F455835

General Info

Members Datasets Scaffolds Average Seq Length
502 247 502 318

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10245185|Ga0114129_102451853
Length 360
Sequence MSETRKYDVVIIGAGPAGLAAALYAGRALLRTAVLERGVPGGELLNTEYLDDVPGFPKVLGRDLAKKYFEHAQEFGAEFKLGTAVQHVKKRASDGMFETRTYEDEVYESPAVIVTAGGTPLKLGIPGELEFAGRGVSYCAVCDGAFFKGLHVVVVGGGDAACEEAEYLTRHAAKVTLVHRRDKFRAAPVIQKRVLENPKIQVVLNTVTEEVLGNPLQGMTGVRVRDVVTGEAYVIEAQGLFVFIGFKPNTGVIADHYEHDAAGYVITDLAMHSSIPGLFVAGDMRAQLTRQVTTAQGDATTAAIAVYRYLAALRSGHPDPVRAILGDIGQPRPRAPEGEAARGGAEMYGQATDAPVLADR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 0.8
Rhizosphere 97.61
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10024344 3300003320 Bacteria 18765
2 rootH2_10226705 3300003320 Bacteria 3293
3 Ga0065715_10089824 3300005293 Bacteria 8404
4 Ga0070658_10002511 3300005327 Bacteria 15326
5 Ga0070676_10021705 3300005328 Bacteria 3595
6 Ga0070683_100001156 3300005329 Bacteria 19987
7 Ga0070683_100037621 3300005329 Bacteria 4430
8 Ga0070683_100185102 3300005329 Bacteria 1977
9 Ga0070690_100027311 3300005330 Bacteria 3528
10 Ga0070690_100145049 3300005330 Unclassified 1614
11 Ga0070680_100000815 3300005336 Bacteria 21971
12 Ga0070680_100042829 3300005336 Bacteria 3675
13 Ga0070680_100080911 3300005336 Bacteria 2680
14 Ga0070680_100210851 3300005336 Bacteria 1639
15 Ga0070682_100031260 3300005337 Bacteria 3219
16 Ga0070682_100077373 3300005337 Bacteria 2143
17 Ga0068868_100013098 3300005338 Bacteria 6073
18 Ga0068868_100021328 3300005338 Bacteria 4879
19 Ga0070660_100031785 3300005339 Bacteria 3967
20 Ga0070689_100000377 3300005340 Bacteria 26255
21 Ga0070689_100023307 3300005340 Bacteria 4633
22 Ga0070689_100370279 3300005340 Bacteria 1205
23 Ga0070691_10120180 3300005341 Eukaryota 1322
24 Ga0070687_100002219 3300005343 Bacteria 7198
25 Ga0070692_10053427 3300005345 Bacteria 2107
26 Ga0070675_100080356 3300005354 Bacteria 2718
27 Ga0070671_100064297 3300005355 Bacteria 3056
28 Ga0070674_100143580 3300005356 Bacteria 1794
29 Ga0070673_100031149 3300005364 Bacteria 4000
30 Ga0070673_100032670 3300005364 Bacteria 3922
31 Ga0070688_100004352 3300005365 Bacteria 7366
32 Ga0070709_10003533 3300005434 Bacteria 8398
33 Ga0070709_10109934 3300005434 Bacteria 1851
34 Ga0070714_100154291 3300005435 Bacteria 2072
35 Ga0070701_10022566 3300005438 Bacteria 3018
36 Ga0070705_100093985 3300005440 Unclassified 1876
37 Ga0070705_100157535 3300005440 Bacteria 1514
38 Ga0070705_100222704 3300005440 Bacteria 1307
39 Ga0070700_100038410 3300005441 Bacteria 2917
40 Ga0070700_100097047 3300005441 Bacteria 1935
41 Ga0070700_100210002 3300005441 Bacteria 1373
42 Ga0070694_100026867 3300005444 Bacteria 3734
43 Ga0070694_100036840 3300005444 Bacteria 3242
44 Ga0070694_100083785 3300005444 Bacteria 2223
45 Ga0070708_100000052 3300005445 Bacteria 78944
46 Ga0070708_100038839 3300005445 Bacteria 4162
47 Ga0070708_100296031 3300005445 Bacteria 1524
48 Ga0070663_100014388 3300005455 Bacteria 5079
49 Ga0070681_10007475 3300005458 Bacteria 10679
50 Ga0070681_10030063 3300005458 Bacteria 5451
51 Ga0070681_10033517 3300005458 Bacteria 5156
52 Ga0070681_10076298 3300005458 Bacteria 3310
53 Ga0070685_10003413 3300005466 Bacteria 8079
54 Ga0070706_100009071 3300005467 Bacteria 9260
55 Ga0070707_100000643 3300005468 Bacteria 34864
56 Ga0070698_100009811 3300005471 Bacteria 10235
57 Ga0070698_100074549 3300005471 Bacteria 3399
58 Ga0070699_100086298 3300005518 Bacteria 2739
59 Ga0070699_100091067 3300005518 Unclassified 2666
60 Ga0070699_100202173 3300005518 Bacteria 1767
61 Ga0070699_100297270 3300005518 Bacteria 1448
62 Ga0070699_100451858 3300005518 Bacteria 1165
63 Ga0070679_100003344 3300005530 Bacteria 14687
64 Ga0070679_100007354 3300005530 Bacteria 10291
65 Ga0070679_100031384 3300005530 Bacteria 5248
66 Ga0070679_100036611 3300005530 Bacteria 4870
67 Ga0070684_100001421 3300005535 Bacteria 17233
68 Ga0070684_100027764 3300005535 Bacteria 4780
69 Ga0068853_100009053 3300005539 Bacteria 8017
70 Ga0068853_100159083 3300005539 Bacteria 2037
71 Ga0070672_100140211 3300005543 Bacteria 1993
72 Ga0070686_100007615 3300005544 Bacteria 6048
73 Ga0070686_100290385 3300005544 Unclassified 1209
74 Ga0070695_100029760 3300005545 Bacteria 3395
75 Ga0070695_100464921 3300005545 Unclassified 972
76 Ga0070696_100035582 3300005546 Unclassified 3429
77 Ga0070665_100000045 3300005548 Bacteria 275023
78 Ga0070665_100123528 3300005548 Bacteria 2591
79 Ga0070704_100006109 3300005549 Bacteria 7070
80 Ga0070704_100084025 3300005549 Bacteria 2352
81 Ga0068855_100019669 3300005563 Bacteria 8110
82 Ga0068855_100060213 3300005563 Bacteria 4441
83 Ga0068855_100110940 3300005563 Bacteria 3148
84 Ga0068855_100169349 3300005563 Bacteria 2474
85 Ga0070664_100003668 3300005564 Bacteria 12368
86 Ga0068857_100010498 3300005577 Bacteria 8049
87 Ga0068857_100088995 3300005577 Bacteria 2762
88 Ga0068854_100125581 3300005578 Unclassified 1953
89 Ga0068856_100000701 3300005614 Bacteria 36336
90 Ga0068856_100006743 3300005614 Bacteria 11247
91 Ga0068856_100217727 3300005614 Bacteria 1925
92 Ga0068856_100232278 3300005614 Unclassified 1860
93 Ga0068856_100297833 3300005614 Bacteria 1630
94 Ga0068856_100755889 3300005614 Eukaryota 992
95 Ga0068852_100318538 3300005616 Unclassified 1510
96 Ga0068859_100004689 3300005617 Bacteria 13916
97 Ga0068859_100124606 3300005617 Bacteria 2645
98 Ga0068859_100159206 3300005617 Bacteria 2336
99 Ga0068859_100177842 3300005617 Bacteria 2210
100 Ga0068859_100269633 3300005617 Bacteria 1794
101 Ga0068859_100424615 3300005617 Unclassified 1426
102 Ga0068866_10019726 3300005718 Unclassified 3076
103 Ga0068863_100106640 3300005841 Bacteria 2666
104 Ga0068863_100289443 3300005841 Bacteria 1588
105 Ga0068858_100038552 3300005842 Bacteria 4433
106 Ga0068858_100081007 3300005842 Bacteria 3017
107 Ga0081455_10090619 3300005937 Bacteria 2478
108 Ga0068871_100165323 3300006358 Bacteria 1894
109 Ga0075428_100002152 3300006844 Bacteria 21278
110 Ga0075428_100607180 3300006844 Bacteria 1168
111 Ga0075430_100012550 3300006846 Bacteria 7214
112 Ga0075430_100085799 3300006846 Bacteria 2636
113 Ga0075431_100034199 3300006847 Bacteria 5237
114 Ga0075431_100042115 3300006847 Bacteria 4709
115 Ga0075431_100085275 3300006847 Bacteria 3260
116 Ga0075431_100090956 3300006847 Bacteria 3150
117 Ga0075431_100328194 3300006847 Bacteria 1542
118 Ga0075433_10033857 3300006852 Bacteria 4383
119 Ga0075434_100052826 3300006871 Bacteria 4038
120 Ga0075434_100286883 3300006871 Bacteria 1666
121 Ga0075429_100015562 3300006880 Bacteria 6591
122 Ga0075429_100115726 3300006880 Bacteria 2344
123 Ga0068865_100003126 3300006881 Bacteria 9904
124 Ga0075436_100012314 3300006914 Bacteria 5861
125 Ga0097620_100004689 3300006931 Bacteria 13916
126 Ga0097620_100124600 3300006931 Bacteria 2645
127 Ga0097620_100159201 3300006931 Bacteria 2336
128 Ga0097620_100177854 3300006931 Bacteria 2210
129 Ga0097620_100269648 3300006931 Bacteria 1794
130 Ga0097620_100424629 3300006931 Unclassified 1426
131 Ga0075435_100119799 3300007076 Bacteria 2196
132 Ga0105240_10002096 3300009093 Bacteria 32628
133 Ga0105240_10005312 3300009093 Bacteria 19215
134 Ga0105240_10007047 3300009093 Bacteria 16398
135 Ga0105240_10047126 3300009093 Bacteria 5456
136 Ga0105240_10277708 3300009093 Bacteria 1926
137 Ga0105240_10306650 3300009093 Bacteria 1814
138 Ga0105240_10452754 3300009093 Bacteria 1436
139 Ga0111539_10003561 3300009094 Bacteria 20533
140 Ga0111539_10008597 3300009094 Bacteria 12966
141 Ga0111539_10248487 3300009094 Bacteria 2071
142 Ga0111539_10332274 3300009094 Bacteria 1769
143 Ga0111539_10509049 3300009094 Unclassified 1402
144 Ga0105245_10028501 3300009098 Bacteria 4927
145 Ga0105245_10067177 3300009098 Bacteria 3247
146 Ga0105245_10077833 3300009098 Bacteria 3025
147 Ga0105245_10202836 3300009098 Bacteria 1905
148 Ga0114129_10050390 3300009147 Bacteria 5848
149 Ga0114129_10144091 3300009147 Bacteria 3264
150 Ga0114129_10245185 3300009147 Bacteria 2407
151 Ga0105248_10609313 3300009177 Bacteria 1232
152 Ga0105238_10001107 3300009551 Bacteria 27230
153 Ga0105238_10001809 3300009551 Bacteria 21424
154 Ga0105238_10019937 3300009551 Bacteria 6825
155 Ga0105238_10142891 3300009551 Bacteria 2370
156 Ga0105249_10260843 3300009553 Bacteria 1722
157 Ga0099796_10010569 3300010159 Unclassified 2542
158 Ga0157373_10144515 3300013100 Bacteria 1673
159 Ga0157371_10002989 3300013102 Bacteria 15706
160 Ga0157370_10015323 3300013104 Bacteria 7797
161 Ga0157370_10296115 3300013104 Unclassified 1494
162 Ga0157369_10033346 3300013105 Bacteria 5659
163 Ga0157374_10248809 3300013296 Bacteria 1749
164 Ga0157378_10084402 3300013297 Unclassified 2875
165 Ga0157378_10121905 3300013297 Bacteria 2404
166 Ga0157378_10215471 3300013297 Unclassified 1823
167 Ga0157378_10265074 3300013297 Bacteria 1650
168 Ga0157372_10006078 3300013307 Bacteria 12828
169 Ga0157372_10007050 3300013307 Bacteria 11970
170 Ga0157372_10070191 3300013307 Bacteria 3941
171 Ga0157372_10119837 3300013307 Bacteria 3021
172 Ga0157372_10382736 3300013307 Bacteria 1639
173 Ga0157375_10000129 3300013308 Bacteria 75013
174 Ga0157375_10833496 3300013308 Bacteria 1070
175 Ga0163163_10000260 3300014325 Bacteria 53427
176 Ga0163163_10589864 3300014325 Unclassified 1174
177 Ga0157380_10465889 3300014326 Bacteria 1218
178 Ga0157380_10491275 3300014326 Bacteria 1190
179 Ga0207642_10114265 3300025899 Bacteria 1380
180 Ga0207685_10030356 3300025905 Bacteria 1923
181 Ga0207645_10001868 3300025907 Bacteria 17003
182 Ga0207705_10000748 3300025909 Bacteria 26723
183 Ga0207705_10012449 3300025909 Bacteria 6145
184 Ga0207707_10003264 3300025912 Bacteria 14408
185 Ga0207707_10075934 3300025912 Bacteria 2932
186 Ga0207707_10188574 3300025912 Unclassified 1799
187 Ga0207695_10005634 3300025913 Bacteria 16526
188 Ga0207695_10011407 3300025913 Bacteria 10772
189 Ga0207695_10175746 3300025913 Bacteria 2064
190 Ga0207660_10013298 3300025917 Bacteria 5394
191 Ga0207657_10001459 3300025919 Bacteria 25313
192 Ga0207652_10003161 3300025921 Bacteria 13717
193 Ga0207652_10004935 3300025921 Bacteria 10798
194 Ga0207652_10041375 3300025921 Bacteria 3917
195 Ga0207652_10042192 3300025921 Bacteria 3881
196 Ga0207652_10316075 3300025921 Unclassified 1410
197 Ga0207652_10317147 3300025921 Unclassified 1407
198 Ga0207646_10003903 3300025922 Bacteria 16554
199 Ga0207646_10086653 3300025922 Bacteria 2802
200 Ga0207694_10002160 3300025924 Bacteria 16167
201 Ga0207694_10002636 3300025924 Bacteria 14541
202 Ga0207694_10070300 3300025924 Bacteria 2735
203 Ga0207687_10205864 3300025927 Bacteria 1541
204 Ga0207700_10086357 3300025928 Unclassified 2465
205 Ga0207664_10134482 3300025929 Bacteria 2085
206 Ga0207706_10003975 3300025933 Bacteria 14004
207 Ga0207670_10000636 3300025936 Bacteria 18770
208 Ga0207670_10035521 3300025936 Bacteria 3233
209 Ga0207670_10129896 3300025936 Bacteria 1844
210 Ga0207665_10000466 3300025939 Bacteria 27684
211 Ga0207691_10142575 3300025940 Bacteria 2110
212 Ga0207711_10491754 3300025941 Bacteria 1143
213 Ga0207661_10000912 3300025944 Bacteria 19404
214 Ga0207661_10108175 3300025944 Bacteria 2347
215 Ga0207661_10415029 3300025944 Bacteria 1222
216 Ga0207667_10006549 3300025949 Bacteria 14087
217 Ga0207667_10147615 3300025949 Bacteria 2420
218 Ga0207651_10051090 3300025960 Bacteria 2811
219 Ga0207640_10011702 3300025981 Unclassified 4973
220 Ga0207658_10193542 3300025986 Unclassified 1693
221 Ga0207703_10066878 3300026035 Bacteria 2957
222 Ga0207703_10075000 3300026035 Bacteria 2802
223 Ga0207678_10001595 3300026067 Bacteria 20860
224 Ga0207708_10035394 3300026075 Unclassified 3800
225 Ga0207708_10047911 3300026075 Bacteria 3252
226 Ga0207708_10264616 3300026075 Bacteria 1389
227 Ga0207702_10001596 3300026078 Bacteria 22428
228 Ga0207702_10362856 3300026078 Bacteria 1389
229 Ga0207702_10445047 3300026078 Unclassified 1256
230 Ga0207641_10144082 3300026088 Bacteria 2153
231 Ga0207648_10016265 3300026089 Bacteria 6805
232 Ga0207674_10025046 3300026116 Bacteria 6367
233 Ga0207674_10164888 3300026116 Bacteria 2170
234 Ga0207683_10022643 3300026121 Bacteria 5396
235 Ga0207698_10069034 3300026142 Bacteria 2793
236 Ga0207428_10020930 3300027907 Bacteria 5545
237 Ga0268266_10000251 3300028379 Bacteria 91204
238 Ga0268266_10095075 3300028379 Bacteria 2617
239 Ga0268264_10209508 3300028381 Bacteria 1788
240 Ga0265337_1000352 3300028556 Bacteria 24577
241 Ga0265337_1000880 3300028556 Bacteria 15778
242 Ga0265337_1002876 3300028556 Bacteria 7686
243 Ga0265337_1016971 3300028556 Bacteria 2343
244 Ga0265337_1029658 3300028556 Bacteria 1634
245 Ga0265319_1000027 3300028563 Bacteria 139786
246 Ga0265319_1026646 3300028563 Bacteria 2056
247 Ga0265318_10019738 3300028577 Unclassified 2730
248 Ga0265323_10000166 3300028653 Bacteria 39420
249 Ga0265322_10014146 3300028654 Bacteria 2308
250 Ga0265322_10032772 3300028654 Bacteria 1482
251 Ga0265336_10007147 3300028666 Bacteria 3986
252 Ga0265336_10008898 3300028666 Bacteria 3499
253 Ga0265338_10000220 3300028800 Bacteria 106037
254 Ga0265338_10000808 3300028800 Bacteria 52850
255 Ga0265338_10000831 3300028800 Bacteria 52074
256 Ga0265338_10001318 3300028800 Bacteria 40654
257 Ga0265338_10001756 3300028800 Bacteria 34249
258 Ga0265338_10001835 3300028800 Bacteria 33316
259 Ga0265338_10002037 3300028800 Bacteria 31291
260 Ga0265338_10003736 3300028800 Bacteria 21165
261 Ga0265338_10008664 3300028800 Bacteria 12304
262 Ga0265338_10012305 3300028800 Bacteria 9765
263 Ga0265338_10014615 3300028800 Bacteria 8712
264 Ga0265338_10017506 3300028800 Bacteria 7720
265 Ga0265338_10025500 3300028800 Bacteria 5997
266 Ga0265338_10025785 3300028800 Bacteria 5953
267 Ga0265338_10030830 3300028800 Bacteria 5270
268 Ga0265338_10036826 3300028800 Bacteria 4672
269 Ga0265338_10036923 3300028800 Bacteria 4663
270 Ga0265338_10038935 3300028800 Unclassified 4495
271 Ga0265338_10055045 3300028800 Bacteria 3542
272 Ga0265338_10066035 3300028800 Bacteria 3134
273 Ga0265338_10084030 3300028800 Bacteria 2660
274 Ga0265338_10106869 3300028800 Bacteria 2264
275 Ga0265338_10291996 3300028800 Bacteria 1188
276 Ga0265324_10000124 3300029957 Bacteria 61275
277 Ga0265324_10000709 3300029957 Bacteria 22206
278 Ga0265324_10002416 3300029957 Bacteria 9610
279 Ga0265324_10015943 3300029957 Unclassified 2757
280 Ga0265324_10030178 3300029957 Bacteria 1903
281 Ga0265324_10079175 3300029957 Bacteria 1118
282 Ga0307511_10000007 3300030521 Bacteria 167546
283 Ga0265330_10068452 3300031235 Bacteria 1538
284 Ga0265320_10003385 3300031240 Bacteria 10747
285 Ga0265320_10004233 3300031240 Bacteria 9432
286 Ga0265320_10025318 3300031240 Bacteria 3121
287 Ga0265320_10064309 3300031240 Bacteria 1743
288 Ga0265320_10118776 3300031240 Bacteria 1207
289 Ga0265325_10006036 3300031241 Bacteria 7409
290 Ga0265325_10015943 3300031241 Bacteria 4210
291 Ga0265339_10003446 3300031249 Bacteria 11068
292 Ga0265339_10009665 3300031249 Bacteria 6040
293 Ga0265339_10019675 3300031249 Bacteria 3959
294 Ga0265327_10003258 3300031251 Bacteria 15737
295 Ga0265327_10026139 3300031251 Unclassified 3388
296 Ga0265316_10002077 3300031344 Bacteria 21048
297 Ga0265316_10036973 3300031344 Bacteria 3946
298 Ga0265316_10040680 3300031344 Bacteria 3725
299 Ga0265316_10065270 3300031344 Bacteria 2819
300 Ga0265316_10067814 3300031344 Bacteria 2758
301 Ga0265316_10092539 3300031344 Bacteria 2305
302 Ga0307408_100147591 3300031548 Bacteria 1853
303 Ga0265313_10002875 3300031595 Bacteria 14435
304 Ga0265313_10006736 3300031595 Bacteria 8036
305 Ga0265314_10052413 3300031711 Bacteria 2836
306 Ga0265314_10097724 3300031711 Unclassified 1896
307 Ga0265314_10227960 3300031711 Bacteria 1083
308 Ga0265342_10012830 3300031712 Bacteria 5656
309 Ga0307405_10158296 3300031731 Bacteria 1601
310 Ga0307413_10038023 3300031824 Bacteria 2786
311 Ga0307410_10003009 3300031852 Bacteria 8318
312 Ga0307410_10199482 3300031852 Bacteria 1527
313 Ga0307406_10015931 3300031901 Bacteria 4359
314 Ga0307407_10147727 3300031903 Bacteria 1524
315 Ga0307407_10182456 3300031903 Bacteria 1392
316 Ga0307409_100631170 3300031995 Unclassified 1063
317 Ga0307416_100034875 3300032002 Bacteria 3835
318 Ga0307416_100591990 3300032002 Bacteria 1188
319 Ga0307411_10091232 3300032005 Bacteria 2127
320 Ga0307411_10218393 3300032005 Bacteria 1477
321 Ga0373928_0000030 3300035084 Bacteria 23861
322 Ga0373929_0000179 3300035085 Bacteria 11149
323 Ga0373944_0000250 3300035089 Bacteria 11833
324 Ga0373944_0012005 3300035089 Bacteria 2382
325 Ga0373944_0012200 3300035089 Bacteria 2365
326 Ga0373949_0003418 3300035090 Bacteria 3785
327 Ga0373932_0000009 3300035112 Bacteria 156439
328 Ga0373945_0075674 3300035116 Bacteria 1282
329 Ga0373954_0012906 3300035118 Bacteria 3720
330 Ga0373956_0040580 3300035119 Bacteria 2065
331 Ga0373957_0140632 3300035120 Bacteria 987
332 Ga0373943_0022679 3300035170 Bacteria 2912
333 Ga0373943_0141031 3300035170 Bacteria 1298
334 Ga0373946_0028190 3300035171 Unclassified 2226
335 Ga0373946_0041781 3300035171 Unclassified 1882
336 Ga0373962_0000011 3300035242 Bacteria 52540
337 Ga0316574_0179323 3300035398 Bacteria 1363
338 Ga0373931_0000030 3300035691 Bacteria 116251
339 Ga0373935_0006631 3300035692 Bacteria 6916
340 Ga0373927_0006805 3300035695 Bacteria 7776
341 Ga0373927_0012602 3300035695 Bacteria 5625
342 Ga0373927_0017771 3300035695 Bacteria 4679
343 Ga0373947_0001213 3300035725 Bacteria 15863
344 Ga0373947_0018034 3300035725 Bacteria 4062
345 Ga0373947_0055094 3300035725 Unclassified 2401
346 Ga0373937_0110788 3300036401 Bacteria 2553
347 Ga0373925_0000423 3300037068 Bacteria 42927
348 Ga0373925_0001194 3300037068 Bacteria 22913
349 Ga0373925_0265367 3300037068 Unclassified 1380
350 Ga0436364_1423732 3300037853 Bacteria 1441
351 Ga0395901_0205913 3300038443 Bacteria 2061
352 Ga0451839_1336335 3300041496 Bacteria 988
353 Ga0451853_1437492 3300041512 Unclassified 1462
354 Ga0439446_0026080 3300042156 Unclassified 1673
355 Ga0439446_0051092 3300042156 Bacteria 1235
356 Ga0439434_0047726 3300042435 Bacteria 1323
357 Ga0451577_0008840 3300042876 Bacteria 9752
358 Ga0451577_0020418 3300042876 Bacteria 6079
359 Ga0451577_0034120 3300042876 Bacteria 4589
360 Ga0451577_0067488 3300042876 Bacteria 3190
361 Ga0451577_0099104 3300042876 Bacteria 2603
362 Ga0451577_0129026 3300042876 Unclassified 2267
363 Ga0451577_0245241 3300042876 Unclassified 1621
364 Ga0466966_0006204 3300044684 Bacteria 7902
365 Ga0466961_0049580 3300044693 Bacteria 2683
366 Ga0453684_0001011 3300044712 Bacteria 90768
367 Ga0453684_0004184 3300044712 Bacteria 31079
368 Ga0453684_0011581 3300044712 Bacteria 14744
369 Ga0453684_0035628 3300044712 Bacteria 6875
370 Ga0453684_0303966 3300044712 Bacteria 1812
371 Ga0453684_0503474 3300044712 Bacteria 1341
372 Ga0453684_0528830 3300044712 Bacteria 1302
373 Ga0466959_0120735 3300045049 Bacteria 1863
374 Ga0451576_0103940 3300045051 Bacteria 2955
375 Ga0451576_0157715 3300045051 Bacteria 2368
376 Ga0451576_0162697 3300045051 Bacteria 2329
377 Ga0451576_0198596 3300045051 Bacteria 2095
378 Ga0451576_0214560 3300045051 Bacteria 2010
379 Ga0451576_0249693 3300045051 Bacteria 1854
380 Ga0451576_0251805 3300045051 Bacteria 1846
381 Ga0451576_0323752 3300045051 Bacteria 1613
382 Ga0451576_0442697 3300045051 Bacteria 1364
383 Ga0495590_0077114 3300046457 Bacteria 1173
384 Ga0495629_0101999 3300046459 Bacteria 2002
385 Ga0495629_0278727 3300046459 Bacteria 1148
386 Ga0495651_0074546 3300046462 Unclassified 2574
387 Ga0495580_0137805 3300046472 Bacteria 1692
388 Ga0495639_0061060 3300046475 Bacteria 1728
389 Ga0495618_0003933 3300046514 Bacteria 9168
390 Ga0495618_0052231 3300046514 Bacteria 2583
391 Ga0495628_0066317 3300046516 Bacteria 2822
392 Ga0495630_0000437 3300046517 Bacteria 31772
393 Ga0495630_0032407 3300046517 Bacteria 3894
394 Ga0495630_0091423 3300046517 Bacteria 2299
395 Ga0495630_0132075 3300046517 Unclassified 1896
396 Ga0495630_0220710 3300046517 Unclassified 1447
397 Ga0495666_0014712 3300046526 Bacteria 3893
398 Ga0495665_0020124 3300046531 Bacteria 3586
399 Ga0495665_0125737 3300046531 Unclassified 1343
400 Ga0495640_0024253 3300046533 Bacteria 4414
401 Ga0495640_0278658 3300046533 Bacteria 1041
402 Ga0495586_0000665 3300046535 Bacteria 19618
403 Ga0495586_0010151 3300046535 Bacteria 5012
404 Ga0495586_0045737 3300046535 Unclassified 2359
405 Ga0495586_0059779 3300046535 Unclassified 2071
406 Ga0495645_0114880 3300046543 Bacteria 1902
407 Ga0495667_0038031 3300046559 Bacteria 3205
408 Ga0495667_0039922 3300046559 Bacteria 3118
409 Ga0495667_0059383 3300046559 Unclassified 2510
410 Ga0495634_0009054 3300046642 Bacteria 7361
411 Ga0495634_0082884 3300046642 Bacteria 2094
412 Ga0495634_0163246 3300046642 Bacteria 1403
413 Ga0495635_0066868 3300046663 Bacteria 2465
414 Ga0495635_0073669 3300046663 Bacteria 2339
415 Ga0495657_0061839 3300046675 Bacteria 2476
416 Ga0495647_0025678 3300046681 Bacteria 2154
417 Ga0495647_0034721 3300046681 Bacteria 1890
418 Ga0495658_0012244 3300046683 Bacteria 4337
419 Ga0495658_0070482 3300046683 Unclassified 2028
420 Ga0495669_0100371 3300046684 Bacteria 1344
421 Ga0495613_0007670 3300046689 Bacteria 8031
422 Ga0495613_0036479 3300046689 Bacteria 3645
423 Ga0495613_0064460 3300046689 Bacteria 2679
424 Ga0495613_0157324 3300046689 Bacteria 1618
425 Ga0495624_0076339 3300046690 Bacteria 2079
426 Ga0495624_0182749 3300046690 Bacteria 1277
427 Ga0495600_0100173 3300046809 Bacteria 1888
428 Ga0495581_0056947 3300047315 Bacteria 2256
429 Ga0495604_0051749 3300047317 Bacteria 3182
430 Ga0495604_0080262 3300047317 Bacteria 2445
431 Ga0495674_0003360 3300047319 Bacteria 15534
432 Ga0495674_0005210 3300047319 Bacteria 12486
433 Ga0495674_0050191 3300047319 Bacteria 3682
434 Ga0495674_0357803 3300047319 Bacteria 1184
435 Ga0495676_0015749 3300047321 Bacteria 6721
436 Ga0495680_0019555 3300047322 Bacteria 5712
437 Ga0495675_0034280 3300047444 Bacteria 3241
438 Ga0495675_0113726 3300047444 Bacteria 1688
439 Ga0495684_0037729 3300047471 Bacteria 3706
440 Ga0495684_0058177 3300047471 Bacteria 2945
441 Ga0495684_0109821 3300047471 Unclassified 2083
442 Ga0495684_0129092 3300047471 Bacteria 1900
443 Ga0495602_0032331 3300048088 Bacteria 4927
444 Ga0496112_0275634 3300048915 Unclassified 1630
445 Ga0496114_0142525 3300048917 Bacteria 2076
446 Ga0496115_0003448 3300048918 Bacteria 11357
447 Ga0496115_0192770 3300048918 Bacteria 1683
448 Ga0501031_0000849 3300049568 Bacteria 18349
449 Ga0501032_0176293 3300049569 Bacteria 1400
450 Ga0501033_0002393 3300049570 Bacteria 15970
451 Ga0501033_0017420 3300049570 Bacteria 5427
452 Ga0501033_0111880 3300049570 Bacteria 1987
453 Ga0501034_0193779 3300049571 Bacteria 1993
454 Ga0501037_0065059 3300049573 Bacteria 2657
455 Ga0501040_0046461 3300049576 Bacteria 2964
456 Ga0501040_0115187 3300049576 Bacteria 1882
457 Ga0501041_0014205 3300049577 Bacteria 4728
458 Ga0501042_0338996 3300049578 Bacteria 1087
459 Ga0501048_0159543 3300049582 Bacteria 1596
460 Ga0501069_0182718 3300049585 Bacteria 1212
461 Ga0501072_0065953 3300049588 Unclassified 2855
462 Ga0501075_0001433 3300049591 Bacteria 15505
463 Ga0501076_0005741 3300049592 Bacteria 8943
464 Ga0501076_0223281 3300049592 Bacteria 1540
465 Ga0501076_0238671 3300049592 Bacteria 1487
466 Ga0501077_0234308 3300049593 Bacteria 1167
467 Ga0501079_0006582 3300049741 Bacteria 8739
468 Ga0501080_0125514 3300049742 Bacteria 2377
469 Ga0501081_0003935 3300049743 Bacteria 9521
470 Ga0501081_0048789 3300049743 Bacteria 2914
471 Ga0501083_0048810 3300049744 Bacteria 2856
472 Ga0501035_0005798 3300049822 Bacteria 11643
473 Ga0501035_0016449 3300049822 Bacteria 6822
474 Ga0501044_0001103 3300049823 Bacteria 32118
475 Ga0501044_0014187 3300049823 Bacteria 8605
476 Ga0501045_0037535 3300049824 Bacteria 3522
477 Ga0501045_0090513 3300049824 Bacteria 2261
478 nmdc:mga05p37_201904_c1 3300050507 Bacteria 2407
479 nmdc:mga05p37_83652_c1 3300050507 Bacteria 3931
480 nmdc:mga09592_34570_c1 3300050508 Bacteria 4225
481 nmdc:mga0qj67_422201_c1 3300050509 Bacteria 1075
482 nmdc:mga06r32_156132_c1 3300050510 Bacteria 2263
483 nmdc:mga06r32_7422_c1 3300050510 Bacteria 9863
484 nmdc:mga08y16_201678_c1 3300050511 Bacteria 2061
485 nmdc:mga08y16_9847_c1 3300050511 Bacteria 10035
486 nmdc:mga0n895_121974_c1 3300050512 Bacteria 2628
487 nmdc:mga0a205_125709_c1 3300050515 Bacteria 2464
488 Ga0495601_0072711 3300053077 Bacteria 2197
489 Ga0495601_0179388 3300053077 Bacteria 1385
490 Ga0495619_0164856 3300053085 Bacteria 1531
491 Ga0500555_000017 3300053103 Bacteria 201046
492 Ga0500616_0033627 3300053153 Bacteria 2797
493 Ga0501084_0018585 3300054114 Bacteria 5784
494 Ga0501084_0188164 3300054114 Bacteria 1742
495 Ga0590071_000173 3300059421 Bacteria 18614
496 Ga0590071_006448 3300059421 Bacteria 2795
497 Ga0590071_012215 3300059421 Bacteria 2013
498 Ga0590077_008836 3300059426 Bacteria 2063
499 Ga0590077_013059 3300059426 Bacteria 1725
500 Ga0501082_0009433 3300060353 Bacteria 8400
501 Ga0501082_0074104 3300060353 Bacteria 2932
502 Ga0530510_0041907 3300061734 Bacteria 3306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059421 Ga0590071_012215 Ga0590071_012215_595_1521 254
2 3300005718 Ga0068866_10019726 Ga0068866_100197263 266
3 3300035171 Ga0373946_0041781 Ga0373946_0041781_864_1757 270
4 3300005328 Ga0070676_10021705 Ga0070676_100217052 279
5 3300005329 Ga0070683_100185102 Ga0070683_1001851022 279
6 3300005338 Ga0068868_100013098 Ga0068868_1000130984 279
7 3300005343 Ga0070687_100002219 Ga0070687_1000022195 279
8 3300005356 Ga0070674_100143580 Ga0070674_1001435802 279
9 3300005441 Ga0070700_100038410 Ga0070700_1000384103 279
10 3300006881 Ga0068865_100003126 Ga0068865_1000031266 279
11 3300007076 Ga0075435_100119799 Ga0075435_1001197992 279
12 3300009098 Ga0105245_10067177 Ga0105245_100671772 279
13 3300025907 Ga0207645_10001868 Ga0207645_100018684 279
14 3300025933 Ga0207706_10003975 Ga0207706_1000397516 279
15 3300025944 Ga0207661_10415029 Ga0207661_104150292 279
16 3300026075 Ga0207708_10035394 Ga0207708_100353946 279
17 3300005444 Ga0070694_100036840 Ga0070694_1000368403 281
18 3300009098 Ga0105245_10077833 Ga0105245_100778333 281
19 3300013297 Ga0157378_10121905 Ga0157378_101219052 281
20 3300041496 Ga0451839_1336335 Ga0451839_1336335_118_963 281
21 3300046457 Ga0495590_0077114 Ga0495590_0077114_167_1132 281
22 3300042876 Ga0451577_0020418 Ga0451577_0020418_4765_5745 285
23 3300044712 Ga0453684_0035628 Ga0453684_0035628_1131_2111 285
24 3300005329 Ga0070683_100001156 Ga0070683_1000011562 289
25 3300005336 Ga0070680_100042829 Ga0070680_1000428293 289
26 3300005337 Ga0070682_100031260 Ga0070682_1000312603 289
27 3300005458 Ga0070681_10007475 Ga0070681_100074759 289
28 3300005530 Ga0070679_100007354 Ga0070679_1000073547 289
29 3300005530 Ga0070679_100036611 Ga0070679_1000366115 289
30 3300005535 Ga0070684_100001421 Ga0070684_1000014219 289
31 3300005564 Ga0070664_100003668 Ga0070664_10000366813 289
32 3300025921 Ga0207652_10003161 Ga0207652_100031619 289
33 3300025921 Ga0207652_10041375 Ga0207652_100413752 289
34 3300025944 Ga0207661_10000912 Ga0207661_1000091221 289
35 3300005336 Ga0070680_100210851 Ga0070680_1002108512 290
36 3300048915 Ga0496112_0275634 Ga0496112_0275634_477_1487 290
37 3300049592 Ga0501076_0238671 Ga0501076_0238671_336_1418 291
38 3300049593 Ga0501077_0234308 Ga0501077_0234308_20_1102 291
39 3300054114 Ga0501084_0188164 Ga0501084_0188164_213_1295 291
40 3300060353 Ga0501082_0074104 Ga0501082_0074104_215_1297 291
41 3300005293 Ga0065715_10089824 Ga0065715_100898244 292
42 3300005539 Ga0068853_100159083 Ga0068853_1001590833 292
43 3300005545 Ga0070695_100029760 Ga0070695_1000297603 292
44 3300005563 Ga0068855_100019669 Ga0068855_1000196694 292
45 3300006846 Ga0075430_100012550 Ga0075430_1000125503 292
46 3300006847 Ga0075431_100034199 Ga0075431_1000341997 292
47 3300010159 Ga0099796_10010569 Ga0099796_100105692 292
48 3300013307 Ga0157372_10007050 Ga0157372_100070508 292
49 3300013307 Ga0157372_10382736 Ga0157372_103827362 292
50 3300025909 Ga0207705_10012449 Ga0207705_100124497 292
51 3300025949 Ga0207667_10147615 Ga0207667_101476152 292
52 3300035089 Ga0373944_0012005 Ga0373944_0012005_899_1942 292
53 3300035170 Ga0373943_0141031 Ga0373943_0141031_188_1216 292
54 3300035692 Ga0373935_0006631 Ga0373935_0006631_571_1599 292
55 3300035725 Ga0373947_0055094 Ga0373947_0055094_367_1395 292
56 3300046472 Ga0495580_0137805 Ga0495580_0137805_124_1152 292
57 3300046531 Ga0495665_0125737 Ga0495665_0125737_34_1062 292
58 3300005336 Ga0070680_100000815 Ga0070680_1000008159 293
59 3300005336 Ga0070680_100080911 Ga0070680_1000809112 293
60 3300005337 Ga0070682_100077373 Ga0070682_1000773732 293
61 3300005345 Ga0070692_10053427 Ga0070692_100534272 293
62 3300005364 Ga0070673_100031149 Ga0070673_1000311492 293
63 3300005441 Ga0070700_100097047 Ga0070700_1000970472 293
64 3300005444 Ga0070694_100083785 Ga0070694_1000837852 293
65 3300005445 Ga0070708_100000052 Ga0070708_10000005219 293
66 3300005458 Ga0070681_10033517 Ga0070681_100335172 293
67 3300005468 Ga0070707_100000643 Ga0070707_10000064329 293
68 3300005518 Ga0070699_100091067 Ga0070699_1000910672 293
69 3300005518 Ga0070699_100451858 Ga0070699_1004518581 293
70 3300005530 Ga0070679_100003344 Ga0070679_10000334415 293
71 3300005539 Ga0068853_100009053 Ga0068853_1000090536 293
72 3300005546 Ga0070696_100035582 Ga0070696_1000355823 293
73 3300006852 Ga0075433_10033857 Ga0075433_100338574 293
74 3300006871 Ga0075434_100052826 Ga0075434_1000528262 293
75 3300013100 Ga0157373_10144515 Ga0157373_101445152 293
76 3300013296 Ga0157374_10248809 Ga0157374_102488092 293
77 3300013297 Ga0157378_10084402 Ga0157378_100844023 293
78 3300025899 Ga0207642_10114265 Ga0207642_101142652 293
79 3300025912 Ga0207707_10003264 Ga0207707_1000326415 293
80 3300025917 Ga0207660_10013298 Ga0207660_100132987 293
81 3300025921 Ga0207652_10004935 Ga0207652_1000493510 293
82 3300025921 Ga0207652_10042192 Ga0207652_100421923 293
83 3300025922 Ga0207646_10003903 Ga0207646_1000390316 293
84 3300025960 Ga0207651_10051090 Ga0207651_100510902 293
85 3300026075 Ga0207708_10047911 Ga0207708_100479112 293
86 3300026089 Ga0207648_10016265 Ga0207648_100162654 293
87 3300026121 Ga0207683_10022643 Ga0207683_100226437 293
88 3300041512 Ga0451853_1437492 Ga0451853_1437492_476_1441 293
89 3300050512 nmdc:mga0n895_121974_c1 nmdc:mga0n895_121974_c1_857_1822 293
90 3300050515 nmdc:mga0a205_125709_c1 nmdc:mga0a205_125709_c1_624_1589 293
91 3300005338 Ga0068868_100021328 Ga0068868_1000213282 294
92 3300005445 Ga0070708_100038839 Ga0070708_1000388396 294
93 3300005467 Ga0070706_100009071 Ga0070706_1000090713 294
94 3300005518 Ga0070699_100297270 Ga0070699_1002972702 294
95 3300025922 Ga0207646_10086653 Ga0207646_100866533 294
96 3300031824 Ga0307413_10038023 Ga0307413_100380233 295
97 3300031852 Ga0307410_10003009 Ga0307410_100030097 295
98 3300031903 Ga0307407_10182456 Ga0307407_101824562 295
99 3300032005 Ga0307411_10091232 Ga0307411_100912323 295
100 3300042156 Ga0439446_0026080 Ga0439446_0026080_469_1551 300
101 3300048917 Ga0496114_0142525 Ga0496114_0142525_478_1461 303
102 3300048918 Ga0496115_0192770 Ga0496115_0192770_687_1670 303
103 3300005548 Ga0070665_100123528 Ga0070665_1001235282 304
104 3300025928 Ga0207700_10086357 Ga0207700_100863572 304
105 3300028379 Ga0268266_10095075 Ga0268266_100950753 304
106 3300005327 Ga0070658_10002511 Ga0070658_100025116 305
107 3300005354 Ga0070675_100080356 Ga0070675_1000803562 305
108 3300005440 Ga0070705_100222704 Ga0070705_1002227041 305
109 3300005471 Ga0070698_100009811 Ga0070698_10000981114 305
110 3300005518 Ga0070699_100202173 Ga0070699_1002021732 305
111 3300006880 Ga0075429_100115726 Ga0075429_1001157263 305
112 3300009094 Ga0111539_10003561 Ga0111539_1000356119 305
113 3300014326 Ga0157380_10465889 Ga0157380_104658892 305
114 3300027907 Ga0207428_10020930 Ga0207428_100209304 305
115 3300031548 Ga0307408_100147591 Ga0307408_1001475912 305
116 3300031731 Ga0307405_10158296 Ga0307405_101582962 305
117 3300031901 Ga0307406_10015931 Ga0307406_100159316 305
118 3300031903 Ga0307407_10147727 Ga0307407_101477272 305
119 3300032002 Ga0307416_100034875 Ga0307416_1000348753 305
120 3300032005 Ga0307411_10218393 Ga0307411_102183932 305
121 3300035120 Ga0373957_0140632 Ga0373957_0140632_17_973 305
122 3300042156 Ga0439446_0051092 Ga0439446_0051092_100_1053 305
123 3300042435 Ga0439434_0047726 Ga0439434_0047726_105_1058 305
124 3300050511 nmdc:mga08y16_9847_c1 nmdc:mga08y16_9847_c1_6472_7425 305
125 3300005329 Ga0070683_100037621 Ga0070683_1000376214 306
126 3300005339 Ga0070660_100031785 Ga0070660_1000317853 306
127 3300005355 Ga0070671_100064297 Ga0070671_1000642972 306
128 3300005364 Ga0070673_100032670 Ga0070673_1000326704 306
129 3300005434 Ga0070709_10003533 Ga0070709_100035339 306
130 3300005441 Ga0070700_100210002 Ga0070700_1002100021 306
131 3300005455 Ga0070663_100014388 Ga0070663_1000143887 306
132 3300005471 Ga0070698_100074549 Ga0070698_1000745494 306
133 3300005518 Ga0070699_100086298 Ga0070699_1000862983 306
134 3300005530 Ga0070679_100031384 Ga0070679_1000313844 306
135 3300005535 Ga0070684_100027764 Ga0070684_1000277642 306
136 3300005543 Ga0070672_100140211 Ga0070672_1001402113 306
137 3300005563 Ga0068855_100169349 Ga0068855_1001693492 306
138 3300005578 Ga0068854_100125581 Ga0068854_1001255812 306
139 3300005614 Ga0068856_100232278 Ga0068856_1002322782 306
140 3300005616 Ga0068852_100318538 Ga0068852_1003185382 306
141 3300005617 Ga0068859_100424615 Ga0068859_1004246152 306
142 3300005842 Ga0068858_100038552 Ga0068858_1000385524 306
143 3300006846 Ga0075430_100085799 Ga0075430_1000857993 306
144 3300006847 Ga0075431_100085275 Ga0075431_1000852752 306
145 3300006847 Ga0075431_100328194 Ga0075431_1003281942 306
146 3300006880 Ga0075429_100015562 Ga0075429_1000155624 306
147 3300006914 Ga0075436_100012314 Ga0075436_1000123143 306
148 3300006931 Ga0097620_100424629 Ga0097620_1004246292 306
149 3300009093 Ga0105240_10005312 Ga0105240_1000531218 306
150 3300009093 Ga0105240_10306650 Ga0105240_103066502 306
151 3300009093 Ga0105240_10452754 Ga0105240_104527542 306
152 3300009098 Ga0105245_10028501 Ga0105245_100285016 306
153 3300009147 Ga0114129_10050390 Ga0114129_100503905 306
154 3300009147 Ga0114129_10144091 Ga0114129_101440913 306
155 3300009147 Ga0114129_10245185 Ga0114129_102451853 306
156 3300009551 Ga0105238_10019937 Ga0105238_100199373 306
157 3300013102 Ga0157371_10002989 Ga0157371_100029894 306
158 3300013105 Ga0157369_10033346 Ga0157369_100333464 306
159 3300013307 Ga0157372_10006078 Ga0157372_1000607812 306
160 3300013307 Ga0157372_10070191 Ga0157372_100701916 306
161 3300025909 Ga0207705_10000748 Ga0207705_1000074818 306
162 3300025913 Ga0207695_10005634 Ga0207695_1000563410 306
163 3300025919 Ga0207657_10001459 Ga0207657_1000145919 306
164 3300025921 Ga0207652_10316075 Ga0207652_103160752 306
165 3300025921 Ga0207652_10317147 Ga0207652_103171472 306
166 3300025924 Ga0207694_10070300 Ga0207694_100703003 306
167 3300025936 Ga0207670_10129896 Ga0207670_101298962 306
168 3300025939 Ga0207665_10000466 Ga0207665_1000046622 306
169 3300025940 Ga0207691_10142575 Ga0207691_101425752 306
170 3300025949 Ga0207667_10006549 Ga0207667_1000654915 306
171 3300025981 Ga0207640_10011702 Ga0207640_100117027 306
172 3300025986 Ga0207658_10193542 Ga0207658_101935422 306
173 3300026035 Ga0207703_10075000 Ga0207703_100750004 306
174 3300026067 Ga0207678_10001595 Ga0207678_1000159524 306
175 3300026078 Ga0207702_10445047 Ga0207702_104450471 306
176 3300026142 Ga0207698_10069034 Ga0207698_100690342 306
177 3300030521 Ga0307511_10000007 Ga0307511_10000007149 306
178 3300037853 Ga0436364_1423732 Ga0436364_1423732_175_1173 306
179 3300044684 Ga0466966_0006204 Ga0466966_0006204_4248_5231 306
180 3300044693 Ga0466961_0049580 Ga0466961_0049580_987_1970 306
181 3300045049 Ga0466959_0120735 Ga0466959_0120735_795_1778 306
182 3300046514 Ga0495618_0052231 Ga0495618_0052231_203_1195 306
183 3300046516 Ga0495628_0066317 Ga0495628_0066317_454_1446 306
184 3300046517 Ga0495630_0091423 Ga0495630_0091423_1018_2010 306
185 3300046531 Ga0495665_0020124 Ga0495665_0020124_585_1577 306
186 3300046543 Ga0495645_0114880 Ga0495645_0114880_592_1584 306
187 3300046559 Ga0495667_0038031 Ga0495667_0038031_288_1280 306
188 3300046642 Ga0495634_0163246 Ga0495634_0163246_111_1103 306
189 3300046663 Ga0495635_0073669 Ga0495635_0073669_332_1324 306
190 3300046675 Ga0495657_0061839 Ga0495657_0061839_216_1208 306
191 3300046689 Ga0495613_0064460 Ga0495613_0064460_900_1892 306
192 3300046690 Ga0495624_0182749 Ga0495624_0182749_250_1242 306
193 3300046809 Ga0495600_0100173 Ga0495600_0100173_500_1492 306
194 3300047317 Ga0495604_0051749 Ga0495604_0051749_374_1366 306
195 3300047317 Ga0495604_0080262 Ga0495604_0080262_1010_2011 306
196 3300047319 Ga0495674_0050191 Ga0495674_0050191_497_1489 306
197 3300047322 Ga0495680_0019555 Ga0495680_0019555_508_1500 306
198 3300047444 Ga0495675_0034280 Ga0495675_0034280_1092_2093 306
199 3300047444 Ga0495675_0113726 Ga0495675_0113726_360_1352 306
200 3300047471 Ga0495684_0037729 Ga0495684_0037729_288_1280 306
201 3300048088 Ga0495602_0032331 Ga0495602_0032331_3171_4163 306
202 3300049570 Ga0501033_0111880 Ga0501033_0111880_756_1742 306
203 3300049576 Ga0501040_0046461 Ga0501040_0046461_879_1865 306
204 3300049576 Ga0501040_0115187 Ga0501040_0115187_865_1851 306
205 3300049577 Ga0501041_0014205 Ga0501041_0014205_429_1511 306
206 3300049578 Ga0501042_0338996 Ga0501042_0338996_44_1030 306
207 3300049582 Ga0501048_0159543 Ga0501048_0159543_158_1144 306
208 3300049585 Ga0501069_0182718 Ga0501069_0182718_27_1109 306
209 3300049588 Ga0501072_0065953 Ga0501072_0065953_410_1492 306
210 3300049591 Ga0501075_0001433 Ga0501075_0001433_10037_11119 306
211 3300049592 Ga0501076_0005741 Ga0501076_0005741_4863_5945 306
212 3300049592 Ga0501076_0223281 Ga0501076_0223281_203_1189 306
213 3300049741 Ga0501079_0006582 Ga0501079_0006582_3990_5072 306
214 3300049743 Ga0501081_0003935 Ga0501081_0003935_3990_5072 306
215 3300049743 Ga0501081_0048789 Ga0501081_0048789_1840_2826 306
216 3300049824 Ga0501045_0037535 Ga0501045_0037535_1289_2371 306
217 3300049824 Ga0501045_0090513 Ga0501045_0090513_1257_2243 306
218 3300050507 nmdc:mga05p37_201904_c1 nmdc:mga05p37_201904_c1_1061_2143 306
219 3300050507 nmdc:mga05p37_83652_c1 nmdc:mga05p37_83652_c1_238_1317 306
220 3300050508 nmdc:mga09592_34570_c1 nmdc:mga09592_34570_c1_1227_2198 306
221 3300050510 nmdc:mga06r32_156132_c1 nmdc:mga06r32_156132_c1_253_1224 306
222 3300053077 Ga0495601_0179388 Ga0495601_0179388_269_1261 306
223 3300053085 Ga0495619_0164856 Ga0495619_0164856_95_1087 306
224 3300054114 Ga0501084_0018585 Ga0501084_0018585_2969_4051 306
225 3300059421 Ga0590071_000173 Ga0590071_000173_10720_11802 306
226 3300059426 Ga0590077_008836 Ga0590077_008836_739_1821 306
227 3300059426 Ga0590077_013059 Ga0590077_013059_160_1242 306
228 3300060353 Ga0501082_0009433 Ga0501082_0009433_4371_5453 306
229 3300061734 Ga0530510_0041907 Ga0530510_0041907_616_1698 306
230 3300005340 Ga0070689_100023307 Ga0070689_1000233074 307
231 3300025936 Ga0207670_10035521 Ga0207670_100355214 307
232 3300046690 Ga0495624_0076339 Ga0495624_0076339_1018_1941 307
233 3300049744 Ga0501083_0048810 Ga0501083_0048810_365_1294 307
234 3300053077 Ga0495601_0072711 Ga0495601_0072711_1259_2182 307
235 3300059421 Ga0590071_006448 Ga0590071_006448_356_1345 307
236 3300003320 rootH2_10226705 rootH2_102267054 308
237 3300028381 Ga0268264_10209508 Ga0268264_102095081 308
238 3300031251 Ga0265327_10003258 Ga0265327_100032582 308
239 3300031711 Ga0265314_10097724 Ga0265314_100977242 308
240 3300042876 Ga0451577_0245241 Ga0451577_0245241_188_1114 308
241 3300053103 Ga0500555_000017 Ga0500555_000017_15689_16618 308
242 3300053153 Ga0500616_0033627 Ga0500616_0033627_384_1313 308
243 3300005330 Ga0070690_100027311 Ga0070690_1000273113 309
244 3300005340 Ga0070689_100000377 Ga0070689_10000037712 309
245 3300005340 Ga0070689_100370279 Ga0070689_1003702792 309
246 3300005341 Ga0070691_10120180 Ga0070691_101201802 309
247 3300005365 Ga0070688_100004352 Ga0070688_1000043525 309
248 3300005434 Ga0070709_10109934 Ga0070709_101099343 309
249 3300005435 Ga0070714_100154291 Ga0070714_1001542912 309
250 3300005438 Ga0070701_10022566 Ga0070701_100225662 309
251 3300005440 Ga0070705_100093985 Ga0070705_1000939852 309
252 3300005440 Ga0070705_100157535 Ga0070705_1001575352 309
253 3300005444 Ga0070694_100026867 Ga0070694_1000268672 309
254 3300005445 Ga0070708_100296031 Ga0070708_1002960312 309
255 3300005458 Ga0070681_10030063 Ga0070681_100300635 309
256 3300005458 Ga0070681_10076298 Ga0070681_100762982 309
257 3300005466 Ga0070685_10003413 Ga0070685_100034131 309
258 3300005544 Ga0070686_100007615 Ga0070686_1000076154 309
259 3300005545 Ga0070695_100464921 Ga0070695_1004649211 309
260 3300005549 Ga0070704_100006109 Ga0070704_1000061095 309
261 3300005549 Ga0070704_100084025 Ga0070704_1000840252 309
262 3300005563 Ga0068855_100060213 Ga0068855_1000602136 309
263 3300005563 Ga0068855_100110940 Ga0068855_1001109403 309
264 3300005577 Ga0068857_100010498 Ga0068857_1000104983 309
265 3300005577 Ga0068857_100088995 Ga0068857_1000889952 309
266 3300005614 Ga0068856_100000701 Ga0068856_10000070120 309
267 3300005614 Ga0068856_100217727 Ga0068856_1002177273 309
268 3300005614 Ga0068856_100297833 Ga0068856_1002978333 309
269 3300005614 Ga0068856_100755889 Ga0068856_1007558891 309
270 3300005617 Ga0068859_100004689 Ga0068859_10000468912 309
271 3300005617 Ga0068859_100124606 Ga0068859_1001246063 309
272 3300005617 Ga0068859_100159206 Ga0068859_1001592062 309
273 3300005617 Ga0068859_100177842 Ga0068859_1001778423 309
274 3300005617 Ga0068859_100269633 Ga0068859_1002696332 309
275 3300005841 Ga0068863_100106640 Ga0068863_1001066404 309
276 3300005841 Ga0068863_100289443 Ga0068863_1002894432 309
277 3300005842 Ga0068858_100081007 Ga0068858_1000810073 309
278 3300005937 Ga0081455_10090619 Ga0081455_100906192 309
279 3300006358 Ga0068871_100165323 Ga0068871_1001653231 309
280 3300006844 Ga0075428_100002152 Ga0075428_10000215219 309
281 3300006844 Ga0075428_100607180 Ga0075428_1006071802 309
282 3300006847 Ga0075431_100042115 Ga0075431_1000421153 309
283 3300006847 Ga0075431_100090956 Ga0075431_1000909564 309
284 3300006871 Ga0075434_100286883 Ga0075434_1002868831 309
285 3300006931 Ga0097620_100004689 Ga0097620_10000468912 309
286 3300006931 Ga0097620_100124600 Ga0097620_1001246003 309
287 3300006931 Ga0097620_100159201 Ga0097620_1001592011 309
288 3300006931 Ga0097620_100177854 Ga0097620_1001778543 309
289 3300006931 Ga0097620_100269648 Ga0097620_1002696482 309
290 3300009093 Ga0105240_10002096 Ga0105240_100020968 309
291 3300009093 Ga0105240_10047126 Ga0105240_100471263 309
292 3300009093 Ga0105240_10277708 Ga0105240_102777081 309
293 3300009094 Ga0111539_10008597 Ga0111539_100085979 309
294 3300009094 Ga0111539_10248487 Ga0111539_102484872 309
295 3300009094 Ga0111539_10332274 Ga0111539_103322743 309
296 3300009094 Ga0111539_10509049 Ga0111539_105090492 309
297 3300009098 Ga0105245_10202836 Ga0105245_102028361 309
298 3300009177 Ga0105248_10609313 Ga0105248_106093132 309
299 3300009551 Ga0105238_10001107 Ga0105238_1000110716 309
300 3300009551 Ga0105238_10142891 Ga0105238_101428912 309
301 3300009553 Ga0105249_10260843 Ga0105249_102608431 309
302 3300013104 Ga0157370_10015323 Ga0157370_100153233 309
303 3300013104 Ga0157370_10296115 Ga0157370_102961152 309
304 3300013297 Ga0157378_10215471 Ga0157378_102154712 309
305 3300013297 Ga0157378_10265074 Ga0157378_102650741 309
306 3300013307 Ga0157372_10119837 Ga0157372_101198372 309
307 3300013308 Ga0157375_10000129 Ga0157375_1000012955 309
308 3300013308 Ga0157375_10833496 Ga0157375_108334961 309
309 3300014325 Ga0163163_10589864 Ga0163163_105898642 309
310 3300014326 Ga0157380_10491275 Ga0157380_104912752 309
311 3300025905 Ga0207685_10030356 Ga0207685_100303562 309
312 3300025912 Ga0207707_10075934 Ga0207707_100759343 309
313 3300025912 Ga0207707_10188574 Ga0207707_101885741 309
314 3300025913 Ga0207695_10011407 Ga0207695_100114078 309
315 3300025924 Ga0207694_10002636 Ga0207694_100026365 309
316 3300025927 Ga0207687_10205864 Ga0207687_102058642 309
317 3300025929 Ga0207664_10134482 Ga0207664_101344822 309
318 3300025936 Ga0207670_10000636 Ga0207670_100006369 309
319 3300025941 Ga0207711_10491754 Ga0207711_104917542 309
320 3300025944 Ga0207661_10108175 Ga0207661_101081753 309
321 3300026035 Ga0207703_10066878 Ga0207703_100668783 309
322 3300026075 Ga0207708_10264616 Ga0207708_102646162 309
323 3300026078 Ga0207702_10001596 Ga0207702_1000159611 309
324 3300026078 Ga0207702_10362856 Ga0207702_103628562 309
325 3300026088 Ga0207641_10144082 Ga0207641_101440821 309
326 3300026116 Ga0207674_10025046 Ga0207674_100250463 309
327 3300026116 Ga0207674_10164888 Ga0207674_101648882 309
328 3300028556 Ga0265337_1000352 Ga0265337_100035216 309
329 3300028556 Ga0265337_1000880 Ga0265337_100088010 309
330 3300028556 Ga0265337_1002876 Ga0265337_10028762 309
331 3300028556 Ga0265337_1016971 Ga0265337_10169712 309
332 3300028556 Ga0265337_1029658 Ga0265337_10296582 309
333 3300028563 Ga0265319_1000027 Ga0265319_1000027114 309
334 3300028563 Ga0265319_1026646 Ga0265319_10266462 309
335 3300028577 Ga0265318_10019738 Ga0265318_100197382 309
336 3300028653 Ga0265323_10000166 Ga0265323_1000016625 309
337 3300028654 Ga0265322_10014146 Ga0265322_100141464 309
338 3300028654 Ga0265322_10032772 Ga0265322_100327722 309
339 3300028666 Ga0265336_10007147 Ga0265336_100071473 309
340 3300028666 Ga0265336_10008898 Ga0265336_100088982 309
341 3300028800 Ga0265338_10000220 Ga0265338_100002206 309
342 3300028800 Ga0265338_10000808 Ga0265338_1000080841 309
343 3300028800 Ga0265338_10000831 Ga0265338_1000083140 309
344 3300028800 Ga0265338_10001318 Ga0265338_1000131816 309
345 3300028800 Ga0265338_10001756 Ga0265338_100017565 309
346 3300028800 Ga0265338_10001835 Ga0265338_1000183519 309
347 3300028800 Ga0265338_10002037 Ga0265338_1000203731 309
348 3300028800 Ga0265338_10003736 Ga0265338_1000373616 309
349 3300028800 Ga0265338_10008664 Ga0265338_100086645 309
350 3300028800 Ga0265338_10012305 Ga0265338_100123052 309
351 3300028800 Ga0265338_10014615 Ga0265338_100146158 309
352 3300028800 Ga0265338_10025500 Ga0265338_100255008 309
353 3300028800 Ga0265338_10025785 Ga0265338_100257856 309
354 3300028800 Ga0265338_10030830 Ga0265338_100308304 309
355 3300028800 Ga0265338_10036923 Ga0265338_100369236 309
356 3300028800 Ga0265338_10038935 Ga0265338_100389352 309
357 3300028800 Ga0265338_10066035 Ga0265338_100660352 309
358 3300028800 Ga0265338_10084030 Ga0265338_100840302 309
359 3300028800 Ga0265338_10106869 Ga0265338_101068692 309
360 3300028800 Ga0265338_10291996 Ga0265338_102919961 309
361 3300029957 Ga0265324_10000124 Ga0265324_1000012475 309
362 3300029957 Ga0265324_10000709 Ga0265324_1000070915 309
363 3300029957 Ga0265324_10002416 Ga0265324_1000241611 309
364 3300029957 Ga0265324_10015943 Ga0265324_100159433 309
365 3300029957 Ga0265324_10030178 Ga0265324_100301782 309
366 3300029957 Ga0265324_10079175 Ga0265324_100791752 309
367 3300031235 Ga0265330_10068452 Ga0265330_100684522 309
368 3300031240 Ga0265320_10003385 Ga0265320_100033857 309
369 3300031240 Ga0265320_10004233 Ga0265320_100042339 309
370 3300031240 Ga0265320_10025318 Ga0265320_100253182 309
371 3300031240 Ga0265320_10064309 Ga0265320_100643092 309
372 3300031240 Ga0265320_10118776 Ga0265320_101187761 309
373 3300031241 Ga0265325_10006036 Ga0265325_100060366 309
374 3300031241 Ga0265325_10015943 Ga0265325_100159432 309
375 3300031249 Ga0265339_10003446 Ga0265339_100034462 309
376 3300031249 Ga0265339_10009665 Ga0265339_100096654 309
377 3300031249 Ga0265339_10019675 Ga0265339_100196753 309
378 3300031251 Ga0265327_10026139 Ga0265327_100261391 309
379 3300031344 Ga0265316_10036973 Ga0265316_100369732 309
380 3300031344 Ga0265316_10040680 Ga0265316_100406802 309
381 3300031344 Ga0265316_10065270 Ga0265316_100652703 309
382 3300031344 Ga0265316_10067814 Ga0265316_100678143 309
383 3300031595 Ga0265313_10002875 Ga0265313_100028756 309
384 3300031595 Ga0265313_10006736 Ga0265313_100067367 309
385 3300031711 Ga0265314_10052413 Ga0265314_100524132 309
386 3300031711 Ga0265314_10227960 Ga0265314_102279601 309
387 3300031712 Ga0265342_10012830 Ga0265342_100128305 309
388 3300031852 Ga0307410_10199482 Ga0307410_101994821 309
389 3300031995 Ga0307409_100631170 Ga0307409_1006311701 309
390 3300032002 Ga0307416_100591990 Ga0307416_1005919901 309
391 3300035084 Ga0373928_0000030 Ga0373928_0000030_12014_12943 309
392 3300035085 Ga0373929_0000179 Ga0373929_0000179_1611_2540 309
393 3300035089 Ga0373944_0000250 Ga0373944_0000250_7013_7942 309
394 3300035089 Ga0373944_0012200 Ga0373944_0012200_1328_2257 309
395 3300035090 Ga0373949_0003418 Ga0373949_0003418_840_1769 309
396 3300035112 Ga0373932_0000009 Ga0373932_0000009_79048_79977 309
397 3300035116 Ga0373945_0075674 Ga0373945_0075674_15_944 309
398 3300035118 Ga0373954_0012906 Ga0373954_0012906_98_1027 309
399 3300035119 Ga0373956_0040580 Ga0373956_0040580_56_985 309
400 3300035170 Ga0373943_0022679 Ga0373943_0022679_497_1552 309
401 3300035242 Ga0373962_0000011 Ga0373962_0000011_3384_4313 309
402 3300035691 Ga0373931_0000030 Ga0373931_0000030_110293_111222 309
403 3300035695 Ga0373927_0006805 Ga0373927_0006805_826_1755 309
404 3300035695 Ga0373927_0012602 Ga0373927_0012602_4676_5605 309
405 3300035725 Ga0373947_0018034 Ga0373947_0018034_2133_3062 309
406 3300036401 Ga0373937_0110788 Ga0373937_0110788_1045_1974 309
407 3300037068 Ga0373925_0000423 Ga0373925_0000423_33724_34653 309
408 3300037068 Ga0373925_0265367 Ga0373925_0265367_236_1165 309
409 3300038443 Ga0395901_0205913 Ga0395901_0205913_93_1034 309
410 3300042876 Ga0451577_0008840 Ga0451577_0008840_1709_2638 309
411 3300042876 Ga0451577_0034120 Ga0451577_0034120_1824_2753 309
412 3300042876 Ga0451577_0067488 Ga0451577_0067488_2245_3174 309
413 3300042876 Ga0451577_0099104 Ga0451577_0099104_1031_1960 309
414 3300044712 Ga0453684_0001011 Ga0453684_0001011_55720_56649 309
415 3300044712 Ga0453684_0004184 Ga0453684_0004184_9608_10537 309
416 3300044712 Ga0453684_0011581 Ga0453684_0011581_13718_14647 309
417 3300044712 Ga0453684_0303966 Ga0453684_0303966_569_1498 309
418 3300044712 Ga0453684_0503474 Ga0453684_0503474_321_1250 309
419 3300045051 Ga0451576_0103940 Ga0451576_0103940_1432_2361 309
420 3300045051 Ga0451576_0157715 Ga0451576_0157715_752_1681 309
421 3300045051 Ga0451576_0162697 Ga0451576_0162697_404_1333 309
422 3300045051 Ga0451576_0198596 Ga0451576_0198596_100_1029 309
423 3300045051 Ga0451576_0214560 Ga0451576_0214560_1029_1958 309
424 3300045051 Ga0451576_0251805 Ga0451576_0251805_903_1832 309
425 3300045051 Ga0451576_0323752 Ga0451576_0323752_592_1521 309
426 3300045051 Ga0451576_0442697 Ga0451576_0442697_401_1330 309
427 3300046459 Ga0495629_0101999 Ga0495629_0101999_252_1181 309
428 3300046459 Ga0495629_0278727 Ga0495629_0278727_130_1059 309
429 3300046462 Ga0495651_0074546 Ga0495651_0074546_911_1840 309
430 3300046475 Ga0495639_0061060 Ga0495639_0061060_648_1577 309
431 3300046514 Ga0495618_0003933 Ga0495618_0003933_3073_4002 309
432 3300046517 Ga0495630_0000437 Ga0495630_0000437_18862_19791 309
433 3300046517 Ga0495630_0032407 Ga0495630_0032407_866_1795 309
434 3300046517 Ga0495630_0220710 Ga0495630_0220710_310_1239 309
435 3300046526 Ga0495666_0014712 Ga0495666_0014712_1333_2262 309
436 3300046533 Ga0495640_0024253 Ga0495640_0024253_786_1715 309
437 3300046533 Ga0495640_0278658 Ga0495640_0278658_39_968 309
438 3300046535 Ga0495586_0000665 Ga0495586_0000665_5097_6026 309
439 3300046535 Ga0495586_0010151 Ga0495586_0010151_1289_2218 309
440 3300046535 Ga0495586_0045737 Ga0495586_0045737_1267_2196 309
441 3300046535 Ga0495586_0059779 Ga0495586_0059779_184_1113 309
442 3300046559 Ga0495667_0039922 Ga0495667_0039922_2079_3008 309
443 3300046559 Ga0495667_0059383 Ga0495667_0059383_97_1026 309
444 3300046642 Ga0495634_0009054 Ga0495634_0009054_428_1357 309
445 3300046642 Ga0495634_0082884 Ga0495634_0082884_736_1665 309
446 3300046663 Ga0495635_0066868 Ga0495635_0066868_56_985 309
447 3300046681 Ga0495647_0025678 Ga0495647_0025678_457_1386 309
448 3300046681 Ga0495647_0034721 Ga0495647_0034721_892_1821 309
449 3300046683 Ga0495658_0012244 Ga0495658_0012244_2506_3435 309
450 3300046683 Ga0495658_0070482 Ga0495658_0070482_252_1181 309
451 3300046684 Ga0495669_0100371 Ga0495669_0100371_387_1316 309
452 3300046689 Ga0495613_0007670 Ga0495613_0007670_226_1155 309
453 3300046689 Ga0495613_0036479 Ga0495613_0036479_221_1150 309
454 3300046689 Ga0495613_0157324 Ga0495613_0157324_289_1218 309
455 3300047315 Ga0495581_0056947 Ga0495581_0056947_254_1183 309
456 3300047319 Ga0495674_0003360 Ga0495674_0003360_205_1134 309
457 3300047319 Ga0495674_0005210 Ga0495674_0005210_591_1520 309
458 3300047319 Ga0495674_0357803 Ga0495674_0357803_196_1125 309
459 3300047321 Ga0495676_0015749 Ga0495676_0015749_1283_2212 309
460 3300047471 Ga0495684_0058177 Ga0495684_0058177_174_1103 309
461 3300047471 Ga0495684_0109821 Ga0495684_0109821_881_1810 309
462 3300047471 Ga0495684_0129092 Ga0495684_0129092_904_1833 309
463 3300048918 Ga0496115_0003448 Ga0496115_0003448_1441_2370 309
464 3300049568 Ga0501031_0000849 Ga0501031_0000849_17340_18269 309
465 3300049569 Ga0501032_0176293 Ga0501032_0176293_72_1001 309
466 3300049570 Ga0501033_0002393 Ga0501033_0002393_14948_15877 309
467 3300049570 Ga0501033_0017420 Ga0501033_0017420_3339_4268 309
468 3300049571 Ga0501034_0193779 Ga0501034_0193779_24_953 309
469 3300049573 Ga0501037_0065059 Ga0501037_0065059_1480_2409 309
470 3300049742 Ga0501080_0125514 Ga0501080_0125514_232_1161 309
471 3300049822 Ga0501035_0005798 Ga0501035_0005798_679_1611 309
472 3300049822 Ga0501035_0016449 Ga0501035_0016449_93_1022 309
473 3300049823 Ga0501044_0001103 Ga0501044_0001103_115_1044 309
474 3300049823 Ga0501044_0014187 Ga0501044_0014187_5327_6259 309
475 3300050509 nmdc:mga0qj67_422201_c1 nmdc:mga0qj67_422201_c1_77_1006 309
476 3300050510 nmdc:mga06r32_7422_c1 nmdc:mga06r32_7422_c1_3389_4318 309
477 3300050511 nmdc:mga08y16_201678_c1 nmdc:mga08y16_201678_c1_1087_2016 309
478 3300035171 Ga0373946_0028190 Ga0373946_0028190_1120_2073 310
479 3300035398 Ga0316574_0179323 Ga0316574_0179323_260_1192 310
480 3300035695 Ga0373927_0017771 Ga0373927_0017771_899_1852 310
481 3300035725 Ga0373947_0001213 Ga0373947_0001213_14310_15263 310
482 3300037068 Ga0373925_0001194 Ga0373925_0001194_6068_7021 310
483 3300042876 Ga0451577_0129026 Ga0451577_0129026_1168_2100 310
484 3300045051 Ga0451576_0249693 Ga0451576_0249693_694_1626 310
485 3300046517 Ga0495630_0132075 Ga0495630_0132075_163_1116 310
486 3300005548 Ga0070665_100000045 Ga0070665_10000004532 311
487 3300009093 Ga0105240_10007047 Ga0105240_1000704724 311
488 3300025913 Ga0207695_10175746 Ga0207695_101757462 311
489 3300028379 Ga0268266_10000251 Ga0268266_1000025132 311
490 3300028800 Ga0265338_10017506 Ga0265338_100175062 313
491 3300005330 Ga0070690_100145049 Ga0070690_1001450492 314
492 3300005544 Ga0070686_100290385 Ga0070686_1002903851 314
493 3300005614 Ga0068856_100006743 Ga0068856_10000674310 314
494 3300009551 Ga0105238_10001809 Ga0105238_1000180913 314
495 3300014325 Ga0163163_10000260 Ga0163163_1000026030 314
496 3300025924 Ga0207694_10002160 Ga0207694_1000216014 314
497 3300028800 Ga0265338_10036826 Ga0265338_100368262 314
498 3300028800 Ga0265338_10055045 Ga0265338_100550452 314
499 3300031344 Ga0265316_10002077 Ga0265316_1000207714 314
500 3300031344 Ga0265316_10092539 Ga0265316_100925393 314
501 3300044712 Ga0453684_0528830 Ga0453684_0528830_216_1229 314
502 3300003320 rootH2_10024344 rootH2_100243447 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

151

227

0.96

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

7

299

0.92

PF00890

FAD_binding_2

FAD binding domain

8

49

0.91

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

54

282

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mih-assembly2.cif.gz_E pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant 0.9367 4 35
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.9232 4 310
5utx-assembly1.cif.gz_B crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form 0.9129 6 313
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.909 4 310
5utx-assembly1.cif.gz_B crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form 0.9034 6 313
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9864 118 244 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9786 118 244 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.978 118 244 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9698 118 244 3.50.50.60
af_Q39243_53_161_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9674 10 111 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7C7H271-F1-model_v4 FAD-binding protein 0.9869 5 85 GO:0016491
AF-A0A6B3EPH4-F1-model_v4 FAD-dependent oxidoreductase 0.985 113 230 GO:0016668
AF-A0A2D9WYK9-F1-model_v4 Thioredoxin-disulfide reductase 0.9802 8 88 GO:0016491
AF-A0A3B0SUF5-F1-model_v4 Thioredoxin reductase (EC 1.8.1.9) 0.9796 5 97 GO:0004791
AF-A0A840EIJ8-F1-model_v4 deleted 0.9775 4 85

Feature Viewer

pLDDT pTM Quality
92.96 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map