F455834

General Info

Members Datasets Scaffolds Average Seq Length
502 275 1004 159

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10030657|Ga0105245_100306575
Length 185
Sequence MMPVRRFANRFGADTAGRSIEHKEHTKMQPKNTICLWFDKDAHEAARFYAATFPDSEVTAVHEAPADYPGGKKGDVLTVNFTVLGIPCLGLNGGPTFKHSEAFSFQIATDNQEETDRYWNAIVGNGGKESQCGWCKDRWGLSWQITPRVLTEALAAGGGEAKRAFEAMMPMKKIDVATIEAARRG

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
212 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
213 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 7.77
Rhizosphere 89.24
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10030657 3300009098 Bacteria 4757
2 CNAas_1003294 3300000532 Bacteria 1079
3 JGI24737J22298_10045442 3300001990 Bacteria 1341
4 JGI24743J22301_10005197 3300001991 Bacteria 2163
5 JGI24745J21846_1034774 3300002073 Bacteria 614
6 JGI24744J21845_10010884 3300002077 Bacteria 1862
7 JGI24034J26672_10010351 3300002239 Bacteria 1384
8 JGI24034J26672_10048496 3300002239 Bacteria 726
9 JGI24742J22300_10015249 3300002244 Bacteria 1293
10 JGI24742J22300_10040899 3300002244 Unclassified 826
11 Ga0058860_11791159 3300004801 Bacteria 693
12 Ga0065714_10128528 3300005288 Bacteria 1272
13 Ga0065714_10305836 3300005288 Bacteria 688
14 Ga0065712_10001519 3300005290 Bacteria 11136
15 Ga0065712_10087205 3300005290 Bacteria 2573
16 Ga0065712_10232420 3300005290 Bacteria 1004
17 Ga0065715_10097383 3300005293 Bacteria 3714
18 Ga0065715_10164759 3300005293 Bacteria 1596
19 Ga0065715_10178745 3300005293 Bacteria 1492
20 Ga0065715_10298562 3300005293 Bacteria 1046
21 Ga0065707_10000900 3300005295 Bacteria 17565
22 Ga0065707_10039869 3300005295 Bacteria 1267
23 Ga0065707_10170461 3300005295 Bacteria 1488
24 Ga0065707_10425814 3300005295 Bacteria 825
25 Ga0070683_100518129 3300005329 Bacteria 1139
26 Ga0070683_101141682 3300005329 Bacteria 749
27 Ga0070670_100035871 3300005331 Bacteria 4269
28 Ga0070670_100059183 3300005331 Bacteria 3288
29 Ga0070670_100434043 3300005331 Bacteria 1162
30 Ga0068869_100641723 3300005334 Bacteria 900
31 Ga0070666_10600829 3300005335 Bacteria 803
32 Ga0070680_100065737 3300005336 Bacteria 2972
33 Ga0070682_100000004 3300005337 Bacteria 388780
34 Ga0068868_101463589 3300005338 Bacteria 638
35 Ga0070689_100530689 3300005340 Bacteria 1012
36 Ga0070691_10028817 3300005341 Bacteria 2597
37 Ga0070691_10460928 3300005341 Bacteria 727
38 Ga0070687_100082360 3300005343 Bacteria 1759
39 Ga0070661_100052060 3300005344 Bacteria 2997
40 Ga0070692_10201621 3300005345 Bacteria 1166
41 Ga0070692_10205643 3300005345 Bacteria 1155
42 Ga0070668_100051256 3300005347 Bacteria 3180
43 Ga0070668_100147059 3300005347 Bacteria 1903
44 Ga0070668_100169111 3300005347 Bacteria 1778
45 Ga0070668_100382800 3300005347 Bacteria 1197
46 Ga0070669_100007583 3300005353 Bacteria 7761
47 Ga0070669_100038651 3300005353 Bacteria 3465
48 Ga0070669_100121722 3300005353 Bacteria 1991
49 Ga0070669_100450325 3300005353 Bacteria 1061
50 Ga0070675_100000014 3300005354 Bacteria 206249
51 Ga0070671_100003567 3300005355 Bacteria 12171
52 Ga0070674_100063227 3300005356 Bacteria 2589
53 Ga0070674_100096364 3300005356 Bacteria 2146
54 Ga0070674_100393486 3300005356 Bacteria 1130
55 Ga0070674_100400954 3300005356 Bacteria 1121
56 Ga0070688_100870603 3300005365 Bacteria 709
57 Ga0070709_10264449 3300005434 Bacteria 1244
58 Ga0070714_100175101 3300005435 Bacteria 1949
59 Ga0070714_100729660 3300005435 Bacteria 957
60 Ga0070710_10011964 3300005437 Bacteria 4301
61 Ga0070701_10113941 3300005438 Bacteria 1514
62 Ga0070701_10240040 3300005438 Bacteria 1089
63 Ga0070701_10621780 3300005438 Bacteria 718
64 Ga0070711_100064338 3300005439 Bacteria 2563
65 Ga0070705_100001307 3300005440 Bacteria 13359
66 Ga0070694_100000796 3300005444 Bacteria 17667
67 Ga0070694_100591494 3300005444 Bacteria 893
68 Ga0070694_100855141 3300005444 Bacteria 749
69 Ga0070663_100419454 3300005455 Bacteria 1097
70 Ga0070678_100142067 3300005456 Bacteria 1922
71 Ga0070678_100437557 3300005456 Bacteria 1143
72 Ga0070662_100199131 3300005457 Bacteria 1588
73 Ga0070662_100271805 3300005457 Bacteria 1369
74 Ga0070681_10020530 3300005458 Bacteria 6621
75 Ga0068867_100095000 3300005459 Bacteria 2268
76 Ga0068867_100403569 3300005459 Bacteria 1153
77 Ga0068867_100726977 3300005459 Bacteria 878
78 Ga0070685_10040951 3300005466 Bacteria 2638
79 Ga0070706_100555646 3300005467 Bacteria 1068
80 Ga0070707_100223922 3300005468 Bacteria 1832
81 Ga0070679_100320729 3300005530 Bacteria 1499
82 Ga0070679_100506551 3300005530 Bacteria 1151
83 Ga0070684_100160850 3300005535 Bacteria 2037
84 Ga0070684_100617354 3300005535 Bacteria 1008
85 Ga0070672_100191564 3300005543 Bacteria 1707
86 Ga0070672_100273566 3300005543 Bacteria 1427
87 Ga0070672_100280483 3300005543 Bacteria 1408
88 Ga0070672_100985055 3300005543 Bacteria 747
89 Ga0070695_100000075 3300005545 Bacteria 40319
90 Ga0070695_100316863 3300005545 Bacteria 1158
91 Ga0070695_100630119 3300005545 Bacteria 845
92 Ga0070696_100000235 3300005546 Bacteria 33523
93 Ga0070693_100657493 3300005547 Bacteria 763
94 Ga0070665_100152710 3300005548 Bacteria 2311
95 Ga0070665_100872332 3300005548 Bacteria 913
96 Ga0070704_100024599 3300005549 Bacteria 3953
97 Ga0070704_100095078 3300005549 Bacteria 2231
98 Ga0070704_100272209 3300005549 Bacteria 1400
99 Ga0070704_100487290 3300005549 Bacteria 1068
100 Ga0068855_100005025 3300005563 Bacteria 16150
101 Ga0068855_100829938 3300005563 Bacteria 981
102 Ga0070664_100181098 3300005564 Bacteria 1873
103 Ga0068857_100316403 3300005577 Bacteria 1441
104 Ga0068856_101186025 3300005614 Bacteria 780
105 Ga0070702_100061509 3300005615 Bacteria 2187
106 Ga0068852_100022973 3300005616 Bacteria 5011
107 Ga0068852_100519075 3300005616 Bacteria 1188
108 Ga0068859_100009131 3300005617 Bacteria 10009
109 Ga0068859_100159040 3300005617 Bacteria 2338
110 Ga0068859_100312336 3300005617 Bacteria 1665
111 Ga0068859_100477149 3300005617 Bacteria 1343
112 Ga0068864_100002156 3300005618 Bacteria 16272
113 Ga0068864_100134086 3300005618 Bacteria 2228
114 Ga0068864_100150940 3300005618 Bacteria 2105
115 Ga0068864_100636085 3300005618 Bacteria 1038
116 Ga0068866_10096958 3300005718 Bacteria 1618
117 Ga0068866_10151411 3300005718 Bacteria 1344
118 Ga0068861_100104413 3300005719 Bacteria 2260
119 Ga0068851_10315021 3300005834 Bacteria 902
120 Ga0068870_10176631 3300005840 Bacteria 1278
121 Ga0068863_100123898 3300005841 Bacteria 2466
122 Ga0068863_100445385 3300005841 Bacteria 1270
123 Ga0068858_100006720 3300005842 Bacteria 11191
124 Ga0068858_100035498 3300005842 Bacteria 4624
125 Ga0068858_100289702 3300005842 Bacteria 1560
126 Ga0068860_100012261 3300005843 Bacteria 8447
127 Ga0068860_100026208 3300005843 Bacteria 5621
128 Ga0068860_100028306 3300005843 Bacteria 5393
129 Ga0068860_100450998 3300005843 Bacteria 1279
130 Ga0068862_100021321 3300005844 Bacteria 5413
131 Ga0068862_100031675 3300005844 Bacteria 4466
132 Ga0068862_100245298 3300005844 Bacteria 1630
133 Ga0081455_10108500 3300005937 Bacteria 2210
134 Ga0081540_1203771 3300005983 Bacteria 717
135 Ga0070717_10038809 3300006028 Bacteria 3872
136 Ga0070717_10227439 3300006028 Bacteria 1641
137 Ga0070717_10417566 3300006028 Bacteria 1207
138 Ga0070715_10359190 3300006163 Bacteria 798
139 Ga0070716_100013870 3300006173 Bacteria 4117
140 Ga0070716_100049247 3300006173 Bacteria 2386
141 Ga0070712_100012574 3300006175 Bacteria 5382
142 Ga0097621_101602233 3300006237 Bacteria 619
143 Ga0068871_100162263 3300006358 Bacteria 1912
144 Ga0068871_100470123 3300006358 Bacteria 1130
145 Ga0075428_100103687 3300006844 Bacteria 3101
146 Ga0075428_100104754 3300006844 Bacteria 3085
147 Ga0075428_100387674 3300006844 Bacteria 1498
148 Ga0075430_100031772 3300006846 Bacteria 4481
149 Ga0075430_100477774 3300006846 Bacteria 1028
150 Ga0075431_100225578 3300006847 Bacteria 1910
151 Ga0075434_101137266 3300006871 Bacteria 794
152 Ga0075429_100392303 3300006880 Bacteria 1215
153 Ga0075429_100487898 3300006880 Bacteria 1079
154 Ga0068865_100014680 3300006881 Bacteria 4982
155 Ga0068865_100210567 3300006881 Bacteria 1515
156 Ga0097620_100009131 3300006931 Bacteria 10009
157 Ga0097620_100159044 3300006931 Bacteria 2338
158 Ga0097620_100312342 3300006931 Bacteria 1665
159 Ga0097620_100477163 3300006931 Bacteria 1343
160 Ga0097620_101682452 3300006931 Bacteria 701
161 Ga0105244_10039946 3300009036 Bacteria 2439
162 Ga0105240_10046691 3300009093 Bacteria 5486
163 Ga0111539_10000003 3300009094 Bacteria 880006
164 Ga0111539_10001241 3300009094 Bacteria 33954
165 Ga0111539_10094896 3300009094 Bacteria 3505
166 Ga0111539_10240919 3300009094 Bacteria 2106
167 Ga0111539_10614736 3300009094 Bacteria 1266
168 Ga0111539_11204256 3300009094 Bacteria 880
169 Ga0105245_10168208 3300009098 Bacteria 2086
170 Ga0105245_10433605 3300009098 Bacteria 1319
171 Ga0105245_10739680 3300009098 Bacteria 1019
172 Ga0105247_10006736 3300009101 Bacteria 7090
173 Ga0105247_10735859 3300009101 Bacteria 746
174 Ga0114129_10129709 3300009147 Bacteria 3464
175 Ga0114129_10313395 3300009147 Bacteria 2088
176 Ga0105243_10014810 3300009148 Bacteria 5901
177 Ga0105243_10027255 3300009148 Bacteria 4376
178 Ga0105241_11680209 3300009174 Bacteria 616
179 Ga0105242_10029441 3300009176 Bacteria 4380
180 Ga0105248_10002900 3300009177 Bacteria 19024
181 Ga0105248_10006922 3300009177 Bacteria 12426
182 Ga0105248_10011506 3300009177 Bacteria 9751
183 Ga0105248_11619730 3300009177 Bacteria 733
184 Ga0105237_10483967 3300009545 Bacteria 1244
185 Ga0105249_10022223 3300009553 Bacteria 5681
186 Ga0105239_10364391 3300010375 Bacteria 1633
187 Ga0105246_10105226 3300011119 Bacteria 2062
188 Ga0105246_12024255 3300011119 Bacteria 556
189 Ga0157373_10597124 3300013100 Bacteria 803
190 Ga0157371_10092624 3300013102 Bacteria 2141
191 Ga0157370_10019999 3300013104 Bacteria 6698
192 Ga0157369_10044174 3300013105 Bacteria 4851
193 Ga0157369_10138069 3300013105 Bacteria 2580
194 Ga0157374_10016939 3300013296 Bacteria 6415
195 Ga0157374_10075829 3300013296 Bacteria 3178
196 Ga0157378_10375735 3300013297 Bacteria 1395
197 Ga0157378_10630400 3300013297 Bacteria 1086
198 Ga0157378_10743661 3300013297 Bacteria 1003
199 Ga0157372_10002297 3300013307 Bacteria 20726
200 Ga0157372_10127080 3300013307 Bacteria 2931
201 Ga0157372_10331078 3300013307 Bacteria 1773
202 Ga0157375_10000028 3300013308 Bacteria 218924
203 Ga0157375_10040087 3300013308 Bacteria 4513
204 Ga0163163_10030804 3300014325 Bacteria 5173
205 Ga0163163_10460049 3300014325 Bacteria 1333
206 Ga0157380_10000625 3300014326 Bacteria 21697
207 Ga0157380_10241396 3300014326 Bacteria 1629
208 Ga0157380_10435829 3300014326 Bacteria 1254
209 Ga0157377_10677116 3300014745 Bacteria 746
210 Ga0157379_10024020 3300014968 Bacteria 5410
211 Ga0157379_10705038 3300014968 Bacteria 948
212 Ga0157379_10954058 3300014968 Bacteria 816
213 Ga0157376_10026393 3300014969 Bacteria 4590
214 Ga0157376_10104559 3300014969 Bacteria 2481
215 Ga0163161_10448171 3300017792 Bacteria 1043
216 Ga0163161_10528026 3300017792 Bacteria 964
217 Ga0163161_10538381 3300017792 Bacteria 956
218 Ga0213876_10046497 3300021384 Bacteria 2294
219 Ga0213875_10139780 3300021388 Bacteria 1133
220 Ga0213875_10150615 3300021388 Bacteria 1090
221 Ga0207682_10512650 3300025893 Bacteria 568
222 Ga0207692_10098278 3300025898 Bacteria 1602
223 Ga0207642_10081389 3300025899 Bacteria 1573
224 Ga0207710_10046504 3300025900 Bacteria 1938
225 Ga0207688_10059986 3300025901 Bacteria 2142
226 Ga0207680_10305270 3300025903 Bacteria 1110
227 Ga0207647_10054854 3300025904 Bacteria 2451
228 Ga0207647_10430890 3300025904 Bacteria 740
229 Ga0207699_10333080 3300025906 Bacteria 1068
230 Ga0207645_10004115 3300025907 Bacteria 10814
231 Ga0207645_10022535 3300025907 Bacteria 4095
232 Ga0207643_10002163 3300025908 Bacteria 10771
233 Ga0207643_10061469 3300025908 Bacteria 2145
234 Ga0207684_10379118 3300025910 Bacteria 1216
235 Ga0207654_10327890 3300025911 Bacteria 1048
236 Ga0207707_10026315 3300025912 Bacteria 5085
237 Ga0207695_10145683 3300025913 Bacteria 2313
238 Ga0207671_10293573 3300025914 Bacteria 1284
239 Ga0207693_10002629 3300025915 Bacteria 15598
240 Ga0207663_10025046 3300025916 Bacteria 3443
241 Ga0207660_10024145 3300025917 Bacteria 4112
242 Ga0207662_10130893 3300025918 Bacteria 1581
243 Ga0207662_10386041 3300025918 Bacteria 947
244 Ga0207657_10371454 3300025919 Bacteria 1127
245 Ga0207649_10129353 3300025920 Bacteria 1713
246 Ga0207649_10440668 3300025920 Bacteria 981
247 Ga0207652_10218538 3300025921 Bacteria 1717
248 Ga0207652_10445349 3300025921 Bacteria 1167
249 Ga0207646_10156615 3300025922 Bacteria 2055
250 Ga0207681_10044151 3300025923 Bacteria 2986
251 Ga0207681_10204077 3300025923 Bacteria 1519
252 Ga0207681_10214739 3300025923 Bacteria 1485
253 Ga0207650_10006434 3300025925 Bacteria 8005
254 Ga0207659_10000001 3300025926 Bacteria 660958
255 Ga0207687_10166966 3300025927 Bacteria 1694
256 Ga0207687_10218572 3300025927 Bacteria 1499
257 Ga0207687_10290901 3300025927 Bacteria 1313
258 Ga0207664_10651359 3300025929 Bacteria 947
259 Ga0207644_10089154 3300025931 Bacteria 2295
260 Ga0207706_10002945 3300025933 Bacteria 16446
261 Ga0207706_10138675 3300025933 Bacteria 2139
262 Ga0207706_10344209 3300025933 Bacteria 1297
263 Ga0207686_10006322 3300025934 Bacteria 6371
264 Ga0207686_10257278 3300025934 Bacteria 1278
265 Ga0207709_10013577 3300025935 Bacteria 4493
266 Ga0207709_10081737 3300025935 Bacteria 2084
267 Ga0207670_10257710 3300025936 Bacteria 1350
268 Ga0207670_10414564 3300025936 Bacteria 1079
269 Ga0207669_10028208 3300025937 Bacteria 3085
270 Ga0207669_10037701 3300025937 Bacteria 2776
271 Ga0207669_10285944 3300025937 Bacteria 1246
272 Ga0207669_10553577 3300025937 Bacteria 928
273 Ga0207704_10031275 3300025938 Bacteria 2996
274 Ga0207704_10214504 3300025938 Bacteria 1419
275 Ga0207665_10001456 3300025939 Bacteria 15936
276 Ga0207665_10005986 3300025939 Bacteria 8085
277 Ga0207691_10006638 3300025940 Bacteria 11166
278 Ga0207691_10067744 3300025940 Bacteria 3227
279 Ga0207691_10075421 3300025940 Bacteria 3041
280 Ga0207691_10253914 3300025940 Bacteria 1517
281 Ga0207691_10604784 3300025940 Bacteria 928
282 Ga0207711_10003614 3300025941 Bacteria 13374
283 Ga0207711_10006684 3300025941 Bacteria 9707
284 Ga0207711_10058197 3300025941 Bacteria 3325
285 Ga0207711_10376864 3300025941 Bacteria 1316
286 Ga0207689_10365807 3300025942 Bacteria 1200
287 Ga0207661_10230164 3300025944 Bacteria 1641
288 Ga0207679_10283194 3300025945 Bacteria 1422
289 Ga0207667_10015649 3300025949 Bacteria 8605
290 Ga0207667_10238678 3300025949 Bacteria 1861
291 Ga0207712_10039555 3300025961 Bacteria 3232
292 Ga0207668_10263253 3300025972 Bacteria 1406
293 Ga0207668_10311773 3300025972 Bacteria 1302
294 Ga0207640_10759918 3300025981 Bacteria 836
295 Ga0207677_10321195 3300026023 Bacteria 1286
296 Ga0207703_10030844 3300026035 Bacteria 4238
297 Ga0207703_10102733 3300026035 Bacteria 2426
298 Ga0207639_10292761 3300026041 Bacteria 1436
299 Ga0207708_10000003 3300026075 Bacteria 324662
300 Ga0207708_10038753 3300026075 Bacteria 3631
301 Ga0207702_11300221 3300026078 Bacteria 721
302 Ga0207641_10207073 3300026088 Bacteria 1812
303 Ga0207641_10584138 3300026088 Bacteria 1092
304 Ga0207648_10011788 3300026089 Bacteria 8216
305 Ga0207648_10030404 3300026089 Bacteria 4783
306 Ga0207648_10044198 3300026089 Bacteria 3908
307 Ga0207648_10045631 3300026089 Bacteria 3843
308 Ga0207648_10584479 3300026089 Bacteria 1028
309 Ga0207676_10008561 3300026095 Bacteria 7272
310 Ga0207676_10251040 3300026095 Bacteria 1592
311 Ga0207676_10268120 3300026095 Bacteria 1545
312 Ga0207674_10605409 3300026116 Bacteria 1058
313 Ga0207675_100005306 3300026118 Bacteria 12389
314 Ga0207675_100139437 3300026118 Bacteria 2303
315 Ga0207675_100165103 3300026118 Bacteria 2114
316 Ga0207683_10021008 3300026121 Bacteria 5587
317 Ga0207698_10014862 3300026142 Bacteria 5191
318 Ga0207698_10678359 3300026142 Bacteria 1023
319 Ga0210000_1013368 3300027462 Bacteria 1225
320 Ga0209999_1046785 3300027543 Bacteria 814
321 Ga0209982_1014901 3300027552 Bacteria 1176
322 Ga0209970_1091145 3300027614 Bacteria 578
323 Ga0209983_1003707 3300027665 Bacteria 3239
324 Ga0209971_1000533 3300027682 Bacteria 10029
325 Ga0209998_10006026 3300027717 Bacteria 2522
326 Ga0209974_10000765 3300027876 Bacteria 10932
327 Ga0207428_10000001 3300027907 Bacteria 1034622
328 Ga0207428_10013713 3300027907 Bacteria 7065
329 Ga0207428_10152868 3300027907 Bacteria 1756
330 Ga0207428_10486877 3300027907 Bacteria 897
331 Ga0268266_10162669 3300028379 Bacteria 2020
332 Ga0268266_11160585 3300028379 Bacteria 747
333 Ga0268265_10050872 3300028380 Bacteria 3124
334 Ga0268265_10108567 3300028380 Bacteria 2259
335 Ga0268265_10334581 3300028380 Bacteria 1376
336 Ga0268265_12191844 3300028380 Bacteria 559
337 Ga0268264_10416812 3300028381 Bacteria 1294
338 Ga0268264_10434651 3300028381 Bacteria 1268
339 Ga0268264_10686218 3300028381 Bacteria 1016
340 Ga0265338_10027515 3300028800 Bacteria 5702
341 Ga0265325_10044890 3300031241 Bacteria 2298
342 Ga0265325_10180702 3300031241 Bacteria 982
343 Ga0265340_10007642 3300031247 Bacteria 5861
344 Ga0307408_100400109 3300031548 Bacteria 1179
345 Ga0307408_100924033 3300031548 Bacteria 800
346 Ga0307413_10215436 3300031824 Bacteria 1398
347 Ga0307410_10180885 3300031852 Bacteria 1596
348 Ga0307410_11016048 3300031852 Bacteria 716
349 Ga0307412_10413786 3300031911 Bacteria 1101
350 Ga0307409_100162649 3300031995 Bacteria 1954
351 Ga0307409_100640712 3300031995 Bacteria 1055
352 Ga0307416_100375040 3300032002 Bacteria 1450
353 Ga0307416_100683913 3300032002 Bacteria 1114
354 Ga0307416_100893158 3300032002 Bacteria 988
355 Ga0307416_102672731 3300032002 Bacteria 596
356 Ga0307416_102787445 3300032002 Bacteria 584
357 Ga0307414_10047863 3300032004 Bacteria 2946
358 Ga0307414_10204437 3300032004 Bacteria 1609
359 Ga0307414_11604362 3300032004 Bacteria 606
360 Ga0307411_10197506 3300032005 Bacteria 1542
361 Ga0307411_10902050 3300032005 Bacteria 785
362 Ga0307415_100061183 3300032126 Bacteria 2606
363 Ga0307415_100331451 3300032126 Bacteria 1273
364 Ga0373932_0000926 3300035112 Bacteria 8573
365 Ga0373936_0120792 3300035113 Bacteria 1119
366 Ga0373939_0146407 3300035114 Bacteria 856
367 Ga0373946_0005659 3300035171 Bacteria 4515
368 Ga0373955_0133687 3300035172 Bacteria 1450
369 Ga0373955_0386665 3300035172 Bacteria 849
370 Ga0373942_0098679 3300035207 Bacteria 890
371 Ga0373924_0344138 3300035410 Bacteria 664
372 Ga0373933_0002028 3300035724 Bacteria 11648
373 Ga0373933_0426815 3300035724 Bacteria 866
374 Ga0373937_0000429 3300036401 Bacteria 39116
375 Ga0373937_0427139 3300036401 Bacteria 1258
376 Ga0395900_0236218 3300037418 Bacteria 1836
377 Ga0395898_0307490 3300037466 Bacteria 1512
378 Ga0395905_0010998 3300037471 Bacteria 8757
379 Ga0395905_0933412 3300037471 Bacteria 771
380 Ga0436364_0015519 3300037853 Bacteria 859
381 Ga0436364_0951790 3300037853 Bacteria 1300
382 Ga0436364_1088246 3300037853 Bacteria 1277
383 Ga0436364_1225112 3300037853 Bacteria 579
384 Ga0436365_0306097 3300039437 Bacteria 2786
385 Ga0436365_0629221 3300039437 Bacteria 14187
386 Ga0436365_0688458 3300039437 Bacteria 840
387 Ga0436365_1352282 3300039437 Bacteria 774
388 Ga0436365_1420241 3300039437 Bacteria 1106
389 Ga0436361_0750261 3300039447 Bacteria 4619
390 Ga0439453_0022260 3300041408 Bacteria 1148
391 Ga0450921_020865 3300042123 Bacteria 622
392 Ga0439444_0059272 3300042437 Bacteria 796
393 Ga0451576_1041993 3300045051 Bacteria 857
394 Ga0495651_0006498 3300046462 Bacteria 8933
395 Ga0495651_0465739 3300046462 Bacteria 814
396 Ga0495653_0255288 3300046463 Bacteria 1162
397 Ga0495605_0171872 3300046474 Bacteria 957
398 Ga0495585_0143960 3300046492 Bacteria 1246
399 Ga0495640_0087006 3300046533 Bacteria 2068
400 Ga0495587_0000401 3300046536 Bacteria 30655
401 Ga0495634_0146797 3300046642 Bacteria 1494
402 Ga0495634_0261446 3300046642 Bacteria 1056
403 Ga0495611_0372567 3300046648 Bacteria 654
404 Ga0495635_0041489 3300046663 Bacteria 3178
405 Ga0495659_0061258 3300046664 Bacteria 1390
406 Ga0495623_0086714 3300046679 Bacteria 1929
407 Ga0495623_0491496 3300046679 Bacteria 649
408 Ga0495658_0055383 3300046683 Bacteria 2259
409 Ga0495658_0220442 3300046683 Bacteria 1187
410 Ga0495669_0036030 3300046684 Bacteria 2186
411 Ga0495669_0134411 3300046684 Bacteria 1166
412 Ga0495600_0032829 3300046809 Bacteria 3369
413 Ga0495600_0135393 3300046809 Bacteria 1601
414 Ga0495604_0309099 3300047317 Bacteria 1060
415 Ga0495680_0226737 3300047322 Bacteria 1332
416 Ga0495675_0001254 3300047444 Bacteria 15371
417 Ga0495593_0055097 3300047673 Bacteria 2094
418 Ga0495602_0000216 3300048088 Bacteria 53347
419 Ga0495602_0225216 3300048088 Bacteria 1412
420 Ga0496100_0114869 3300048903 Bacteria 1876
421 Ga0496101_0090558 3300048904 Bacteria 2275
422 Ga0496102_0008229 3300048905 Bacteria 8928
423 Ga0496102_0014118 3300048905 Bacteria 6938
424 Ga0496102_0277636 3300048905 Bacteria 1579
425 Ga0496103_0085109 3300048906 Bacteria 1992
426 Ga0496103_0124815 3300048906 Bacteria 1641
427 Ga0496104_0004887 3300048907 Bacteria 11684
428 Ga0496104_0035340 3300048907 Bacteria 4666
429 Ga0496104_0056185 3300048907 Bacteria 3721
430 Ga0496104_0820427 3300048907 Bacteria 836
431 Ga0496105_0003396 3300048908 Bacteria 11775
432 Ga0496105_0034091 3300048908 Bacteria 4186
433 Ga0496105_0706025 3300048908 Bacteria 774
434 Ga0496108_0000868 3300048911 Bacteria 23566
435 Ga0496108_0016862 3300048911 Bacteria 5969
436 Ga0496108_0137625 3300048911 Bacteria 2102
437 Ga0496109_0000506 3300048912 Bacteria 33302
438 Ga0496109_0238719 3300048912 Bacteria 1710
439 Ga0496109_0441552 3300048912 Bacteria 1229
440 Ga0496109_0738012 3300048912 Bacteria 922
441 Ga0496110_0004079 3300048913 Bacteria 11276
442 Ga0496110_0174709 3300048913 Bacteria 1949
443 Ga0496110_0443200 3300048913 Bacteria 1183
444 Ga0496111_0022237 3300048914 Bacteria 4436
445 Ga0496111_0075565 3300048914 Bacteria 2455
446 Ga0496111_0260357 3300048914 Bacteria 1287
447 Ga0496112_0004976 3300048915 Bacteria 11391
448 Ga0496112_0045032 3300048915 Bacteria 4324
449 Ga0496112_0077126 3300048915 Bacteria 3295
450 Ga0496112_0154737 3300048915 Bacteria 2260
451 Ga0496112_0370414 3300048915 Bacteria 1374
452 Ga0496113_0000457 3300048916 Bacteria 19875
453 Ga0496113_0089296 3300048916 Bacteria 2372
454 Ga0496113_0724217 3300048916 Bacteria 793
455 Ga0496113_0833593 3300048916 Bacteria 731
456 Ga0496114_0032942 3300048917 Bacteria 4267
457 Ga0496114_0144511 3300048917 Bacteria 2061
458 Ga0496115_0330457 3300048918 Bacteria 1245
459 Ga0501036_0121804 3300049572 Bacteria 2203
460 Ga0501036_0547474 3300049572 Bacteria 962
461 Ga0501038_1085407 3300049574 Bacteria 585
462 Ga0501040_0443150 3300049576 Bacteria 934
463 Ga0501041_0015842 3300049577 Bacteria 4481
464 Ga0501042_0003877 3300049578 Bacteria 9454
465 Ga0501046_0096345 3300049580 Bacteria 2273
466 Ga0501047_0005591 3300049581 Bacteria 11837
467 Ga0501068_0150780 3300049584 Bacteria 1461
468 Ga0501072_0017835 3300049588 Bacteria 5459
469 Ga0501072_1008558 3300049588 Bacteria 649
470 Ga0501073_0092553 3300049589 Bacteria 2101
471 Ga0501073_0498990 3300049589 Bacteria 841
472 Ga0501076_0017850 3300049592 Bacteria 5396
473 Ga0501076_1567075 3300049592 Bacteria 541
474 Ga0501079_0007785 3300049741 Bacteria 8110
475 Ga0501080_0129142 3300049742 Bacteria 2340
476 Ga0501263_075177 3300049760 Bacteria 551
477 Ga0501044_0336337 3300049823 Bacteria 1431
478 Ga0501045_0033434 3300049824 Bacteria 3729
479 nmdc:mga06z11_209660_c1 3300050494 Bacteria 1135
480 nmdc:mga06z11_363683_c1 3300050494 Bacteria 867
481 nmdc:mga05p37_275029_c1 3300050507 Bacteria 2011
482 nmdc:mga05p37_280648_c1 3300050507 Bacteria 1987
483 nmdc:mga05p37_387163_c1 3300050507 Bacteria 1636
484 nmdc:mga05p37_611782_c1 3300050507 Bacteria 1228
485 nmdc:mga09592_336091_c1 3300050508 Bacteria 1308
486 nmdc:mga09592_734434_c1 3300050508 Bacteria 839
487 nmdc:mga0qj67_467785_c1 3300050509 Bacteria 1015
488 nmdc:mga0qj67_4765_c1 3300050509 Bacteria 9859
489 nmdc:mga06r32_964361_c1 3300050510 Bacteria 807
490 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
491 nmdc:mga08y16_383679_c1 3300050511 Bacteria 1440
492 nmdc:mga08y16_523847_c1 3300050511 Bacteria 1202
493 nmdc:mga08y16_915_c1 3300050511 Bacteria 28610
494 nmdc:mga0n895_183755_c1 3300050512 Bacteria 2122
495 Ga0495601_0253096 3300053077 Bacteria 1150
496 Ga0495601_0476164 3300053077 Bacteria 807
497 Ga0495655_0000148 3300053083 Bacteria 13146
498 Ga0495655_0040356 3300053083 Bacteria 1188
499 Ga0495619_0004858 3300053085 Bacteria 8529
500 Ga0495619_0028961 3300053085 Bacteria 3575
501 Ga0501084_0556364 3300054114 Bacteria 969
502 Ga0590077_064259 3300059426 Bacteria 834
503 Ga0105245_10030657
504 CNAas_1003294
505 JGI24737J22298_10045442
506 JGI24743J22301_10005197
507 JGI24745J21846_1034774
508 JGI24744J21845_10010884
509 JGI24034J26672_10010351
510 JGI24034J26672_10048496
511 JGI24742J22300_10015249
512 JGI24742J22300_10040899
513 Ga0058860_11791159
514 Ga0065714_10128528
515 Ga0065714_10305836
516 Ga0065712_10001519
517 Ga0065712_10087205
518 Ga0065712_10232420
519 Ga0065715_10097383
520 Ga0065715_10164759
521 Ga0065715_10178745
522 Ga0065715_10298562
523 Ga0065707_10000900
524 Ga0065707_10039869
525 Ga0065707_10170461
526 Ga0065707_10425814
527 Ga0070683_100518129
528 Ga0070683_101141682
529 Ga0070670_100035871
530 Ga0070670_100059183
531 Ga0070670_100434043
532 Ga0068869_100641723
533 Ga0070666_10600829
534 Ga0070680_100065737
535 Ga0070682_100000004
536 Ga0068868_101463589
537 Ga0070689_100530689
538 Ga0070691_10028817
539 Ga0070691_10460928
540 Ga0070687_100082360
541 Ga0070661_100052060
542 Ga0070692_10201621
543 Ga0070692_10205643
544 Ga0070668_100051256
545 Ga0070668_100147059
546 Ga0070668_100169111
547 Ga0070668_100382800
548 Ga0070669_100007583
549 Ga0070669_100038651
550 Ga0070669_100121722
551 Ga0070669_100450325
552 Ga0070675_100000014
553 Ga0070671_100003567
554 Ga0070674_100063227
555 Ga0070674_100096364
556 Ga0070674_100393486
557 Ga0070674_100400954
558 Ga0070688_100870603
559 Ga0070709_10264449
560 Ga0070714_100175101
561 Ga0070714_100729660
562 Ga0070710_10011964
563 Ga0070701_10113941
564 Ga0070701_10240040
565 Ga0070701_10621780
566 Ga0070711_100064338
567 Ga0070705_100001307
568 Ga0070694_100000796
569 Ga0070694_100591494
570 Ga0070694_100855141
571 Ga0070663_100419454
572 Ga0070678_100142067
573 Ga0070678_100437557
574 Ga0070662_100199131
575 Ga0070662_100271805
576 Ga0070681_10020530
577 Ga0068867_100095000
578 Ga0068867_100403569
579 Ga0068867_100726977
580 Ga0070685_10040951
581 Ga0070706_100555646
582 Ga0070707_100223922
583 Ga0070679_100320729
584 Ga0070679_100506551
585 Ga0070684_100160850
586 Ga0070684_100617354
587 Ga0070672_100191564
588 Ga0070672_100273566
589 Ga0070672_100280483
590 Ga0070672_100985055
591 Ga0070695_100000075
592 Ga0070695_100316863
593 Ga0070695_100630119
594 Ga0070696_100000235
595 Ga0070693_100657493
596 Ga0070665_100152710
597 Ga0070665_100872332
598 Ga0070704_100024599
599 Ga0070704_100095078
600 Ga0070704_100272209
601 Ga0070704_100487290
602 Ga0068855_100005025
603 Ga0068855_100829938
604 Ga0070664_100181098
605 Ga0068857_100316403
606 Ga0068856_101186025
607 Ga0070702_100061509
608 Ga0068852_100022973
609 Ga0068852_100519075
610 Ga0068859_100009131
611 Ga0068859_100159040
612 Ga0068859_100312336
613 Ga0068859_100477149
614 Ga0068864_100002156
615 Ga0068864_100134086
616 Ga0068864_100150940
617 Ga0068864_100636085
618 Ga0068866_10096958
619 Ga0068866_10151411
620 Ga0068861_100104413
621 Ga0068851_10315021
622 Ga0068870_10176631
623 Ga0068863_100123898
624 Ga0068863_100445385
625 Ga0068858_100006720
626 Ga0068858_100035498
627 Ga0068858_100289702
628 Ga0068860_100012261
629 Ga0068860_100026208
630 Ga0068860_100028306
631 Ga0068860_100450998
632 Ga0068862_100021321
633 Ga0068862_100031675
634 Ga0068862_100245298
635 Ga0081455_10108500
636 Ga0081540_1203771
637 Ga0070717_10038809
638 Ga0070717_10227439
639 Ga0070717_10417566
640 Ga0070715_10359190
641 Ga0070716_100013870
642 Ga0070716_100049247
643 Ga0070712_100012574
644 Ga0097621_101602233
645 Ga0068871_100162263
646 Ga0068871_100470123
647 Ga0075428_100103687
648 Ga0075428_100104754
649 Ga0075428_100387674
650 Ga0075430_100031772
651 Ga0075430_100477774
652 Ga0075431_100225578
653 Ga0075434_101137266
654 Ga0075429_100392303
655 Ga0075429_100487898
656 Ga0068865_100014680
657 Ga0068865_100210567
658 Ga0097620_100009131
659 Ga0097620_100159044
660 Ga0097620_100312342
661 Ga0097620_100477163
662 Ga0097620_101682452
663 Ga0105244_10039946
664 Ga0105240_10046691
665 Ga0111539_10000003
666 Ga0111539_10001241
667 Ga0111539_10094896
668 Ga0111539_10240919
669 Ga0111539_10614736
670 Ga0111539_11204256
671 Ga0105245_10168208
672 Ga0105245_10433605
673 Ga0105245_10739680
674 Ga0105247_10006736
675 Ga0105247_10735859
676 Ga0114129_10129709
677 Ga0114129_10313395
678 Ga0105243_10014810
679 Ga0105243_10027255
680 Ga0105241_11680209
681 Ga0105242_10029441
682 Ga0105248_10002900
683 Ga0105248_10006922
684 Ga0105248_10011506
685 Ga0105248_11619730
686 Ga0105237_10483967
687 Ga0105249_10022223
688 Ga0105239_10364391
689 Ga0105246_10105226
690 Ga0105246_12024255
691 Ga0157373_10597124
692 Ga0157371_10092624
693 Ga0157370_10019999
694 Ga0157369_10044174
695 Ga0157369_10138069
696 Ga0157374_10016939
697 Ga0157374_10075829
698 Ga0157378_10375735
699 Ga0157378_10630400
700 Ga0157378_10743661
701 Ga0157372_10002297
702 Ga0157372_10127080
703 Ga0157372_10331078
704 Ga0157375_10000028
705 Ga0157375_10040087
706 Ga0163163_10030804
707 Ga0163163_10460049
708 Ga0157380_10000625
709 Ga0157380_10241396
710 Ga0157380_10435829
711 Ga0157377_10677116
712 Ga0157379_10024020
713 Ga0157379_10705038
714 Ga0157379_10954058
715 Ga0157376_10026393
716 Ga0157376_10104559
717 Ga0163161_10448171
718 Ga0163161_10528026
719 Ga0163161_10538381
720 Ga0213876_10046497
721 Ga0213875_10139780
722 Ga0213875_10150615
723 Ga0207682_10512650
724 Ga0207692_10098278
725 Ga0207642_10081389
726 Ga0207710_10046504
727 Ga0207688_10059986
728 Ga0207680_10305270
729 Ga0207647_10054854
730 Ga0207647_10430890
731 Ga0207699_10333080
732 Ga0207645_10004115
733 Ga0207645_10022535
734 Ga0207643_10002163
735 Ga0207643_10061469
736 Ga0207684_10379118
737 Ga0207654_10327890
738 Ga0207707_10026315
739 Ga0207695_10145683
740 Ga0207671_10293573
741 Ga0207693_10002629
742 Ga0207663_10025046
743 Ga0207660_10024145
744 Ga0207662_10130893
745 Ga0207662_10386041
746 Ga0207657_10371454
747 Ga0207649_10129353
748 Ga0207649_10440668
749 Ga0207652_10218538
750 Ga0207652_10445349
751 Ga0207646_10156615
752 Ga0207681_10044151
753 Ga0207681_10204077
754 Ga0207681_10214739
755 Ga0207650_10006434
756 Ga0207659_10000001
757 Ga0207687_10166966
758 Ga0207687_10218572
759 Ga0207687_10290901
760 Ga0207664_10651359
761 Ga0207644_10089154
762 Ga0207706_10002945
763 Ga0207706_10138675
764 Ga0207706_10344209
765 Ga0207686_10006322
766 Ga0207686_10257278
767 Ga0207709_10013577
768 Ga0207709_10081737
769 Ga0207670_10257710
770 Ga0207670_10414564
771 Ga0207669_10028208
772 Ga0207669_10037701
773 Ga0207669_10285944
774 Ga0207669_10553577
775 Ga0207704_10031275
776 Ga0207704_10214504
777 Ga0207665_10001456
778 Ga0207665_10005986
779 Ga0207691_10006638
780 Ga0207691_10067744
781 Ga0207691_10075421
782 Ga0207691_10253914
783 Ga0207691_10604784
784 Ga0207711_10003614
785 Ga0207711_10006684
786 Ga0207711_10058197
787 Ga0207711_10376864
788 Ga0207689_10365807
789 Ga0207661_10230164
790 Ga0207679_10283194
791 Ga0207667_10015649
792 Ga0207667_10238678
793 Ga0207712_10039555
794 Ga0207668_10263253
795 Ga0207668_10311773
796 Ga0207640_10759918
797 Ga0207677_10321195
798 Ga0207703_10030844
799 Ga0207703_10102733
800 Ga0207639_10292761
801 Ga0207708_10000003
802 Ga0207708_10038753
803 Ga0207702_11300221
804 Ga0207641_10207073
805 Ga0207641_10584138
806 Ga0207648_10011788
807 Ga0207648_10030404
808 Ga0207648_10044198
809 Ga0207648_10045631
810 Ga0207648_10584479
811 Ga0207676_10008561
812 Ga0207676_10251040
813 Ga0207676_10268120
814 Ga0207674_10605409
815 Ga0207675_100005306
816 Ga0207675_100139437
817 Ga0207675_100165103
818 Ga0207683_10021008
819 Ga0207698_10014862
820 Ga0207698_10678359
821 Ga0210000_1013368
822 Ga0209999_1046785
823 Ga0209982_1014901
824 Ga0209970_1091145
825 Ga0209983_1003707
826 Ga0209971_1000533
827 Ga0209998_10006026
828 Ga0209974_10000765
829 Ga0207428_10000001
830 Ga0207428_10013713
831 Ga0207428_10152868
832 Ga0207428_10486877
833 Ga0268266_10162669
834 Ga0268266_11160585
835 Ga0268265_10050872
836 Ga0268265_10108567
837 Ga0268265_10334581
838 Ga0268265_12191844
839 Ga0268264_10416812
840 Ga0268264_10434651
841 Ga0268264_10686218
842 Ga0265338_10027515
843 Ga0265325_10044890
844 Ga0265325_10180702
845 Ga0265340_10007642
846 Ga0307408_100400109
847 Ga0307408_100924033
848 Ga0307413_10215436
849 Ga0307410_10180885
850 Ga0307410_11016048
851 Ga0307412_10413786
852 Ga0307409_100162649
853 Ga0307409_100640712
854 Ga0307416_100375040
855 Ga0307416_100683913
856 Ga0307416_100893158
857 Ga0307416_102672731
858 Ga0307416_102787445
859 Ga0307414_10047863
860 Ga0307414_10204437
861 Ga0307414_11604362
862 Ga0307411_10197506
863 Ga0307411_10902050
864 Ga0307415_100061183
865 Ga0307415_100331451
866 Ga0373932_0000926
867 Ga0373936_0120792
868 Ga0373939_0146407
869 Ga0373946_0005659
870 Ga0373955_0133687
871 Ga0373955_0386665
872 Ga0373942_0098679
873 Ga0373924_0344138
874 Ga0373933_0002028
875 Ga0373933_0426815
876 Ga0373937_0000429
877 Ga0373937_0427139
878 Ga0395900_0236218
879 Ga0395898_0307490
880 Ga0395905_0010998
881 Ga0395905_0933412
882 Ga0436364_0015519
883 Ga0436364_0951790
884 Ga0436364_1088246
885 Ga0436364_1225112
886 Ga0436365_0306097
887 Ga0436365_0629221
888 Ga0436365_0688458
889 Ga0436365_1352282
890 Ga0436365_1420241
891 Ga0436361_0750261
892 Ga0439453_0022260
893 Ga0450921_020865
894 Ga0439444_0059272
895 Ga0451576_1041993
896 Ga0495651_0006498
897 Ga0495651_0465739
898 Ga0495653_0255288
899 Ga0495605_0171872
900 Ga0495585_0143960
901 Ga0495640_0087006
902 Ga0495587_0000401
903 Ga0495634_0146797
904 Ga0495634_0261446
905 Ga0495611_0372567
906 Ga0495635_0041489
907 Ga0495659_0061258
908 Ga0495623_0086714
909 Ga0495623_0491496
910 Ga0495658_0055383
911 Ga0495658_0220442
912 Ga0495669_0036030
913 Ga0495669_0134411
914 Ga0495600_0032829
915 Ga0495600_0135393
916 Ga0495604_0309099
917 Ga0495680_0226737
918 Ga0495675_0001254
919 Ga0495593_0055097
920 Ga0495602_0000216
921 Ga0495602_0225216
922 Ga0496100_0114869
923 Ga0496101_0090558
924 Ga0496102_0008229
925 Ga0496102_0014118
926 Ga0496102_0277636
927 Ga0496103_0085109
928 Ga0496103_0124815
929 Ga0496104_0004887
930 Ga0496104_0035340
931 Ga0496104_0056185
932 Ga0496104_0820427
933 Ga0496105_0003396
934 Ga0496105_0034091
935 Ga0496105_0706025
936 Ga0496108_0000868
937 Ga0496108_0016862
938 Ga0496108_0137625
939 Ga0496109_0000506
940 Ga0496109_0238719
941 Ga0496109_0441552
942 Ga0496109_0738012
943 Ga0496110_0004079
944 Ga0496110_0174709
945 Ga0496110_0443200
946 Ga0496111_0022237
947 Ga0496111_0075565
948 Ga0496111_0260357
949 Ga0496112_0004976
950 Ga0496112_0045032
951 Ga0496112_0077126
952 Ga0496112_0154737
953 Ga0496112_0370414
954 Ga0496113_0000457
955 Ga0496113_0089296
956 Ga0496113_0724217
957 Ga0496113_0833593
958 Ga0496114_0032942
959 Ga0496114_0144511
960 Ga0496115_0330457
961 Ga0501036_0121804
962 Ga0501036_0547474
963 Ga0501038_1085407
964 Ga0501040_0443150
965 Ga0501041_0015842
966 Ga0501042_0003877
967 Ga0501046_0096345
968 Ga0501047_0005591
969 Ga0501068_0150780
970 Ga0501072_0017835
971 Ga0501072_1008558
972 Ga0501073_0092553
973 Ga0501073_0498990
974 Ga0501076_0017850
975 Ga0501076_1567075
976 Ga0501079_0007785
977 Ga0501080_0129142
978 Ga0501263_075177
979 Ga0501044_0336337
980 Ga0501045_0033434
981 nmdc:mga06z11_209660_c1
982 nmdc:mga06z11_363683_c1
983 nmdc:mga05p37_275029_c1
984 nmdc:mga05p37_280648_c1
985 nmdc:mga05p37_387163_c1
986 nmdc:mga05p37_611782_c1
987 nmdc:mga09592_336091_c1
988 nmdc:mga09592_734434_c1
989 nmdc:mga0qj67_467785_c1
990 nmdc:mga0qj67_4765_c1
991 nmdc:mga06r32_964361_c1
992 nmdc:mga08y16_1_c1
993 nmdc:mga08y16_383679_c1
994 nmdc:mga08y16_523847_c1
995 nmdc:mga08y16_915_c1
996 nmdc:mga0n895_183755_c1
997 Ga0495601_0253096
998 Ga0495601_0476164
999 Ga0495655_0000148
1000 Ga0495655_0040356
1001 Ga0495619_0004858
1002 Ga0495619_0028961
1003 Ga0501084_0556364
1004 Ga0590077_064259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

30

146

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9493 3 155
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9466 3 155
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9438 3 155
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9307 3 155
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.928 3 155
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.942 3 155 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.923 3 155 3.10.180.10
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.723 8 115 3.10.180.10
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7106 1 128 3.10.180.10
af_A0A1D6NQT3_395_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6912 72 125 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A435UWU8-F1-model_v4 deleted 0.9929 77 157
AF-A0A1G4T9J9-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9915 78 157 GO:0008168
GO:0032259
AF-A0A2V8C048-F1-model_v4 PhnB-like domain-containing protein 0.9905 94 157
AF-A0A258BT07-F1-model_v4 PhnB-like domain-containing protein 0.9833 1 66
AF-A0A531K413-F1-model_v4 VOC family protein 0.9818 1 60

Map