681_10692501 3300005458 Bacteria 935
55 Ga0068867_100003306 3300005459 Bacteria 11358
56 Ga0068867_100017466 3300005459 Bacteria 5096
57 Ga0070706_100000058 3300005467 Bacteria 133347
58 Ga0070707_100043874 3300005468 Bacteria 4280
59 Ga0070698_100337860 3300005471 Bacteria 1438
60 Ga0070699_100017797 3300005518 Bacteria 6102
61 Ga0070699_100530040 3300005518 Bacteria 1071
62 Ga0070684_101077929 3300005535 Unclassified 755
63 Ga0070697_100001145 3300005536 Bacteria 20085
64 Ga0070697_101209934 3300005536 Bacteria 673
65 Ga0068853_100004116 3300005539 Bacteria 11211
66 Ga0068853_100195713 3300005539 Bacteria 1838
67 Ga0068853_101635909 3300005539 Bacteria 624
68 Ga0068853_102475103 3300005539 Bacteria 503
69 Ga0070672_100560687 3300005543 Bacteria 992
70 Ga0070693_100256634 3300005547 Bacteria 1161
71 Ga0070693_100262915 3300005547 Bacteria 1148
72 Ga0070665_100000100 3300005548 Bacteria 160186
73 Ga0070665_100052574 3300005548 Bacteria 4085
74 Ga0070665_100076196 3300005548 Bacteria 3361
75 Ga0068855_100426686 3300005563 Bacteria 1449
76 Ga0070664_100656920 3300005564 Bacteria 975
77 Ga0068857_100548740 3300005577 Bacteria 1089
78 Ga0068854_100169116 3300005578 Bacteria 1699
79 Ga0068854_100376644 3300005578 Bacteria 1168
80 Ga0068854_101135256 3300005578 Bacteria 698
81 Ga0068854_101391879 3300005578 Bacteria 634
82 Ga0068856_100102161 3300005614 Bacteria 2860
83 Ga0068856_100246415 3300005614 Bacteria 1802
84 Ga0068856_101121933 3300005614 Bacteria 803
85 Ga0068852_100013930 3300005616 Bacteria 6167
86 Ga0068852_100136246 3300005616 Bacteria 2267
87 Ga0068852_100372203 3300005616 Bacteria 1400
88 Ga0068859_100001272 3300005617 Bacteria 25788
89 Ga0068859_100015903 3300005617 Bacteria 7562
90 Ga0068864_100059009 3300005618 Bacteria 3318
91 Ga0068864_100231337 3300005618 Bacteria 1709
92 Ga0068864_101066575 3300005618 Bacteria 803
93 Ga0068861_100097778 3300005719 Bacteria 2329
94 Ga0068851_10053881 3300005834 Bacteria 2048
95 Ga0068851_10086384 3300005834 Bacteria 1646
96 Ga0068870_10410425 3300005840 Bacteria 883
97 Ga0068863_100129228 3300005841 Bacteria 2411
98 Ga0068863_102020141 3300005841 Bacteria 586
99 Ga0068858_100010674 3300005842 Bacteria 8689
100 Ga0068860_100135206 3300005843 Bacteria 2367
101 Ga0068860_100559956 3300005843 Bacteria 1146
102 Ga0068860_100801035 3300005843 Bacteria 955
103 Ga0068860_100937325 3300005843 Bacteria 883
104 Ga0068862_100005379 3300005844 Bacteria 10713
105 Ga0068862_100013778 3300005844 Bacteria 6701
106 Ga0068862_100056017 3300005844 Bacteria 3377
107 Ga0068862_100157790 3300005844 Bacteria 2024
108 Ga0068862_100967592 3300005844 Bacteria 840
109 Ga0081540_1014464 3300005983 Bacteria 5053
110 Ga0070717_10028532 3300006028 Bacteria 4468
111 Ga0070717_10549398 3300006028 Bacteria 1046
112 Ga0097621_100078685 3300006237 Bacteria 2740
113 Ga0097621_100569974 3300006237 Bacteria 1032
114 Ga0097621_100832440 3300006237 Bacteria 856
115 Ga0068871_100262909 3300006358 Bacteria 1506
116 Ga0068871_100716355 3300006358 Bacteria 918
117 Ga0075428_101249557 3300006844 Bacteria 782
118 Ga0075429_100059181 3300006880 Bacteria 3337
119 Ga0075429_101461859 3300006880 Bacteria 595
120 Ga0075429_101910930 3300006880 Bacteria 514
121 Ga0068865_100032603 3300006881 Bacteria 3481
122 Ga0068865_100089104 3300006881 Unclassified 2234
123 Ga0068865_100222447 3300006881 Bacteria 1476
124 Ga0075436_100066705 3300006914 Bacteria 2488
125 Ga0097620_100001272 3300006931 Bacteria 25788
126 Ga0097620_100015903 3300006931 Bacteria 7562
127 Ga0075435_100143968 3300007076 Bacteria 2001
128 Ga0105240_10485930 3300009093 Bacteria 1376
129 Ga0105240_11054212 3300009093 Bacteria 867
130 Ga0105240_11606798 3300009093 Unclassified 680
131 Ga0105245_11055971 3300009098 Bacteria 858
132 Ga0105247_10084613 3300009101 Bacteria 2004
133 Ga0105241_10874044 3300009174 Bacteria 833
134 Ga0105241_11086475 3300009174 Bacteria 753
135 Ga0105242_10668701 3300009176 Bacteria 1012
136 Ga0105242_12951934 3300009176 Bacteria 526
137 Ga0105248_10005464 3300009177 Bacteria 13962
138 Ga0105248_10043012 3300009177 Bacteria 5065
139 Ga0105248_10226740 3300009177 Bacteria 2103
140 Ga0105248_11871663 3300009177 Bacteria 681
141 Ga0105237_10005712 3300009545 Bacteria 13991
142 Ga0105237_10335188 3300009545 Bacteria 1517
143 Ga0105237_10395050 3300009545 Bacteria 1387
144 Ga0105237_12391829 3300009545 Bacteria 538
145 Ga0105238_10280086 3300009551 Bacteria 1649
146 Ga0105238_11785563 3300009551 Bacteria 647
147 Ga0105238_12002177 3300009551 Bacteria 613
148 Ga0105238_12816439 3300009551 Bacteria 523
149 Ga0105249_10000803 3300009553 Bacteria 28251
150 Ga0105249_10021446 3300009553 Bacteria 5783
151 Ga0105249_10093401 3300009553 Bacteria 2818
152 Ga0105249_10903928 3300009553 Bacteria 950
153 Ga0105147_103763 3300009982 Bacteria 1272
154 Ga0105239_10000033 3300010375 Bacteria 223933
155 Ga0105239_10077609 3300010375 Bacteria 3655
156 Ga0105239_10117858 3300010375 Bacteria 2947
157 Ga0105239_10172090 3300010375 Bacteria 2422
158 Ga0105239_10469927 3300010375 Unclassified 1428
159 Ga0105239_12140403 3300010375 Bacteria 650
160 Ga0105246_10635144 3300011119 Bacteria 927
161 Ga0157373_10791042 3300013100 Bacteria 699
162 Ga0157371_10198496 3300013102 Bacteria 1438
163 Ga0157371_10325502 3300013102 Bacteria 1116
164 Ga0157371_11125012 3300013102 Bacteria 603
165 Ga0157370_11573633 3300013104 Bacteria 591
166 Ga0157369_10599383 3300013105 Bacteria 1137
167 Ga0157374_10344405 3300013296 Bacteria 1480
168 Ga0157374_10350999 3300013296 Bacteria 1466
169 Ga0157378_10302918 3300013297 Bacteria 1547
170 Ga0163162_10000716 3300013306 Bacteria 30803
171 Ga0163162_10323223 3300013306 Bacteria 1675
172 Ga0157372_10029438 3300013307 Bacteria 5996
173 Ga0157372_10054298 3300013307 Bacteria 4468
174 Ga0157372_10434263 3300013307 Bacteria 1530
175 Ga0157375_10160997 3300013308 Bacteria 2386
176 Ga0157375_10317538 3300013308 Bacteria 1722
177 Ga0157375_10968507 3300013308 Bacteria 992
178 Ga0163163_10147637 3300014325 Bacteria 2396
179 Ga0163163_10215573 3300014325 Bacteria 1968
180 Ga0157380_12340575 3300014326 Bacteria 599
181 Ga0157379_11069203 3300014968 Bacteria 772
182 Ga0157376_10034293 3300014969 Bacteria 4097
183 Ga0157376_11067586 3300014969 Bacteria 832
184 Ga0213871_10010854 3300021441 Bacteria 2077
185 Ga0228598_1007421 3300024227 Bacteria 2233
186 Ga0209758_1000239 3300025297 Bacteria 114761
187 Ga0209758_1019994 3300025297 Bacteria 3194
188 Ga0209050_1012953 3300025298 Bacteria 3767
189 Ga0209257_1001119 3300025304 Bacteria 34613
190 Ga0207656_10082737 3300025321 Bacteria 1445
191 Ga0207656_10735679 3300025321 Unclassified 505
192 Ga0207682_10248914 3300025893 Bacteria 827
193 Ga0207682_10360128 3300025893 Bacteria 686
194 Ga0207680_10615059 3300025903 Bacteria 777
195 Ga0207647_10006826 3300025904 Bacteria 8274
196 Ga0207647_10012642 3300025904 Bacteria 5867
197 Ga0207699_11341596 3300025906 Bacteria 529
198 Ga0207645_10013081 3300025907 Bacteria 5606
199 Ga0207645_10079916 3300025907 Bacteria 2096
200 Ga0207643_10183450 3300025908 Bacteria 1267
201 Ga0207705_10196778 3300025909 Bacteria 1526
202 Ga0207684_10000066 3300025910 Bacteria 193406
203 Ga0207707_10257289 3300025912 Bacteria 1516
204 Ga0207695_10000322 3300025913 Bacteria 114700
205 Ga0207695_10003273 3300025913 Bacteria 23026
206 Ga0207695_10024662 3300025913 Bacteria 6755
207 Ga0207695_10221507 3300025913 Bacteria 1799
208 Ga0207695_10750031 3300025913 Bacteria 856
209 Ga0207671_10006234 3300025914 Bacteria 10687
210 Ga0207671_10503913 3300025914 Bacteria 965
211 Ga0207693_10076182 3300025915 Bacteria 2627
212 Ga0207663_10113142 3300025916 Unclassified 1845
213 Ga0207649_10277425 3300025920 Bacteria 1217
214 Ga0207649_10906477 3300025920 Bacteria 691
215 Ga0207649_11052275 3300025920 Bacteria 641
216 Ga0207646_10040894 3300025922 Bacteria 4168
217 Ga0207681_10003285 3300025923 Bacteria 10122
218 Ga0207681_10006303 3300025923 Bacteria 7281
219 Ga0207694_10593962 3300025924 Bacteria 931
220 Ga0207650_10159869 3300025925 Bacteria 1784
221 Ga0207650_10502008 3300025925 Bacteria 1014
222 Ga0207650_10657467 3300025925 Bacteria 884
223 Ga0207700_10805783 3300025928 Bacteria 840
224 Ga0207700_10823655 3300025928 Bacteria 830
225 Ga0207664_10000041 3300025929 Bacteria 154806
226 Ga0207664_10010563 3300025929 Bacteria 6522
227 Ga0207644_10067208 3300025931 Bacteria 2612
228 Ga0207690_10000124 3300025932 Bacteria 63516
229 Ga0207690_11030805 3300025932 Bacteria 685
230 Ga0207706_10013686 3300025933 Bacteria 7363
231 Ga0207706_10025799 3300025933 Bacteria 5264
232 Ga0207706_10158551 3300025933 Bacteria 1990
233 Ga0207686_10841113 3300025934 Bacteria 738
234 Ga0207686_11013429 3300025934 Bacteria 674
235 Ga0207669_10281979 3300025937 Bacteria 1253
236 Ga0207669_10340976 3300025937 Bacteria 1154
237 Ga0207669_10357641 3300025937 Bacteria 1130
238 Ga0207704_10047183 3300025938 Unclassified 2573
239 Ga0207704_10154993 3300025938 Bacteria 1622
240 Ga0207704_10518912 3300025938 Bacteria 963
241 Ga0207704_10709506 3300025938 Bacteria 833
242 Ga0207665_10009764 3300025939 Bacteria 6301
243 Ga0207665_10151107 3300025939 Bacteria 1663
244 Ga0207691_10074226 3300025940 Bacteria 3068
245 Ga0207691_10234229 3300025940 Bacteria 1589
246 Ga0207711_10000539 3300025941 Bacteria 38710
247 Ga0207711_10356691 3300025941 Bacteria 1354
248 Ga0207711_10477453 3300025941 Bacteria 1161
249 Ga0207689_10002311 3300025942 Bacteria 17851
250 Ga0207689_10234532 3300025942 Bacteria 1517
251 Ga0207689_10267644 3300025942 Bacteria 1415
252 Ga0207679_10176541 3300025945 Bacteria 1764
253 Ga0207679_11075694 3300025945 Bacteria 738
254 Ga0207667_10401151 3300025949 Bacteria 1396
255 Ga0207651_10153349 3300025960 Bacteria 1796
256 Ga0207651_10651854 3300025960 Bacteria 924
257 Ga0207712_10013427 3300025961 Bacteria 5250
258 Ga0207712_10243634 3300025961 Bacteria 1449
259 Ga0207712_10844905 3300025961 Bacteria 807
260 Ga0207712_11366680 3300025961 Bacteria 633
261 Ga0207668_10006717 3300025972 Bacteria 6805
262 Ga0207668_10299007 3300025972 Bacteria 1327
263 Ga0207640_10339529 3300025981 Bacteria 1203
264 Ga0207640_10506574 3300025981 Bacteria 1006
265 Ga0207640_11125254 3300025981 Bacteria 695
266 Ga0207658_10000626 3300025986 Bacteria 31259
267 Ga0207658_10002618 3300025986 Bacteria 13068
268 Ga0207658_10044897 3300025986 Bacteria 3218
269 Ga0207658_10186291 3300025986 Bacteria 1722
270 Ga0207658_10582874 3300025986 Bacteria 1003
271 Ga0207658_11746866 3300025986 Bacteria 568
272 Ga0207677_10042234 3300026023 Bacteria 3022
273 Ga0207677_10093726 3300026023 Bacteria 2190
274 Ga0207677_12117209 3300026023 Bacteria 523
275 Ga0207703_10226616 3300026035 Bacteria 1673
276 Ga0207703_10936770 3300026035 Bacteria 830
277 Ga0207703_11276670 3300026035 Bacteria 706
278 Ga0207703_11378481 3300026035 Bacteria 678
279 Ga0207639_10033535 3300026041 Bacteria 3788
280 Ga0207639_10830032 3300026041 Bacteria 862
281 Ga0207639_11011426 3300026041 Bacteria 779
282 Ga0207678_10001238 3300026067 Bacteria 23529
283 Ga0207678_10012496 3300026067 Bacteria 7456
284 Ga0207678_10029809 3300026067 Bacteria 4764
285 Ga0207641_10204328 3300026088 Bacteria 1823
286 Ga0207641_10356724 3300026088 Bacteria 1395
287 Ga0207641_11339686 3300026088 Bacteria 716
288 Ga0207648_10006184 3300026089 Bacteria 11924
289 Ga0207648_10015990 3300026089 Bacteria 6876
290 Ga0207648_10225319 3300026089 Bacteria 1667
291 Ga0207676_10075142 3300026095 Bacteria 2725
292 Ga0207676_10110297 3300026095 Bacteria 2301
293 Ga0207676_11972693 3300026095 Bacteria 582
294 Ga0207674_10068204 3300026116 Bacteria 3580
295 Ga0207675_100035871 3300026118 Bacteria 4626
296 Ga0207675_100408609 3300026118 Bacteria 1339
297 Ga0207683_10014586 3300026121 Bacteria 6692
298 Ga0207698_10142480 3300026142 Bacteria 2067
299 Ga0207698_11460006 3300026142 Unclassified 699
300 Ga0268266_10000017 3300028379 Bacteria 607272
301 Ga0268266_10107210 3300028379 Bacteria 2470
302 Ga0268266_10206265 3300028379 Bacteria 1801
303 Ga0268266_10211662 3300028379 Bacteria 1778
304 Ga0268265_10001627 3300028380 Bacteria 18490
305 Ga0268265_10146403 3300028380 Bacteria 1985
306 Ga0268265_10273007 3300028380 Bacteria 1509
307 Ga0268265_10309638 3300028380 Bacteria 1425
308 Ga0268264_10427239 3300028381 Bacteria 1279
309 Ga0268264_10855046 3300028381 Bacteria 911
310 Ga0268264_12106361 3300028381 Bacteria 573
311 Ga0307513_10122955 3300031456 Bacteria 2558
312 Ga0307513_10498034 3300031456 Bacteria 936
313 Ga0307508_10053263 3300031616 Bacteria 3592
314 Ga0307412_10653250 3300031911 Bacteria 897
315 Ga0307510_10576638 3300033180 Bacteria 574
316 Ga0395899_0017037 3300037312 Bacteria 5536
317 Ga0436365_0438639 3300039437 Bacteria 5320
318 Ga0436360_0102030 3300039438 Bacteria 9249
319 Ga0436360_0609938 3300039438 Bacteria 1695
320 Ga0436361_0995122 3300039447 Bacteria 609
321 Ga0436363_0166237 3300039450 Bacteria 1830
322 Ga0436363_1473180 3300039450 Unclassified 591
323 Ga0451795_1615648 3300041456 Bacteria 532
324 Ga0451804_1152559 3300041463 Bacteria 516
325 Ga0451841_1356420 3300041498 Bacteria 1260
326 Ga0451849_0988518 3300041505 Bacteria 593
327 Ga0439437_017097 3300042000 Bacteria 860
328 Ga0439432_206180 3300042006 Bacteria 569
329 Ga0439460_0027389 3300042461 Unclassified 1601
330 Ga0466982_0000011 3300044672 Bacteria 175513
331 Ga0466965_0056345 3300044683 Bacteria 1957
332 Ga0466966_0003916 3300044684 Bacteria 9830
333 Ga0466963_0927802 3300044694 Bacteria 613
334 Ga0495650_0000134 3300046471 Bacteria 173331
335 Ga0495632_0293735 3300046519 Bacteria 722
336 Ga0495598_0039599 3300046537 Bacteria 1371
337 Ga0495621_0008227 3300046539 Bacteria 3119
338 Ga0495621_0286621 3300046539 Bacteria 680
339 Ga0495625_0009321 3300046660 Bacteria 8226
340 Ga0495649_0000573 3300046694 Bacteria 31036
341 Ga0495686_0006212 3300047472 Bacteria 9211
342 Ga0496100_0339560 3300048903 Bacteria 1132
343 Ga0496100_0453346 3300048903 Bacteria 983
344 Ga0496101_0014930 3300048904 Bacteria 5226
345 Ga0496101_0530091 3300048904 Bacteria 931
346 Ga0496102_0166195 3300048905 Bacteria 2076
347 Ga0496103_0037210 3300048906 Bacteria 2981
348 Ga0496103_0209272 3300048906 Bacteria 1254
349 Ga0496104_0017876 3300048907 Bacteria 6465
350 Ga0496104_0033922 3300048907 Bacteria 4758
351 Ga0496104_0672802 3300048907 Bacteria 943
352 Ga0496105_0044783 3300048908 Bacteria 3650
353 Ga0496106_0792507 3300048909 Bacteria 752
354 Ga0496115_0003509 3300048918 Bacteria 11266
355 Ga0496115_0023942 3300048918 Bacteria 4742
356 Ga0496115_0153987 3300048918 Bacteria 1899
357 Ga0496116_0142325 3300048919 Bacteria 1347
358 Ga0496117_0048897 3300048920 Bacteria 3014
359 Ga0496117_0072463 3300048920 Bacteria 2302
360 Ga0496118_0008500 3300048921 Bacteria 10597
361 Ga0496118_0011773 3300048921 Bacteria 8499
362 Ga0496118_0016719 3300048921 Bacteria 6713
363 Ga0496119_0000776 3300048922 Bacteria 42684
364 Ga0496120_0000874 3300048923 Bacteria 42572
365 Ga0496121_0160198 3300048924 Bacteria 1646
366 Ga0496122_0007208 3300048925 Bacteria 12447
367 Ga0496123_0002900 3300048926 Bacteria 20063
368 Ga0496125_0107607 3300048928 Bacteria 2031
369 Ga0496126_0005390 3300048929 Bacteria 14603
370 Ga0496126_0191029 3300048929 Bacteria 1734
371 Ga0496126_0708902 3300048929 Bacteria 781
372 Ga0501031_0087683 3300049568 Bacteria 2029
373 Ga0501031_0089563 3300049568 Bacteria 2006
374 Ga0501032_0016690 3300049569 Bacteria 5160
375 Ga0501032_0063172 3300049569 Bacteria 2479
376 Ga0501032_0075525 3300049569 Bacteria 2244
377 Ga0501033_0003691 3300049570 Bacteria 12448
378 Ga0501033_0021629 3300049570 Bacteria 4853
379 Ga0501033_0323795 3300049570 Bacteria 1082
380 Ga0501034_0019035 3300049571 Bacteria 7033
381 Ga0501034_0474197 3300049571 Bacteria 1167
382 Ga0501034_1132271 3300049571 Bacteria 663
383 Ga0501036_0011209 3300049572 Bacteria 7416
384 Ga0501036_0057702 3300049572 Bacteria 3288
385 Ga0501036_0130130 3300049572 Bacteria 2125
386 Ga0501036_0307928 3300049572 Bacteria 1325
387 Ga0501037_0028837 3300049573 Bacteria 4101
388 Ga0501037_0103873 3300049573 Bacteria 2049
389 Ga0501037_0173902 3300049573 Bacteria 1530
390 Ga0501037_0186038 3300049573 Bacteria 1472
391 Ga0501037_0863824 3300049573 Bacteria 594
392 Ga0501038_0025863 3300049574 Bacteria 5228
393 Ga0501038_0031199 3300049574 Bacteria 4711
394 Ga0501038_0387838 3300049574 Bacteria 1082
395 Ga0501039_0013281 3300049575 Bacteria 6297
396 Ga0501039_0187938 3300049575 Bacteria 1624
397 Ga0501039_1235737 3300049575 Unclassified 577
398 Ga0501040_0435785 3300049576 Bacteria 943
399 Ga0501041_0121156 3300049577 Bacteria 1626
400 Ga0501042_0424316 3300049578 Bacteria 964
401 Ga0501043_0027454 3300049579 Bacteria 4469
402 Ga0501043_0138802 3300049579 Bacteria 1904
403 Ga0501043_0296442 3300049579 Bacteria 1237
404 Ga0501043_0442242 3300049579 Bacteria 978
405 Ga0501043_0507231 3300049579 Bacteria 900
406 Ga0501046_0007041 3300049580 Bacteria 9906
407 Ga0501046_0091702 3300049580 Bacteria 2336
408 Ga0501047_0071111 3300049581 Bacteria 3349
409 Ga0501047_0157450 3300049581 Bacteria 2144
410 Ga0501047_0169697 3300049581 Bacteria 2051
411 Ga0501047_0194816 3300049581 Bacteria 1889
412 Ga0501047_0502958 3300049581 Bacteria 1038
413 Ga0501047_0742521 3300049581 Bacteria 798
414 Ga0501047_0755200 3300049581 Bacteria 788
415 Ga0501048_0208506 3300049582 Bacteria 1386
416 Ga0501048_0224279 3300049582 Bacteria 1333
417 Ga0501048_0387841 3300049582 Bacteria 998
418 Ga0501067_0052713 3300049583 Bacteria 2254
419 Ga0501067_0060768 3300049583 Bacteria 2091
420 Ga0501068_0071918 3300049584 Bacteria 2111
421 Ga0501068_0225676 3300049584 Bacteria 1191
422 Ga0501069_0028683 3300049585 Bacteria 3052
423 Ga0501069_0203422 3300049585 Bacteria 1148
424 Ga0501070_0063367 3300049586 Bacteria 3062
425 Ga0501070_0229878 3300049586 Bacteria 1520
426 Ga0501070_0411009 3300049586 Bacteria 1093
427 Ga0501070_0456505 3300049586 Bacteria 1030
428 Ga0501070_0555003 3300049586 Bacteria 919
429 Ga0501070_1202637 3300049586 Bacteria 581
430 Ga0501071_0113753 3300049587 Bacteria 2001
431 Ga0501071_0246756 3300049587 Unclassified 1347
432 Ga0501071_0565868 3300049587 Bacteria 873
433 Ga0501071_1395877 3300049587 Bacteria 541
434 Ga0501072_0018149 3300049588 Bacteria 5412
435 Ga0501072_0447122 3300049588 Bacteria 1024
436 Ga0501072_0507028 3300049588 Bacteria 954
437 Ga0501073_0034081 3300049589 Bacteria 3624
438 Ga0501073_0096935 3300049589 Bacteria 2048
439 Ga0501073_0167916 3300049589 Bacteria 1519
440 Ga0501073_0222024 3300049589 Bacteria 1305
441 Ga0501073_0236729 3300049589 Bacteria 1261
442 Ga0501074_0007753 3300049590 Bacteria 7773
443 Ga0501074_0015472 3300049590 Bacteria 5544
444 Ga0501074_0374967 3300049590 Bacteria 1009
445 Ga0501075_0015011 3300049591 Bacteria 5557
446 Ga0501076_0018645 3300049592 Bacteria 5295
447 Ga0501076_0228232 3300049592 Bacteria 1522
448 Ga0501077_0008086 3300049593 Bacteria 6501
449 Ga0501077_0764171 3300049593 Bacteria 621
450 Ga0501079_0070790 3300049741 Bacteria 2693
451 Ga0501079_0373890 3300049741 Bacteria 1117
452 Ga0501079_0736142 3300049741 Bacteria 776
453 Ga0501080_0014008 3300049742 Bacteria 7381
454 Ga0501080_0101040 3300049742 Bacteria 2675
455 Ga0501080_0483150 3300049742 Bacteria 1108
456 Ga0501080_0593891 3300049742 Bacteria 983
457 Ga0501080_0654275 3300049742 Bacteria 929
458 Ga0501080_0824171 3300049742 Bacteria 812
459 Ga0501080_0954959 3300049742 Bacteria 745
460 Ga0501081_0019909 3300049743 Bacteria 4470
461 Ga0501083_0041496 3300049744 Bacteria 3120
462 Ga0501083_0134146 3300049744 Bacteria 1623
463 Ga0501035_0000967 3300049822 Bacteria 30354
464 Ga0501035_0029308 3300049822 Bacteria 5019
465 Ga0501035_0072397 3300049822 Bacteria 3050
466 Ga0501035_0315065 3300049822 Bacteria 1315
467 Ga0501035_0368998 3300049822 Bacteria 1198
468 Ga0501044_0016858 3300049823 Bacteria 7837
469 Ga0501044_0039386 3300049823 Bacteria 4931
470 Ga0501044_0047280 3300049823 Bacteria 4450
471 Ga0501044_0153823 3300049823 Bacteria 2281
472 Ga0501044_0169789 3300049823 Bacteria 2153
473 Ga0501044_0242275 3300049823 Bacteria 1746
474 Ga0501044_0449742 3300049823 Bacteria 1195
475 Ga0501044_0640726 3300049823 Bacteria 952
476 Ga0501044_0803328 3300049823 Bacteria 820
477 Ga0501045_0017582 3300049824 Bacteria 5077
478 Ga0501045_0063864 3300049824 Bacteria 2702
479 Ga0501045_0139254 3300049824 Bacteria 1804
480 nmdc:mga09592_267408_c1 3300050508 Bacteria 1483
481 nmdc:mga0rr50_131718_c1 3300050513 Bacteria 2003
482 nmdc:mga08x19_25132_c1 3300050514 Bacteria 3709
483 Ga0495655_0334615 3300053083 Bacteria 527
484 Ga0500644_0118355 3300053088 Bacteria 1029
485 Ga0500646_0007308 3300053090 Bacteria 2822
486 Ga0500651_0772833 3300053093 Bacteria 509
487 Ga0500594_0059405 3300053118 Bacteria 1098
488 Ga0500597_000799 3300053120 Bacteria 7167
489 Ga0500642_0000378 3300053130 Bacteria 14992
490 Ga0500658_0295296 3300053134 Bacteria 745
491 Ga0500568_0002415 3300053139 Bacteria 11014
492 Ga0500568_0002932 3300053139 Bacteria 9780
493 Ga0500577_0051215 3300053142 Bacteria 1552
494 Ga0500577_0057970 3300053142 Bacteria 1480
495 Ga0500588_0001270 3300053146 Bacteria 4716
496 Ga0501084_0266110 3300054114 Bacteria 1447
497 Ga0501084_0316722 3300054114 Bacteria 1318
498 Ga0501082_0069588 3300060353 Bacteria 3030
499 Ga0501082_0101875 3300060353 Bacteria 2484
500 Ga0501082_0290871 3300060353 Bacteria 1422
501 Ga0530510_0043773 3300061734 Bacteria 3234
502 Ga0530510_0465507 3300061734 Bacteria 957

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041456 Ga0451795_1615648 Ga0451795_1615648_80_433 114
2 3300010375 Ga0105239_12140403 Ga0105239_121404032 115
3 3300025939 Ga0207665_10151107 Ga0207665_101511072 119
4 3300005328 Ga0070676_10008008 Ga0070676_100080084 122
5 3300005333 Ga0070677_10285376 Ga0070677_102853761 122
6 3300005353 Ga0070669_100015224 Ga0070669_1000152247 122
7 3300005434 Ga0070709_10004644 Ga0070709_100046448 122
8 3300005435 Ga0070714_100013475 Ga0070714_1000134755 122
9 3300005436 Ga0070713_100054871 Ga0070713_1000548712 122
10 3300005439 Ga0070711_100025780 Ga0070711_1000257802 122
11 3300005459 Ga0068867_100017466 Ga0068867_1000174667 122
12 3300005467 Ga0070706_100000058 Ga0070706_10000005874 122
13 3300005468 Ga0070707_100043874 Ga0070707_1000438746 122
14 3300005471 Ga0070698_100337860 Ga0070698_1003378601 122
15 3300005518 Ga0070699_100530040 Ga0070699_1005300402 122
16 3300005536 Ga0070697_100001145 Ga0070697_1000011457 122
17 3300005547 Ga0070693_100256634 Ga0070693_1002566342 122
18 3300005578 Ga0068854_100376644 Ga0068854_1003766442 122
19 3300005614 Ga0068856_100246415 Ga0068856_1002464152 122
20 3300005618 Ga0068864_101066575 Ga0068864_1010665752 122
21 3300005840 Ga0068870_10410425 Ga0068870_104104252 122
22 3300006028 Ga0070717_10028532 Ga0070717_100285326 122
23 3300006028 Ga0070717_10549398 Ga0070717_105493982 122
24 3300006844 Ga0075428_101249557 Ga0075428_1012495571 122
25 3300006880 Ga0075429_101910930 Ga0075429_1019109301 122
26 3300006881 Ga0068865_100089104 Ga0068865_1000891043 122
27 3300006914 Ga0075436_100066705 Ga0075436_1000667052 122
28 3300007076 Ga0075435_100143968 Ga0075435_1001439682 122
29 3300010375 Ga0105239_10469927 Ga0105239_104699273 122
30 3300011119 Ga0105246_10635144 Ga0105246_106351442 122
31 3300021441 Ga0213871_10010854 Ga0213871_100108542 122
32 3300025893 Ga0207682_10360128 Ga0207682_103601281 122
33 3300025904 Ga0207647_10012642 Ga0207647_100126422 122
34 3300025906 Ga0207699_11341596 Ga0207699_113415961 122
35 3300025907 Ga0207645_10013081 Ga0207645_100130816 122
36 3300025908 Ga0207643_10183450 Ga0207643_101834502 122
37 3300025910 Ga0207684_10000066 Ga0207684_1000006648 122
38 3300025915 Ga0207693_10076182 Ga0207693_100761822 122
39 3300025916 Ga0207663_10113142 Ga0207663_101131422 122
40 3300025922 Ga0207646_10040894 Ga0207646_100408943 122
41 3300025923 Ga0207681_10006303 Ga0207681_100063035 122
42 3300025928 Ga0207700_10805783 Ga0207700_108057832 122
43 3300025928 Ga0207700_10823655 Ga0207700_108236552 122
44 3300025929 Ga0207664_10010563 Ga0207664_100105631 122
45 3300025937 Ga0207669_10357641 Ga0207669_103576412 122
46 3300025938 Ga0207704_10047183 Ga0207704_100471833 122
47 3300025939 Ga0207665_10009764 Ga0207665_100097643 122
48 3300025940 Ga0207691_10234229 Ga0207691_102342292 122
49 3300025945 Ga0207679_10176541 Ga0207679_101765413 122
50 3300025961 Ga0207712_10243634 Ga0207712_102436342 122
51 3300026023 Ga0207677_10042234 Ga0207677_100422341 122
52 3300026035 Ga0207703_10226616 Ga0207703_102266163 122
53 3300026089 Ga0207648_10015990 Ga0207648_100159906 122
54 3300026118 Ga0207675_100408609 Ga0207675_1004086092 122
55 3300039438 Ga0436360_0102030 Ga0436360_0102030_1834_2214 122
56 3300039438 Ga0436360_0609938 Ga0436360_0609938_310_690 122
57 3300039450 Ga0436363_0166237 Ga0436363_0166237_1030_1410 122
58 3300042461 Ga0439460_0027389 Ga0439460_0027389_701_1102 122
59 3300044694 Ga0466963_0927802 Ga0466963_0927802_126_506 122
60 3300048903 Ga0496100_0339560 Ga0496100_0339560_283_663 122
61 3300048904 Ga0496101_0530091 Ga0496101_0530091_88_468 122
62 3300048905 Ga0496102_0166195 Ga0496102_0166195_90_470 122
63 3300048906 Ga0496103_0037210 Ga0496103_0037210_2412_2792 122
64 3300048907 Ga0496104_0017876 Ga0496104_0017876_5232_5612 122
65 3300048909 Ga0496106_0792507 Ga0496106_0792507_338_718 122
66 3300048921 Ga0496118_0016719 Ga0496118_0016719_5017_5397 122
67 3300048928 Ga0496125_0107607 Ga0496125_0107607_1431_1811 122
68 3300050513 nmdc:mga0rr50_131718_c1 nmdc:mga0rr50_131718_c1_408_788 122
69 3300050514 nmdc:mga08x19_25132_c1 nmdc:mga08x19_25132_c1_523_903 122
70 3300003215 JGI25153J46596_10000103 JGI25153J46596_1000010374 123
71 3300003320 rootH2_10223466 rootH2_102234663 123
72 3300003794 Ga0055531_10013363 Ga0055531_100133636 123
73 3300005327 Ga0070658_10104392 Ga0070658_101043926 123
74 3300005327 Ga0070658_10182910 Ga0070658_101829102 123
75 3300005328 Ga0070676_10008083 Ga0070676_100080834 123
76 3300005328 Ga0070676_10087186 Ga0070676_100871863 123
77 3300005330 Ga0070690_100081744 Ga0070690_1000817444 123
78 3300005331 Ga0070670_100219880 Ga0070670_1002198802 123
79 3300005334 Ga0068869_100048141 Ga0068869_1000481412 123
80 3300005334 Ga0068869_100051553 Ga0068869_1000515532 123
81 3300005334 Ga0068869_100817651 Ga0068869_1008176512 123
82 3300005334 Ga0068869_101700964 Ga0068869_1017009641 123
83 3300005335 Ga0070666_10075812 Ga0070666_100758122 123
84 3300005335 Ga0070666_10156717 Ga0070666_101567173 123
85 3300005340 Ga0070689_100141210 Ga0070689_1001412103 123
86 3300005344 Ga0070661_100173828 Ga0070661_1001738282 123
87 3300005344 Ga0070661_100240945 Ga0070661_1002409451 123
88 3300005345 Ga0070692_10153184 Ga0070692_101531843 123
89 3300005347 Ga0070668_100012560 Ga0070668_1000125602 123
90 3300005347 Ga0070668_100107357 Ga0070668_1001073573 123
91 3300005353 Ga0070669_100391347 Ga0070669_1003913473 123
92 3300005355 Ga0070671_100292831 Ga0070671_1002928312 123
93 3300005355 Ga0070671_100299690 Ga0070671_1002996901 123
94 3300005356 Ga0070674_100006500 Ga0070674_10000650013 123
95 3300005356 Ga0070674_100626668 Ga0070674_1006266681 123
96 3300005364 Ga0070673_100173654 Ga0070673_1001736543 123
97 3300005364 Ga0070673_100192265 Ga0070673_1001922653 123
98 3300005364 Ga0070673_101593826 Ga0070673_1015938261 123
99 3300005366 Ga0070659_101615106 Ga0070659_1016151061 123
100 3300005367 Ga0070667_100001062 Ga0070667_1000010622 123
101 3300005367 Ga0070667_100005234 Ga0070667_1000052345 123
102 3300005367 Ga0070667_100173857 Ga0070667_1001738572 123
103 3300005367 Ga0070667_100343375 Ga0070667_1003433752 123
104 3300005367 Ga0070667_100651403 Ga0070667_1006514032 123
105 3300005435 Ga0070714_100000073 Ga0070714_10000007391 123
106 3300005437 Ga0070710_11060481 Ga0070710_110604811 123
107 3300005445 Ga0070708_100001533 Ga0070708_1000015334 123
108 3300005455 Ga0070663_100000389 Ga0070663_1000003893 123
109 3300005455 Ga0070663_100027054 Ga0070663_1000270545 123
110 3300005455 Ga0070663_100074462 Ga0070663_1000744622 123
111 3300005455 Ga0070663_100086472 Ga0070663_1000864723 123
112 3300005456 Ga0070678_100052300 Ga0070678_1000523006 123
113 3300005457 Ga0070662_100029177 Ga0070662_1000291774 123
114 3300005457 Ga0070662_100036609 Ga0070662_1000366093 123
115 3300005458 Ga0070681_10692501 Ga0070681_106925012 123
116 3300005459 Ga0068867_100003306 Ga0068867_1000033066 123
117 3300005518 Ga0070699_100017797 Ga0070699_1000177976 123
118 3300005535 Ga0070684_101077929 Ga0070684_1010779292 123
119 3300005536 Ga0070697_101209934 Ga0070697_1012099341 123
120 3300005539 Ga0068853_100004116 Ga0068853_10000411610 123
121 3300005539 Ga0068853_100195713 Ga0068853_1001957133 123
122 3300005539 Ga0068853_101635909 Ga0068853_1016359091 123
123 3300005539 Ga0068853_102475103 Ga0068853_1024751031 123
124 3300005543 Ga0070672_100560687 Ga0070672_1005606873 123
125 3300005547 Ga0070693_100262915 Ga0070693_1002629152 123
126 3300005548 Ga0070665_100000100 Ga0070665_10000010060 123
127 3300005548 Ga0070665_100052574 Ga0070665_1000525744 123
128 3300005548 Ga0070665_100076196 Ga0070665_1000761964 123
129 3300005563 Ga0068855_100426686 Ga0068855_1004266862 123
130 3300005564 Ga0070664_100656920 Ga0070664_1006569202 123
131 3300005577 Ga0068857_100548740 Ga0068857_1005487402 123
132 3300005578 Ga0068854_100169116 Ga0068854_1001691164 123
133 3300005578 Ga0068854_101135256 Ga0068854_1011352562 123
134 3300005578 Ga0068854_101391879 Ga0068854_1013918791 123
135 3300005614 Ga0068856_100102161 Ga0068856_1001021614 123
136 3300005614 Ga0068856_101121933 Ga0068856_1011219332 123
137 3300005616 Ga0068852_100013930 Ga0068852_1000139308 123
138 3300005616 Ga0068852_100136246 Ga0068852_1001362462 123
139 3300005616 Ga0068852_100372203 Ga0068852_1003722032 123
140 3300005617 Ga0068859_100001272 Ga0068859_1000012724 123
141 3300005617 Ga0068859_100015903 Ga0068859_1000159039 123
142 3300005618 Ga0068864_100059009 Ga0068864_1000590094 123
143 3300005618 Ga0068864_100231337 Ga0068864_1002313374 123
144 3300005719 Ga0068861_100097778 Ga0068861_1000977783 123
145 3300005834 Ga0068851_10053881 Ga0068851_100538813 123
146 3300005834 Ga0068851_10086384 Ga0068851_100863842 123
147 3300005841 Ga0068863_100129228 Ga0068863_1001292284 123
148 3300005841 Ga0068863_102020141 Ga0068863_1020201411 123
149 3300005842 Ga0068858_100010674 Ga0068858_10001067414 123
150 3300005843 Ga0068860_100135206 Ga0068860_1001352063 123
151 3300005843 Ga0068860_100559956 Ga0068860_1005599562 123
152 3300005843 Ga0068860_100801035 Ga0068860_1008010352 123
153 3300005843 Ga0068860_100937325 Ga0068860_1009373252 123
154 3300005844 Ga0068862_100005379 Ga0068862_1000053795 123
155 3300005844 Ga0068862_100013778 Ga0068862_1000137782 123
156 3300005844 Ga0068862_100056017 Ga0068862_1000560172 123
157 3300005844 Ga0068862_100157790 Ga0068862_1001577904 123
158 3300005844 Ga0068862_100967592 Ga0068862_1009675922 123
159 3300005983 Ga0081540_1014464 Ga0081540_10144643 123
160 3300006237 Ga0097621_100078685 Ga0097621_1000786853 123
161 3300006237 Ga0097621_100569974 Ga0097621_1005699742 123
162 3300006237 Ga0097621_100832440 Ga0097621_1008324402 123
163 3300006358 Ga0068871_100262909 Ga0068871_1002629093 123
164 3300006358 Ga0068871_100716355 Ga0068871_1007163552 123
165 3300006880 Ga0075429_100059181 Ga0075429_1000591815 123
166 3300006880 Ga0075429_101461859 Ga0075429_1014618592 123
167 3300006881 Ga0068865_100032603 Ga0068865_1000326033 123
168 3300006881 Ga0068865_100222447 Ga0068865_1002224471 123
169 3300006931 Ga0097620_100001272 Ga0097620_1000012724 123
170 3300006931 Ga0097620_100015903 Ga0097620_1000159036 123
171 3300009093 Ga0105240_10485930 Ga0105240_104859302 123
172 3300009093 Ga0105240_11054212 Ga0105240_110542122 123
173 3300009093 Ga0105240_11606798 Ga0105240_116067981 123
174 3300009098 Ga0105245_11055971 Ga0105245_110559712 123
175 3300009101 Ga0105247_10084613 Ga0105247_100846132 123
176 3300009174 Ga0105241_10874044 Ga0105241_108740442 123
177 3300009174 Ga0105241_11086475 Ga0105241_110864751 123
178 3300009176 Ga0105242_10668701 Ga0105242_106687012 123
179 3300009176 Ga0105242_12951934 Ga0105242_129519341 123
180 3300009177 Ga0105248_10005464 Ga0105248_100054644 123
181 3300009177 Ga0105248_10043012 Ga0105248_100430125 123
182 3300009177 Ga0105248_10226740 Ga0105248_102267403 123
183 3300009177 Ga0105248_11871663 Ga0105248_118716632 123
184 3300009545 Ga0105237_10005712 Ga0105237_100057123 123
185 3300009545 Ga0105237_10335188 Ga0105237_103351881 123
186 3300009545 Ga0105237_10395050 Ga0105237_103950502 123
187 3300009545 Ga0105237_12391829 Ga0105237_123918291 123
188 3300009551 Ga0105238_10280086 Ga0105238_102800862 123
189 3300009551 Ga0105238_11785563 Ga0105238_117855631 123
190 3300009551 Ga0105238_12002177 Ga0105238_120021771 123
191 3300009551 Ga0105238_12816439 Ga0105238_128164391 123
192 3300009553 Ga0105249_10000803 Ga0105249_100008033 123
193 3300009553 Ga0105249_10021446 Ga0105249_100214462 123
194 3300009553 Ga0105249_10093401 Ga0105249_100934013 123
195 3300009553 Ga0105249_10903928 Ga0105249_109039282 123
196 3300009982 Ga0105147_103763 Ga0105147_1037631 123
197 3300010375 Ga0105239_10000033 Ga0105239_10000033176 123
198 3300010375 Ga0105239_10077609 Ga0105239_100776094 123
199 3300010375 Ga0105239_10117858 Ga0105239_101178583 123
200 3300010375 Ga0105239_10172090 Ga0105239_101720904 123
201 3300013100 Ga0157373_10791042 Ga0157373_107910422 123
202 3300013102 Ga0157371_10198496 Ga0157371_101984962 123
203 3300013102 Ga0157371_10325502 Ga0157371_103255022 123
204 3300013102 Ga0157371_11125012 Ga0157371_111250122 123
205 3300013104 Ga0157370_11573633 Ga0157370_115736332 123
206 3300013105 Ga0157369_10599383 Ga0157369_105993832 123
207 3300013296 Ga0157374_10344405 Ga0157374_103444052 123
208 3300013296 Ga0157374_10350999 Ga0157374_103509992 123
209 3300013297 Ga0157378_10302918 Ga0157378_103029182 123
210 3300013306 Ga0163162_10000716 Ga0163162_100007167 123
211 3300013306 Ga0163162_10323223 Ga0163162_103232233 123
212 3300013307 Ga0157372_10029438 Ga0157372_100294383 123
213 3300013307 Ga0157372_10054298 Ga0157372_100542986 123
214 3300013307 Ga0157372_10434263 Ga0157372_104342632 123
215 3300013308 Ga0157375_10160997 Ga0157375_101609973 123
216 3300013308 Ga0157375_10317538 Ga0157375_103175383 123
217 3300013308 Ga0157375_10968507 Ga0157375_109685072 123
218 3300014325 Ga0163163_10147637 Ga0163163_101476373 123
219 3300014325 Ga0163163_10215573 Ga0163163_102155733 123
220 3300014326 Ga0157380_12340575 Ga0157380_123405752 123
221 3300014968 Ga0157379_11069203 Ga0157379_110692032 123
222 3300014969 Ga0157376_10034293 Ga0157376_100342934 123
223 3300014969 Ga0157376_11067586 Ga0157376_110675862 123
224 3300024227 Ga0228598_1007421 Ga0228598_10074212 123
225 3300025297 Ga0209758_1000239 Ga0209758_100023995 123
226 3300025297 Ga0209758_1019994 Ga0209758_10199942 123
227 3300025298 Ga0209050_1012953 Ga0209050_10129535 123
228 3300025304 Ga0209257_1001119 Ga0209257_100111938 123
229 3300025321 Ga0207656_10082737 Ga0207656_100827372 123
230 3300025321 Ga0207656_10735679 Ga0207656_107356791 123
231 3300025893 Ga0207682_10248914 Ga0207682_102489142 123
232 3300025903 Ga0207680_10615059 Ga0207680_106150592 123
233 3300025904 Ga0207647_10006826 Ga0207647_100068266 123
234 3300025907 Ga0207645_10079916 Ga0207645_100799164 123
235 3300025909 Ga0207705_10196778 Ga0207705_101967782 123
236 3300025912 Ga0207707_10257289 Ga0207707_102572892 123
237 3300025913 Ga0207695_10000322 Ga0207695_1000032217 123
238 3300025913 Ga0207695_10003273 Ga0207695_1000327316 123
239 3300025913 Ga0207695_10024662 Ga0207695_100246622 123
240 3300025913 Ga0207695_10221507 Ga0207695_102215071 123
241 3300025913 Ga0207695_10750031 Ga0207695_107500311 123
242 3300025914 Ga0207671_10006234 Ga0207671_100062344 123
243 3300025914 Ga0207671_10503913 Ga0207671_105039132 123
244 3300025920 Ga0207649_10277425 Ga0207649_102774252 123
245 3300025920 Ga0207649_10906477 Ga0207649_109064771 123
246 3300025920 Ga0207649_11052275 Ga0207649_110522751 123
247 3300025923 Ga0207681_10003285 Ga0207681_100032854 123
248 3300025924 Ga0207694_10593962 Ga0207694_105939622 123
249 3300025925 Ga0207650_10159869 Ga0207650_101598692 123
250 3300025925 Ga0207650_10502008 Ga0207650_105020082 123
251 3300025925 Ga0207650_10657467 Ga0207650_106574672 123
252 3300025929 Ga0207664_10000041 Ga0207664_10000041142 123
253 3300025931 Ga0207644_10067208 Ga0207644_100672084 123
254 3300025932 Ga0207690_10000124 Ga0207690_1000012437 123
255 3300025932 Ga0207690_11030805 Ga0207690_110308051 123
256 3300025933 Ga0207706_10013686 Ga0207706_100136864 123
257 3300025933 Ga0207706_10025799 Ga0207706_100257992 123
258 3300025933 Ga0207706_10158551 Ga0207706_101585513 123
259 3300025934 Ga0207686_10841113 Ga0207686_108411131 123
260 3300025934 Ga0207686_11013429 Ga0207686_110134292 123
261 3300025937 Ga0207669_10281979 Ga0207669_102819792 123
262 3300025937 Ga0207669_10340976 Ga0207669_103409762 123
263 3300025938 Ga0207704_10154993 Ga0207704_101549932 123
264 3300025938 Ga0207704_10518912 Ga0207704_105189122 123
265 3300025938 Ga0207704_10709506 Ga0207704_107095062 123
266 3300025940 Ga0207691_10074226 Ga0207691_100742262 123
267 3300025941 Ga0207711_10000539 Ga0207711_1000053933 123
268 3300025941 Ga0207711_10356691 Ga0207711_103566912 123
269 3300025941 Ga0207711_10477453 Ga0207711_104774532 123
270 3300025942 Ga0207689_10002311 Ga0207689_1000231124 123
271 3300025942 Ga0207689_10234532 Ga0207689_102345322 123
272 3300025942 Ga0207689_10267644 Ga0207689_102676442 123
273 3300025945 Ga0207679_11075694 Ga0207679_110756942 123
274 3300025949 Ga0207667_10401151 Ga0207667_104011511 123
275 3300025960 Ga0207651_10153349 Ga0207651_101533495 123
276 3300025960 Ga0207651_10651854 Ga0207651_106518543 123
277 3300025961 Ga0207712_10013427 Ga0207712_100134272 123
278 3300025961 Ga0207712_10844905 Ga0207712_108449052 123
279 3300025961 Ga0207712_11366680 Ga0207712_113666801 123
280 3300025972 Ga0207668_10006717 Ga0207668_1000671711 123
281 3300025972 Ga0207668_10299007 Ga0207668_102990072 123
282 3300025981 Ga0207640_10339529 Ga0207640_103395292 123
283 3300025981 Ga0207640_10506574 Ga0207640_105065742 123
284 3300025981 Ga0207640_11125254 Ga0207640_111252541 123
285 3300025986 Ga0207658_10000626 Ga0207658_1000062621 123
286 3300025986 Ga0207658_10002618 Ga0207658_100026186 123
287 3300025986 Ga0207658_10044897 Ga0207658_100448972 123
288 3300025986 Ga0207658_10186291 Ga0207658_101862912 123
289 3300025986 Ga0207658_10582874 Ga0207658_105828742 123
290 3300025986 Ga0207658_11746866 Ga0207658_117468661 123
291 3300026023 Ga0207677_10093726 Ga0207677_100937265 123
292 3300026023 Ga0207677_12117209 Ga0207677_121172091 123
293 3300026035 Ga0207703_10936770 Ga0207703_109367702 123
294 3300026035 Ga0207703_11276670 Ga0207703_112766701 123
295 3300026035 Ga0207703_11378481 Ga0207703_113784811 123
296 3300026041 Ga0207639_10033535 Ga0207639_100335355 123
297 3300026041 Ga0207639_10830032 Ga0207639_108300321 123
298 3300026041 Ga0207639_11011426 Ga0207639_110114261 123
299 3300026067 Ga0207678_10001238 Ga0207678_100012383 123
300 3300026067 Ga0207678_10012496 Ga0207678_100124965 123
301 3300026067 Ga0207678_10029809 Ga0207678_100298097 123
302 3300026088 Ga0207641_10204328 Ga0207641_102043282 123
303 3300026088 Ga0207641_10356724 Ga0207641_103567242 123
304 3300026088 Ga0207641_11339686 Ga0207641_113396861 123
305 3300026089 Ga0207648_10006184 Ga0207648_100061844 123
306 3300026089 Ga0207648_10225319 Ga0207648_102253192 123
307 3300026095 Ga0207676_10075142 Ga0207676_100751422 123
308 3300026095 Ga0207676_10110297 Ga0207676_101102971 123
309 3300026095 Ga0207676_11972693 Ga0207676_119726931 123
310 3300026116 Ga0207674_10068204 Ga0207674_100682044 123
311 3300026118 Ga0207675_100035871 Ga0207675_1000358715 123
312 3300026121 Ga0207683_10014586 Ga0207683_100145863 123
313 3300026142 Ga0207698_10142480 Ga0207698_101424802 123
314 3300026142 Ga0207698_11460006 Ga0207698_114600062 123
315 3300028379 Ga0268266_10000017 Ga0268266_1000001788 123
316 3300028379 Ga0268266_10107210 Ga0268266_101072102 123
317 3300028379 Ga0268266_10206265 Ga0268266_102062653 123
318 3300028379 Ga0268266_10211662 Ga0268266_102116621 123
319 3300028380 Ga0268265_10001627 Ga0268265_100016275 123
320 3300028380 Ga0268265_10146403 Ga0268265_101464031 123
321 3300028380 Ga0268265_10273007 Ga0268265_102730073 123
322 3300028380 Ga0268265_10309638 Ga0268265_103096382 123
323 3300028381 Ga0268264_10427239 Ga0268264_104272393 123
324 3300028381 Ga0268264_10855046 Ga0268264_108550461 123
325 3300028381 Ga0268264_12106361 Ga0268264_121063612 123
326 3300031456 Ga0307513_10122955 Ga0307513_101229553 123
327 3300031456 Ga0307513_10498034 Ga0307513_104980341 123
328 3300031616 Ga0307508_10053263 Ga0307508_100532632 123
329 3300033180 Ga0307510_10576638 Ga0307510_105766381 123
330 3300037312 Ga0395899_0017037 Ga0395899_0017037_4734_5117 123
331 3300039437 Ga0436365_0438639 Ga0436365_0438639_2729_3109 123
332 3300039447 Ga0436361_0995122 Ga0436361_0995122_153_536 123
333 3300039450 Ga0436363_1473180 Ga0436363_1473180_130_510 123
334 3300041463 Ga0451804_1152559 Ga0451804_1152559_12_392 123
335 3300041498 Ga0451841_1356420 Ga0451841_1356420_330_746 123
336 3300041505 Ga0451849_0988518 Ga0451849_0988518_178_561 123
337 3300042000 Ga0439437_017097 Ga0439437_017097_375_758 123
338 3300042006 Ga0439432_206180 Ga0439432_206180_99_482 123
339 3300044672 Ga0466982_0000011 Ga0466982_0000011_32376_32762 123
340 3300044683 Ga0466965_0056345 Ga0466965_0056345_47_433 123
341 3300044684 Ga0466966_0003916 Ga0466966_0003916_7809_8195 123
342 3300046471 Ga0495650_0000134 Ga0495650_0000134_54669_55127 123
343 3300046519 Ga0495632_0293735 Ga0495632_0293735_157_546 123
344 3300046537 Ga0495598_0039599 Ga0495598_0039599_792_1175 123
345 3300046539 Ga0495621_0008227 Ga0495621_0008227_1831_2214 123
346 3300046539 Ga0495621_0286621 Ga0495621_0286621_269_652 123
347 3300046660 Ga0495625_0009321 Ga0495625_0009321_5064_5522 123
348 3300046694 Ga0495649_0000573 Ga0495649_0000573_26485_26895 123
349 3300047472 Ga0495686_0006212 Ga0495686_0006212_7529_7918 123
350 3300048903 Ga0496100_0453346 Ga0496100_0453346_232_615 123
351 3300048904 Ga0496101_0014930 Ga0496101_0014930_2758_3141 123
352 3300048906 Ga0496103_0209272 Ga0496103_0209272_240_638 123
353 3300048907 Ga0496104_0033922 Ga0496104_0033922_2845_3243 123
354 3300048908 Ga0496105_0044783 Ga0496105_0044783_26_424 123
355 3300048918 Ga0496115_0003509 Ga0496115_0003509_8193_8603 123
356 3300048918 Ga0496115_0023942 Ga0496115_0023942_1386_1769 123
357 3300048918 Ga0496115_0153987 Ga0496115_0153987_450_833 123
358 3300048919 Ga0496116_0142325 Ga0496116_0142325_452_850 123
359 3300048920 Ga0496117_0048897 Ga0496117_0048897_670_1053 123
360 3300048920 Ga0496117_0072463 Ga0496117_0072463_1359_1757 123
361 3300048921 Ga0496118_0008500 Ga0496118_0008500_3636_4034 123
362 3300048921 Ga0496118_0011773 Ga0496118_0011773_6616_6999 123
363 3300048922 Ga0496119_0000776 Ga0496119_0000776_38570_38968 123
364 3300048923 Ga0496120_0000874 Ga0496120_0000874_38570_38968 123
365 3300048924 Ga0496121_0160198 Ga0496121_0160198_221_604 123
366 3300048925 Ga0496122_0007208 Ga0496122_0007208_8531_8917 123
367 3300048926 Ga0496123_0002900 Ga0496123_0002900_16118_16504 123
368 3300048929 Ga0496126_0005390 Ga0496126_0005390_2652_3035 123
369 3300048929 Ga0496126_0191029 Ga0496126_0191029_65_475 123
370 3300048929 Ga0496126_0708902 Ga0496126_0708902_172_558 123
371 3300049568 Ga0501031_0087683 Ga0501031_0087683_422_811 123
372 3300049568 Ga0501031_0089563 Ga0501031_0089563_281_670 123
373 3300049569 Ga0501032_0016690 Ga0501032_0016690_4141_4530 123
374 3300049569 Ga0501032_0063172 Ga0501032_0063172_1268_1651 123
375 3300049569 Ga0501032_0075525 Ga0501032_0075525_826_1215 123
376 3300049570 Ga0501033_0003691 Ga0501033_0003691_8522_8911 123
377 3300049570 Ga0501033_0021629 Ga0501033_0021629_1278_1661 123
378 3300049570 Ga0501033_0323795 Ga0501033_0323795_34_423 123
379 3300049571 Ga0501034_0019035 Ga0501034_0019035_3351_3740 123
380 3300049571 Ga0501034_0474197 Ga0501034_0474197_567_950 123
381 3300049572 Ga0501036_0011209 Ga0501036_0011209_4507_4896 123
382 3300049572 Ga0501036_0057702 Ga0501036_0057702_2240_2629 123
383 3300049572 Ga0501036_0130130 Ga0501036_0130130_566_949 123
384 3300049573 Ga0501037_0028837 Ga0501037_0028837_2174_2563 123
385 3300049573 Ga0501037_0103873 Ga0501037_0103873_444_824 123
386 3300049573 Ga0501037_0173902 Ga0501037_0173902_615_998 123
387 3300049573 Ga0501037_0863824 Ga0501037_0863824_34_423 123
388 3300049574 Ga0501038_0025863 Ga0501038_0025863_2948_3337 123
389 3300049574 Ga0501038_0387838 Ga0501038_0387838_34_423 123
390 3300049575 Ga0501039_0013281 Ga0501039_0013281_1563_1952 123
391 3300049575 Ga0501039_0187938 Ga0501039_0187938_379_768 123
392 3300049575 Ga0501039_1235737 Ga0501039_1235737_46_426 123
393 3300049576 Ga0501040_0435785 Ga0501040_0435785_460_849 123
394 3300049577 Ga0501041_0121156 Ga0501041_0121156_990_1370 123
395 3300049578 Ga0501042_0424316 Ga0501042_0424316_464_853 123
396 3300049579 Ga0501043_0027454 Ga0501043_0027454_3858_4241 123
397 3300049579 Ga0501043_0138802 Ga0501043_0138802_210_653 123
398 3300049579 Ga0501043_0442242 Ga0501043_0442242_576_965 123
399 3300049579 Ga0501043_0507231 Ga0501043_0507231_409_798 123
400 3300049580 Ga0501046_0007041 Ga0501046_0007041_5758_6147 123
401 3300049580 Ga0501046_0091702 Ga0501046_0091702_1288_1677 123
402 3300049581 Ga0501047_0071111 Ga0501047_0071111_788_1171 123
403 3300049581 Ga0501047_0157450 Ga0501047_0157450_534_923 123
404 3300049581 Ga0501047_0194816 Ga0501047_0194816_431_811 123
405 3300049581 Ga0501047_0502958 Ga0501047_0502958_462_851 123
406 3300049581 Ga0501047_0755200 Ga0501047_0755200_309_698 123
407 3300049582 Ga0501048_0208506 Ga0501048_0208506_85_474 123
408 3300049582 Ga0501048_0224279 Ga0501048_0224279_283_672 123
409 3300049582 Ga0501048_0387841 Ga0501048_0387841_46_426 123
410 3300049583 Ga0501067_0052713 Ga0501067_0052713_335_724 123
411 3300049583 Ga0501067_0060768 Ga0501067_0060768_787_1176 123
412 3300049584 Ga0501068_0071918 Ga0501068_0071918_805_1194 123
413 3300049584 Ga0501068_0225676 Ga0501068_0225676_113_493 123
414 3300049585 Ga0501069_0028683 Ga0501069_0028683_286_675 123
415 3300049586 Ga0501070_0063367 Ga0501070_0063367_2026_2415 123
416 3300049586 Ga0501070_0229878 Ga0501070_0229878_750_1133 123
417 3300049586 Ga0501070_0411009 Ga0501070_0411009_45_434 123
418 3300049586 Ga0501070_0456505 Ga0501070_0456505_154_543 123
419 3300049586 Ga0501070_0555003 Ga0501070_0555003_80_460 123
420 3300049587 Ga0501071_0113753 Ga0501071_0113753_1204_1593 123
421 3300049587 Ga0501071_0246756 Ga0501071_0246756_907_1287 123
422 3300049587 Ga0501071_0565868 Ga0501071_0565868_407_796 123
423 3300049588 Ga0501072_0018149 Ga0501072_0018149_4566_4946 123
424 3300049588 Ga0501072_0447122 Ga0501072_0447122_518_907 123
425 3300049588 Ga0501072_0507028 Ga0501072_0507028_237_626 123
426 3300049589 Ga0501073_0034081 Ga0501073_0034081_2046_2435 123
427 3300049589 Ga0501073_0096935 Ga0501073_0096935_1594_1974 123
428 3300049589 Ga0501073_0167916 Ga0501073_0167916_647_1027 123
429 3300049589 Ga0501073_0236729 Ga0501073_0236729_148_591 123
430 3300049590 Ga0501074_0015472 Ga0501074_0015472_4568_4957 123
431 3300049590 Ga0501074_0374967 Ga0501074_0374967_430_810 123
432 3300049591 Ga0501075_0015011 Ga0501075_0015011_3544_3924 123
433 3300049592 Ga0501076_0018645 Ga0501076_0018645_390_770 123
434 3300049592 Ga0501076_0228232 Ga0501076_0228232_38_427 123
435 3300049593 Ga0501077_0008086 Ga0501077_0008086_3842_4222 123
436 3300049593 Ga0501077_0764171 Ga0501077_0764171_144_533 123
437 3300049741 Ga0501079_0070790 Ga0501079_0070790_432_821 123
438 3300049741 Ga0501079_0373890 Ga0501079_0373890_580_969 123
439 3300049741 Ga0501079_0736142 Ga0501079_0736142_23_403 123
440 3300049742 Ga0501080_0014008 Ga0501080_0014008_4538_4927 123
441 3300049742 Ga0501080_0101040 Ga0501080_0101040_911_1291 123
442 3300049742 Ga0501080_0483150 Ga0501080_0483150_341_721 123
443 3300049742 Ga0501080_0593891 Ga0501080_0593891_46_429 123
444 3300049742 Ga0501080_0824171 Ga0501080_0824171_128_517 123
445 3300049742 Ga0501080_0954959 Ga0501080_0954959_200_583 123
446 3300049743 Ga0501081_0019909 Ga0501081_0019909_2831_3211 123
447 3300049744 Ga0501083_0041496 Ga0501083_0041496_1999_2388 123
448 3300049744 Ga0501083_0134146 Ga0501083_0134146_85_474 123
449 3300049822 Ga0501035_0029308 Ga0501035_0029308_4220_4603 123
450 3300049822 Ga0501035_0315065 Ga0501035_0315065_540_929 123
451 3300049822 Ga0501035_0368998 Ga0501035_0368998_671_1060 123
452 3300049823 Ga0501044_0016858 Ga0501044_0016858_5580_5969 123
453 3300049823 Ga0501044_0039386 Ga0501044_0039386_1435_1818 123
454 3300049823 Ga0501044_0047280 Ga0501044_0047280_660_1049 123
455 3300049823 Ga0501044_0169789 Ga0501044_0169789_352_732 123
456 3300049823 Ga0501044_0242275 Ga0501044_0242275_1223_1612 123
457 3300049823 Ga0501044_0449742 Ga0501044_0449742_780_1169 123
458 3300049823 Ga0501044_0803328 Ga0501044_0803328_339_719 123
459 3300049824 Ga0501045_0017582 Ga0501045_0017582_1890_2279 123
460 3300049824 Ga0501045_0063864 Ga0501045_0063864_995_1375 123
461 3300049824 Ga0501045_0139254 Ga0501045_0139254_1385_1774 123
462 3300050508 nmdc:mga09592_267408_c1 nmdc:mga09592_267408_c1_805_1182 123
463 3300053083 Ga0495655_0334615 Ga0495655_0334615_90_473 123
464 3300053088 Ga0500644_0118355 Ga0500644_0118355_586_966 123
465 3300053090 Ga0500646_0007308 Ga0500646_0007308_84_464 123
466 3300053093 Ga0500651_0772833 Ga0500651_0772833_118_498 123
467 3300053118 Ga0500594_0059405 Ga0500594_0059405_621_1001 123
468 3300053120 Ga0500597_000799 Ga0500597_000799_3304_3693 123
469 3300053130 Ga0500642_0000378 Ga0500642_0000378_10971_11351 123
470 3300053134 Ga0500658_0295296 Ga0500658_0295296_203_583 123
471 3300053139 Ga0500568_0002415 Ga0500568_0002415_10479_10862 123
472 3300053139 Ga0500568_0002932 Ga0500568_0002932_5161_5541 123
473 3300053142 Ga0500577_0051215 Ga0500577_0051215_986_1366 123
474 3300053142 Ga0500577_0057970 Ga0500577_0057970_530_910 123
475 3300053146 Ga0500588_0001270 Ga0500588_0001270_516_896 123
476 3300054114 Ga0501084_0266110 Ga0501084_0266110_221_610 123
477 3300060353 Ga0501082_0069588 Ga0501082_0069588_1885_2265 123
478 3300060353 Ga0501082_0101875 Ga0501082_0101875_907_1296 123
479 3300060353 Ga0501082_0290871 Ga0501082_0290871_952_1341 123
480 3300061734 Ga0530510_0043773 Ga0530510_0043773_1330_1710 123
481 3300061734 Ga0530510_0465507 Ga0530510_0465507_473_862 123
482 3300001915 JGI24741J21665_1000664 JGI24741J21665_10006645 124
483 3300031911 Ga0307412_10653250 Ga0307412_106532501 124
484 3300048907 Ga0496104_0672802 Ga0496104_0672802_405_806 124
485 3300049571 Ga0501034_1132271 Ga0501034_1132271_229_603 124
486 3300049572 Ga0501036_0307928 Ga0501036_0307928_885_1259 124
487 3300049573 Ga0501037_0186038 Ga0501037_0186038_811_1185 124
488 3300049574 Ga0501038_0031199 Ga0501038_0031199_4161_4535 124
489 3300049579 Ga0501043_0296442 Ga0501043_0296442_843_1217 124
490 3300049581 Ga0501047_0169697 Ga0501047_0169697_1603_1977 124
491 3300049581 Ga0501047_0742521 Ga0501047_0742521_193_567 124
492 3300049585 Ga0501069_0203422 Ga0501069_0203422_569_943 124
493 3300049586 Ga0501070_1202637 Ga0501070_1202637_61_435 124
494 3300049587 Ga0501071_1395877 Ga0501071_1395877_142_516 124
495 3300049589 Ga0501073_0222024 Ga0501073_0222024_801_1175 124
496 3300049590 Ga0501074_0007753 Ga0501074_0007753_1562_1936 124
497 3300049742 Ga0501080_0654275 Ga0501080_0654275_244_618 124
498 3300049822 Ga0501035_0000967 Ga0501035_0000967_1398_1772 124
499 3300049822 Ga0501035_0072397 Ga0501035_0072397_1562_1936 124
500 3300049823 Ga0501044_0153823 Ga0501044_0153823_634_1008 124
501 3300049823 Ga0501044_0640726 Ga0501044_0640726_147_521 124
502 3300054114 Ga0501084_0316722 Ga0501084_0316722_42_416 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

34

138

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rm3-assembly1.cif.gz_SE0 evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome 0.8971 85 108
1d1c-assembly1.cif.gz_A dictyostelium myosin s1dc (motor domain fragment) complexed with n-methyl-o-nitrophenyl aminoethyldiphosphate beryllium trifluoride. 0.8966 85 108
7b1a-assembly1.cif.gz_A myosin-ii-aa mutant motor domain 0.8852 85 108
3mjx-assembly1.cif.gz_A crystal structure of myosin-2 motor domain in complex with adp-metavanadate and blebbistatin 0.8813 85 108
3mnq-assembly1.cif.gz_A crystal structure of myosin-2 motor domain in complex with adp-metavanadate and resveratrol 0.8762 85 108
ID Description Score Start End Superfamily
af_Q8IIS3_1222_1271_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9347 85 108 2.30.30.60
af_P75783_574_621_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.899 85 108 2.30.30.60
af_A0A1D6LPC7_212_432_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8987 84 108 3.50.50.60
1d1cA01 Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal 0.8966 85 108 2.30.30.360
af_A0A0R4IJY6_29_78_2.30.30.360 Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal 0.8932 85 108 2.30.30.360
ID Description Score Start End GO Terms
AF-A0A4R6WB84-F1-model_v4 deleted 0.9641 74 108
AF-A0A7K0CTN1-F1-model_v4 Glyoxalase-like domain-containing protein 0.9604 63 110
AF-A0A848QBT6-F1-model_v4 deleted 0.9587 1 84
AF-A0A4R8FQV6-F1-model_v4 Glyoxalase-like domain-containing protein 0.9524 2 113
AF-A0A2W2E0A7-F1-model_v4 Glyoxalase 0.9494 65 111

Feature Viewer

pLDDT pTM Quality
92.36 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map