F455739

General Info

Members Datasets Scaffolds Average Seq Length
501 371 401 253

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_000022|Ga0495687_000022_268356_269264
Length 302
Sequence LIEANQQGTRPRTMQCSIARSSLERLAVLQFVQCSTQRNATQKEQPVDGYMSSKVAVITGAGRGLGRSTALKLAQQGVGIIGTWNSDAASAEAVAGEIEELGCKCAMLKLDVSRSETFSDFGDEVCKALEQTFERTNFDFLVNNAGIGVHASFVDTTPEQFDTLVDIHLKGPFFLTQTLLPYLHEEGSIVNVSSGLTRFALPGFAAYAAMKGGIEVLTRYLAKELGPHGITVNTIAPGAIETDFGGGSVRDDQDVNEFVAQNTALGRAGVPDDIGGAIAAMLSEGNRWMTAQRLEVSGGMFI

Samples

Sample ID Description Type Environment
1 2511231010 Pseudomonas sp. GM25 Isolate Nodule
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2511231024 Pseudomonas sp. GM84 Isolate Nodule
4 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
5 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
6 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
7 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
8 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
9 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
10 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
11 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
12 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
13 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
14 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
15 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
16 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
17 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
18 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
19 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
20 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
21 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
22 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
23 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
24 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
25 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
26 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
27 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
28 2643221596 Acidovorax sp. Root70 Isolate Unclassified
29 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
30 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
31 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
32 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
33 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
34 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
35 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
36 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
37 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
38 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
39 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
40 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
41 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
42 2765235841 Pseudomonas putida AA7 Isolate Unclassified
43 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
44 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
45 2773857673 Pseudomonas sp. 443 Isolate Unclassified
46 2784132063 Pseudomonas sp. 424 Isolate Unclassified
47 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
48 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
49 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
50 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
51 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
52 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
53 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
54 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
55 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
56 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
57 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
58 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
59 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
60 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
61 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
62 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
63 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
64 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
65 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
66 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
67 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
68 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
69 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
70 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
71 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
72 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
73 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
74 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
75 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
76 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
77 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
78 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
79 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
80 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
81 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
82 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
83 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
84 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
85 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
86 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
87 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
88 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
89 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
90 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
91 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
92 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
93 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
94 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
95 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
96 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
97 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
98 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
99 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
100 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
101 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
102 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
103 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
104 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
105 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
106 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
107 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
108 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
109 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
110 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
111 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
112 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
113 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
114 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
115 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
116 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
117 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
118 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
119 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
120 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
121 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
122 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
123 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
124 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
125 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
126 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
132 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
153 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
162 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
163 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
166 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
167 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
196 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
203 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
204 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
205 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
215 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
216 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
234 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
296 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
310 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
311 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
339 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
340 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
341 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
342 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
343 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
344 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
345 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
346 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
347 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
351 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
352 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
353 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
356 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
357 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
358 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
359 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
360 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
361 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
362 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
363 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
364 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
365 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
366 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
367 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
368 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
369 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
370 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
371 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.64
Metatranscriptomes 0.4
Isolates 19.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.77
Nodule 4.39
Rhizoplane 3.19
Rhizosphere 63.67
Stem 0
Stem Tuber 0
Unclassified 14.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000819 3300000546 Bacteria 5141
2 JGI24735J21928_10000354 3300002067 Bacteria 15957
3 JGI25162J39368_1001014 3300002737 Bacteria 17524
4 JGI25164J39214_1000217 3300002772 Bacteria 46995
5 JGI25165J46597_1000453 3300003214 Bacteria 41271
6 rootH1_10008883 3300003316 Bacteria 3839
7 rootH1_10102956 3300003316 Bacteria 2540
8 rootL2_10072587 3300003322 Bacteria 6089
9 rootH1_10168422 3300003323 Bacteria 2484
10 rootH1_10304896 3300003323 Bacteria 3007
11 Ga0055538_1000002 3300003751 Bacteria 999437
12 Ga0055539_1000002 3300003752 Bacteria 999437
13 Ga0055533_1000004 3300003756 Bacteria 999437
14 Ga0055525_1000002 3300003759 Bacteria 999437
15 Ga0055527_1003396 3300003760 Bacteria 2381
16 Ga0055535_1000615 3300003761 Bacteria 29107
17 Ga0055542_1000147 3300003762 Bacteria 88503
18 Ga0055542_1000619 3300003762 Bacteria 30088
19 Ga0055529_1000116 3300003763 Bacteria 117929
20 Ga0055536_1003931 3300003781 Bacteria 7792
21 Ga0055541_1000002 3300003841 Bacteria 896405
22 Ga0058692_1014932 3300003856 Bacteria 1764
23 Ga0058692_1029743 3300003856 Bacteria 1043
24 Ga0055543_1006402 3300004625 Bacteria 2850
25 Ga0070658_10175099 3300005327 Bacteria 1804
26 Ga0070680_100187425 3300005336 Bacteria 1743
27 Ga0070682_100045132 3300005337 Bacteria 2731
28 Ga0070661_100142814 3300005344 Bacteria 1805
29 Ga0070661_100238376 3300005344 Bacteria 1400
30 Ga0070669_100021771 3300005353 Bacteria 4584
31 Ga0070667_100000251 3300005367 Bacteria 60913
32 Ga0070667_100102908 3300005367 Bacteria 2468
33 Ga0070713_100531819 3300005436 Bacteria 1112
34 Ga0070710_10297837 3300005437 Bacteria 1052
35 Ga0070711_100028860 3300005439 Bacteria 3654
36 Ga0070663_100026361 3300005455 Bacteria 3937
37 Ga0070663_100315397 3300005455 Bacteria 1256
38 Ga0070678_100060386 3300005456 Bacteria 2790
39 Ga0070662_100045527 3300005457 Bacteria 3148
40 Ga0070662_100574704 3300005457 Bacteria 946
41 Ga0070681_10180441 3300005458 Bacteria 2033
42 Ga0068867_100000302 3300005459 Bacteria 32474
43 Ga0070707_100252504 3300005468 Bacteria 1716
44 Ga0070698_100014619 3300005471 Bacteria 8294
45 Ga0070699_100140153 3300005518 Bacteria 2135
46 Ga0070679_100049681 3300005530 Bacteria 4177
47 Ga0068853_100007420 3300005539 Bacteria 8774
48 Ga0068853_100392269 3300005539 Bacteria 1298
49 Ga0070693_100309746 3300005547 Bacteria 1067
50 Ga0070665_100246746 3300005548 Bacteria 1786
51 Ga0070665_100269519 3300005548 Bacteria 1704
52 Ga0068855_100000055 3300005563 Bacteria 136099
53 Ga0068855_100012086 3300005563 Bacteria 10434
54 Ga0068855_100294757 3300005563 Bacteria 1797
55 Ga0068856_100452951 3300005614 Bacteria 1304
56 Ga0068856_101039822 3300005614 Bacteria 837
57 Ga0068860_100403390 3300005843 Bacteria 1353
58 Ga0075364_10009094 3300006051 Bacteria 5951
59 Ga0070716_100001017 3300006173 Bacteria 12283
60 Ga0070712_100050578 3300006175 Bacteria 2892
61 Ga0075366_10161138 3300006195 Bacteria 1359
62 Ga0075370_10330774 3300006353 Bacteria 908
63 Ga0075431_100013464 3300006847 Bacteria 8261
64 Ga0079104_1000527 3300006946 Bacteria 40639
65 Ga0105244_10001221 3300009036 Bacteria 21066
66 Ga0105244_10020914 3300009036 Bacteria 3626
67 Ga0105240_10000086 3300009093 Bacteria 188623
68 Ga0105240_10000105 3300009093 Bacteria 172035
69 Ga0105240_10004624 3300009093 Bacteria 20868
70 Ga0105240_10172361 3300009093 Bacteria 2561
71 Ga0105240_10188112 3300009093 Bacteria 2430
72 Ga0105245_10000102 3300009098 Bacteria 82611
73 Ga0105243_10000444 3300009148 Bacteria 43105
74 Ga0105241_10066868 3300009174 Bacteria 2781
75 Ga0105241_10499252 3300009174 Bacteria 1085
76 Ga0105237_10001124 3300009545 Bacteria 35879
77 Ga0105237_10020043 3300009545 Bacteria 6903
78 Ga0105237_10164968 3300009545 Bacteria 2214
79 Ga0105237_10321101 3300009545 Bacteria 1552
80 Ga0105238_10040073 3300009551 Bacteria 4748
81 Ga0105238_10041794 3300009551 Bacteria 4643
82 Ga0105238_10093526 3300009551 Bacteria 2994
83 Ga0099796_10070933 3300010159 Bacteria 1258
84 Ga0105239_10001195 3300010375 Bacteria 35500
85 Ga0105239_10070439 3300010375 Bacteria 3841
86 Ga0105239_10091400 3300010375 Bacteria 3359
87 Ga0157369_10061441 3300013105 Bacteria 4050
88 Ga0163162_10000425 3300013306 Bacteria 38967
89 Ga0157372_10101090 3300013307 Bacteria 3291
90 Ga0157375_10000392 3300013308 Bacteria 39867
91 Ga0157375_10763003 3300013308 Bacteria 1118
92 Ga0157377_10000097 3300014745 Bacteria 62513
93 Ga0182006_1004778 3300015261 Bacteria 6600
94 Ga0163161_10041418 3300017792 Bacteria 3310
95 Ga0213872_10000286 3300021361 Bacteria 43221
96 Ga0213872_10005608 3300021361 Bacteria 6411
97 Ga0213872_10013145 3300021361 Bacteria 3881
98 Ga0209435_110622 3300025206 Bacteria 995
99 Ga0209784_100002 3300025224 Bacteria 1753105
100 Ga0209566_100003 3300025225 Bacteria 1753105
101 Ga0209674_100004 3300025226 Bacteria 1753105
102 Ga0209674_100556 3300025226 Bacteria 14827
103 Ga0209674_107256 3300025226 Bacteria 1417
104 Ga0209672_100045 3300025228 Bacteria 264926
105 Ga0209672_100207 3300025228 Bacteria 46534
106 Ga0209563_100006 3300025230 Bacteria 1753105
107 Ga0207427_100228 3300025231 Bacteria 47076
108 Ga0209437_100370 3300025233 Bacteria 47076
109 Ga0209437_101529 3300025233 Bacteria 5432
110 Ga0209258_100111 3300025242 Bacteria 197019
111 Ga0209258_100200 3300025242 Bacteria 123379
112 Ga0209646_1000702 3300025246 Bacteria 12015
113 Ga0209026_1000589 3300025250 Bacteria 23701
114 Ga0209677_100003 3300025253 Bacteria 1753105
115 Ga0209148_1000045 3300025254 Bacteria 448076
116 Ga0209148_1000099 3300025254 Bacteria 227713
117 Ga0209148_1001448 3300025254 Bacteria 12048
118 Ga0209759_1000247 3300025256 Bacteria 80850
119 Ga0209233_1000336 3300025261 Bacteria 47076
120 Ga0209455_1000035 3300025272 Bacteria 479071
121 Ga0209455_1026699 3300025272 Bacteria 1033
122 Ga0209130_1033067 3300025284 Bacteria 1050
123 Ga0209676_1000034 3300025292 Bacteria 460125
124 Ga0209050_1005127 3300025298 Bacteria 8414
125 Ga0209256_1000143 3300025299 Bacteria 151331
126 Ga0207426_1014646 3300025302 Bacteria 2868
127 Ga0209051_1026369 3300025303 Bacteria 2343
128 Ga0207655_1001378 3300025728 Bacteria 22725
129 Ga0207655_1023687 3300025728 Bacteria 3035
130 Ga0207692_10056550 3300025898 Bacteria 2013
131 Ga0207707_10508257 3300025912 Bacteria 1027
132 Ga0207695_10000175 3300025913 Bacteria 188658
133 Ga0207695_10000193 3300025913 Bacteria 172070
134 Ga0207695_10026518 3300025913 Bacteria 6468
135 Ga0207695_10037034 3300025913 Bacteria 5266
136 Ga0207695_10305684 3300025913 Bacteria 1481
137 Ga0207695_10421063 3300025913 Bacteria 1220
138 Ga0207695_10720142 3300025913 Bacteria 878
139 Ga0207671_10002219 3300025914 Bacteria 21074
140 Ga0207671_10066307 3300025914 Bacteria 2687
141 Ga0207671_10169161 3300025914 Bacteria 1696
142 Ga0207663_10026425 3300025916 Bacteria 3369
143 Ga0207657_10266483 3300025919 Bacteria 1362
144 Ga0207652_10361335 3300025921 Bacteria 1310
145 Ga0207646_10045746 3300025922 Bacteria 3928
146 Ga0207687_10008994 3300025927 Bacteria 6528
147 Ga0207709_10002441 3300025935 Bacteria 11672
148 Ga0207665_10002541 3300025939 Bacteria 12272
149 Ga0207667_10000032 3300025949 Bacteria 322253
150 Ga0207667_10137503 3300025949 Bacteria 2516
151 Ga0207667_10211609 3300025949 Bacteria 1987
152 Ga0207667_10313024 3300025949 Bacteria 1604
153 Ga0207658_10074330 3300025986 Bacteria 2582
154 Ga0207639_10036111 3300026041 Bacteria 3660
155 Ga0207678_10040393 3300026067 Bacteria 4047
156 Ga0207702_10419796 3300026078 Bacteria 1293
157 Ga0207648_10000471 3300026089 Bacteria 44936
158 Ga0207676_10155315 3300026095 Bacteria 1976
159 Ga0207674_10317344 3300026116 Bacteria 1508
160 Ga0207683_10110824 3300026121 Bacteria 2457
161 Ga0209281_1004131 3300027111 Bacteria 4449
162 Ga0209371_1000543 3300027312 Bacteria 35406
163 Ga0209371_1007320 3300027312 Bacteria 3869
164 Ga0265354_1001650 3300028016 Bacteria 3102
165 Ga0268266_10278533 3300028379 Bacteria 1554
166 Ga0268264_10163344 3300028381 Bacteria 2008
167 Ga0307515_10001082 3300028794 Bacteria 62350
168 Ga0307515_10004543 3300028794 Bacteria 28621
169 Ga0307515_10015316 3300028794 Bacteria 14135
170 Ga0307515_10126894 3300028794 Bacteria 2841
171 Ga0307515_10263107 3300028794 Bacteria 1458
172 Ga0265338_10299641 3300028800 Bacteria 1169
173 Ga0268256_1000223 3300030500 Bacteria 62142
174 Ga0268256_1007511 3300030500 Bacteria 3869
175 Ga0307511_10094736 3300030521 Bacteria 1999
176 Ga0307512_10094973 3300030522 Bacteria 2054
177 Ga0307512_10206620 3300030522 Bacteria 1052
178 Ga0265770_1001999 3300030878 Bacteria 2776
179 Ga0265760_10009511 3300031090 Bacteria 2776
180 Ga0265328_10019344 3300031239 Bacteria 2617
181 Ga0265325_10036504 3300031241 Bacteria 2602
182 Ga0265325_10049366 3300031241 Bacteria 2171
183 Ga0265331_10000259 3300031250 Bacteria 60879
184 Ga0265327_10000595 3300031251 Bacteria 60289
185 Ga0265327_10001925 3300031251 Bacteria 23968
186 Ga0307513_10394370 3300031456 Bacteria 1120
187 Ga0307509_10033984 3300031507 Bacteria 5607
188 Ga0307509_10190428 3300031507 Bacteria 1903
189 Ga0307408_100000288 3300031548 Bacteria 49765
190 Ga0307508_10000134 3300031616 Bacteria 87501
191 Ga0307514_10008162 3300031649 Bacteria 8945
192 Ga0316576_10061913 3300031727 Unclassified 2743
193 Ga0307516_10045709 3300031730 Bacteria 4323
194 Ga0307406_10001222 3300031901 Bacteria 14379
195 Ga0307411_10499270 3300032005 Bacteria 1028
196 Ga0307415_100659752 3300032126 Bacteria 939
197 Ga0373943_0264730 3300035170 Bacteria 969
198 Ga0316574_0261259 3300035398 Bacteria 1105
199 Ga0373931_0002162 3300035691 Bacteria 8660
200 Ga0373933_0276601 3300035724 Bacteria 1084
201 Ga0316584_0165202 3300036712 Unclassified 1644
202 Ga0395899_0000218 3300037312 Bacteria 79718
203 Ga0395899_0031757 3300037312 Bacteria 3968
204 Ga0395899_0094515 3300037312 Bacteria 2163
205 Ga0395898_0002578 3300037466 Bacteria 21226
206 Ga0436361_0034970 3300039447 Bacteria 88532
207 Ga0436361_0121645 3300039447 Bacteria 1632
208 Ga0436361_0144002 3300039447 Bacteria 44507
209 Ga0436361_0695818 3300039447 Bacteria 1415
210 Ga0436361_0835614 3300039447 Bacteria 2174
211 Ga0436361_1002267 3300039447 Bacteria 2118
212 Ga0436361_1065176 3300039447 Bacteria 3339
213 Ga0436361_1143736 3300039447 Bacteria 8992
214 Ga0451839_1416864 3300041496 Bacteria 892
215 Ga0451849_0319413 3300041505 Bacteria 2636
216 Ga0451853_0033037 3300041512 Bacteria 2073
217 Ga0439455_0019102 3300042012 Bacteria 1613
218 Ga0450898_018758 3300042134 Bacteria 1201
219 Ga0450904_000381 3300042139 Bacteria 9191
220 Ga0451577_0005030 3300042876 Bacteria 13670
221 Ga0451577_0108375 3300042876 Bacteria 2483
222 Ga0466969_0000028 3300044656 Bacteria 92394
223 Ga0466969_0019528 3300044656 Bacteria 3521
224 Ga0466982_0000061 3300044672 Bacteria 29699
225 Ga0466982_0000083 3300044672 Bacteria 24784
226 Ga0453683_0052298 3300044673 Bacteria 2557
227 Ga0466965_0016849 3300044683 Bacteria 3485
228 Ga0466965_0017451 3300044683 Bacteria 3431
229 Ga0466965_0055885 3300044683 Bacteria 1965
230 Ga0466966_0003861 3300044684 Bacteria 9890
231 Ga0466966_0115988 3300044684 Bacteria 1648
232 Ga0466961_0001799 3300044693 Bacteria 13281
233 Ga0466961_0008699 3300044693 Bacteria 6471
234 Ga0466961_0058367 3300044693 Bacteria 2455
235 Ga0466961_0116553 3300044693 Bacteria 1678
236 Ga0466964_0022819 3300044706 Bacteria 2430
237 Ga0453684_0006276 3300044712 Bacteria 22752
238 Ga0453684_0341856 3300044712 Bacteria 1689
239 Ga0466968_0000746 3300044735 Bacteria 11288
240 Ga0466968_0229604 3300044735 Bacteria 876
241 Ga0466970_0008292 3300044765 Bacteria 5225
242 Ga0466970_0043780 3300044765 Bacteria 2383
243 Ga0466970_0066109 3300044765 Bacteria 1941
244 Ga0466959_0071596 3300045049 Bacteria 2510
245 Ga0466959_0132703 3300045049 Bacteria 1764
246 Ga0451576_0003410 3300045051 Bacteria 21876
247 Ga0466958_0001479 3300045836 Bacteria 11202
248 Ga0466958_0047730 3300045836 Bacteria 2585
249 Ga0466958_0161979 3300045836 Bacteria 1413
250 Ga0466967_0811477 3300045976 Bacteria 929
251 Ga0495617_076544 3300046452 Bacteria 1098
252 Ga0495627_032179 3300046453 Bacteria 1651
253 Ga0495603_0076741 3300046455 Bacteria 1961
254 Ga0495591_000521 3300046458 Bacteria 30106
255 Ga0495591_003555 3300046458 Bacteria 7967
256 Ga0495629_0009293 3300046459 Bacteria 7193
257 Ga0495638_0001696 3300046460 Bacteria 19401
258 Ga0495638_0020246 3300046460 Bacteria 4395
259 Ga0495638_0027004 3300046460 Bacteria 3718
260 Ga0495650_0007105 3300046471 Bacteria 6800
261 Ga0495580_0249174 3300046472 Bacteria 1216
262 Ga0495582_0073770 3300046473 Bacteria 1889
263 Ga0495605_0000002 3300046474 Bacteria 522417
264 Ga0495605_0009951 3300046474 Bacteria 5328
265 Ga0495664_0004099 3300046477 Bacteria 7955
266 Ga0495584_0024529 3300046491 Bacteria 3059
267 Ga0495585_0002302 3300046492 Bacteria 13757
268 Ga0495594_0004561 3300046499 Bacteria 7129
269 Ga0495583_0000012 3300046506 Bacteria 324839
270 Ga0495583_0015092 3300046506 Bacteria 4221
271 Ga0495606_0004301 3300046507 Bacteria 14338
272 Ga0495606_0019485 3300046507 Bacteria 5045
273 Ga0495606_0137104 3300046507 Bacteria 1448
274 Ga0495606_0167228 3300046507 Bacteria 1278
275 Ga0495610_0035738 3300046512 Bacteria 2547
276 Ga0495620_0000238 3300046515 Bacteria 41133
277 Ga0495620_0151332 3300046515 Bacteria 904
278 Ga0495628_0118011 3300046516 Bacteria 2037
279 Ga0495630_0130077 3300046517 Bacteria 1912
280 Ga0495631_0010865 3300046518 Bacteria 4497
281 Ga0495632_0014166 3300046519 Bacteria 4522
282 Ga0495637_0117310 3300046520 Bacteria 1027
283 Ga0495643_0000084 3300046522 Bacteria 158427
284 Ga0495643_0000987 3300046522 Bacteria 29153
285 Ga0495643_0009058 3300046522 Bacteria 6241
286 Ga0495648_0003416 3300046524 Bacteria 13957
287 Ga0495666_0026566 3300046526 Bacteria 2852
288 Ga0495642_0005114 3300046528 Bacteria 5051
289 Ga0495652_0094252 3300046529 Bacteria 2442
290 Ga0495652_0351369 3300046529 Bacteria 1056
291 Ga0495654_0000283 3300046530 Bacteria 46130
292 Ga0495654_0058767 3300046530 Bacteria 1854
293 Ga0495586_0040428 3300046535 Bacteria 2508
294 Ga0495587_0077445 3300046536 Bacteria 1930
295 Ga0495598_0013242 3300046537 Bacteria 2040
296 Ga0495609_0000008 3300046538 Bacteria 383025
297 Ga0495621_0006438 3300046539 Bacteria 3427
298 Ga0495597_0087109 3300046542 Bacteria 1329
299 Ga0495597_0137277 3300046542 Bacteria 1010
300 Ga0495622_0033634 3300046557 Bacteria 2392
301 Ga0495633_0000009 3300046558 Bacteria 293183
302 Ga0495656_0083878 3300046615 Bacteria 1444
303 Ga0495634_0277505 3300046642 Bacteria 1019
304 Ga0495611_0000010 3300046648 Bacteria 156661
305 Ga0495611_0000555 3300046648 Bacteria 21770
306 Ga0495611_0228611 3300046648 Bacteria 865
307 Ga0495625_0014561 3300046660 Bacteria 6270
308 Ga0495625_0036734 3300046660 Bacteria 3598
309 Ga0495625_0108245 3300046660 Bacteria 1901
310 Ga0495661_0000029 3300046665 Bacteria 173899
311 Ga0495661_0009314 3300046665 Bacteria 6741
312 Ga0495623_0271144 3300046679 Bacteria 947
313 Ga0495669_0006744 3300046684 Bacteria 4804
314 Ga0495624_0096708 3300046690 Bacteria 1819
315 Ga0495624_0176295 3300046690 Bacteria 1303
316 Ga0495670_0032487 3300046691 Bacteria 2596
317 Ga0495670_0077899 3300046691 Bacteria 1685
318 Ga0495670_0115701 3300046691 Bacteria 1390
319 Ga0495671_0007125 3300046692 Bacteria 6404
320 Ga0495671_0007969 3300046692 Bacteria 5989
321 Ga0495649_0002723 3300046694 Bacteria 12307
322 Ga0495649_0005625 3300046694 Bacteria 7923
323 Ga0495649_0085782 3300046694 Bacteria 1681
324 Ga0495649_0133284 3300046694 Bacteria 1310
325 Ga0495589_0000579 3300046794 Bacteria 25243
326 Ga0495589_0003295 3300046794 Bacteria 8762
327 Ga0495600_0199742 3300046809 Bacteria 1284
328 Ga0495660_0001737 3300046810 Bacteria 14559
329 Ga0495660_0093737 3300046810 Bacteria 1556
330 Ga0495604_0151724 3300047317 Bacteria 1646
331 Ga0495674_0052443 3300047319 Bacteria 3589
332 Ga0495672_0083437 3300047320 Bacteria 1775
333 Ga0495680_0028864 3300047322 Bacteria 4546
334 Ga0495680_0125163 3300047322 Bacteria 1894
335 Ga0495683_0000039 3300047323 Bacteria 137702
336 Ga0495683_0123120 3300047323 Bacteria 1229
337 Ga0495687_000022 3300047443 Bacteria 327353
338 Ga0495675_0221626 3300047444 Bacteria 1144
339 Ga0495677_0002850 3300047445 Bacteria 6735
340 Ga0495679_000160 3300047446 Bacteria 61002
341 Ga0495673_0007499 3300047469 Bacteria 6259
342 Ga0495681_0004251 3300047470 Bacteria 9822
343 Ga0495681_0068106 3300047470 Bacteria 1620
344 Ga0495686_0138292 3300047472 Bacteria 1439
345 Ga0495593_0036087 3300047673 Bacteria 2682
346 Ga0495593_0064278 3300047673 Bacteria 1915
347 Ga0495602_0107686 3300048088 Bacteria 2271
348 Ga0495602_0116704 3300048088 Bacteria 2156
349 Ga0495602_0131600 3300048088 Bacteria 1994
350 Ga0495614_0118778 3300048089 Bacteria 1165
351 Ga0496100_0002671 3300048903 Bacteria 9087
352 Ga0496101_0006867 3300048904 Bacteria 7347
353 Ga0496102_0049582 3300048905 Bacteria 3820
354 Ga0496107_0126217 3300048910 Bacteria 1887
355 Ga0496109_0005041 3300048912 Bacteria 11035
356 Ga0496110_0739749 3300048913 Bacteria 886
357 Ga0496114_0111176 3300048917 Bacteria 2348
358 Ga0496115_0033193 3300048918 Bacteria 4074
359 Ga0496115_0059499 3300048918 Bacteria 3077
360 Ga0496120_0039924 3300048923 Bacteria 2763
361 Ga0496120_0253578 3300048923 Bacteria 825
362 Ga0496121_0020713 3300048924 Bacteria 6486
363 Ga0496121_0268183 3300048924 Bacteria 1175
364 Ga0496124_0493947 3300048927 Bacteria 822
365 Ga0496125_0004319 3300048928 Bacteria 16501
366 Ga0496126_0009096 3300048929 Bacteria 10610
367 Ga0496126_0347493 3300048929 Bacteria 1214
368 Ga0496126_0423550 3300048929 Bacteria 1076
369 Ga0495678_000011 3300049459 Bacteria 335512
370 Ga0501077_0083438 3300049593 Bacteria 2025
371 Ga0501279_022452 3300049775 Bacteria 906
372 Ga0501035_0120412 3300049822 Bacteria 2295
373 Ga0501044_0000336 3300049823 Bacteria 59417
374 nmdc:mga00v17_6399_c1 3300050491 Bacteria 6245
375 nmdc:mga0k408_118853_c1 3300050493 Bacteria 1565
376 nmdc:mga0k408_217142_c1 3300050493 Bacteria 1142
377 nmdc:mga07m45_258048_c1 3300050496 Bacteria 1014
378 nmdc:mga06r32_176219_c1 3300050510 Bacteria 2123
379 Ga0500644_0001205 3300053088 Bacteria 7290
380 Ga0500644_0004953 3300053088 Bacteria 3350
381 Ga0500651_0038530 3300053093 Bacteria 3011
382 Ga0500556_0018971 3300053104 Unclassified 2180
383 Ga0500562_000013 3300053108 Bacteria 150003
384 Ga0500569_126296 3300053109 Bacteria 854
385 Ga0500594_0003066 3300053118 Bacteria 3657
386 Ga0500618_050386 3300053125 Bacteria 943
387 Ga0500658_0155102 3300053134 Bacteria 1034
388 Ga0500559_0000133 3300053136 Bacteria 56972
389 Ga0500559_0002144 3300053136 Bacteria 10501
390 Ga0500559_0008868 3300053136 Bacteria 4380
391 Ga0500559_0166938 3300053136 Bacteria 1035
392 Ga0500568_0062735 3300053139 Bacteria 1435
393 Ga0500616_0003799 3300053153 Bacteria 11210
394 Ga0500616_0014394 3300053153 Bacteria 4546
395 Ga0500622_0181110 3300053156 Bacteria 973
396 Ga0500634_0018370 3300053161 Bacteria 3755
397 Ga0500636_0008922 3300053177 Bacteria 5821
398 Ga0500645_064222 3300053730 Bacteria 1059
399 Ga0500587_008835 3300053739 Bacteria 1293
400 Ga0466962_0008179 3300061719 Bacteria 5017
401 Ga0466962_0010934 3300061719 Bacteria 4365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053109 Ga0500569_126296 Ga0500569_126296_182_805 207
2 3300005518 Ga0070699_100140153 Ga0070699_1001401531 208
3 3300025949 Ga0207667_10137503 Ga0207667_101375032 232
4 3300002067 JGI24735J21928_10000354 JGI24735J21928_1000035410 236
5 3300005327 Ga0070658_10175099 Ga0070658_101750992 236
6 3300005344 Ga0070661_100142814 Ga0070661_1001428142 236
7 3300005455 Ga0070663_100315397 Ga0070663_1003153972 236
8 3300025206 Ga0209435_110622 Ga0209435_1106221 239
9 3300041496 Ga0451839_1416864 Ga0451839_1416864_69_827 242
10 3300025912 Ga0207707_10508257 Ga0207707_105082571 244
11 3300046452 Ga0495617_076544 Ga0495617_076544_98_835 244
12 3300048927 Ga0496124_0493947 Ga0496124_0493947_74_811 244
13 iso_pu_bacteria 2739367756 2739792700 244
14 3300046694 Ga0495649_0002723 Ga0495649_0002723_12_752 245
15 3300005336 Ga0070680_100187425 Ga0070680_1001874252 246
16 3300005458 Ga0070681_10180441 Ga0070681_101804412 246
17 3300005530 Ga0070679_100049681 Ga0070679_1000496816 246
18 3300005563 Ga0068855_100294757 Ga0068855_1002947572 246
19 3300009098 Ga0105245_10000102 Ga0105245_1000010224 246
20 3300025921 Ga0207652_10361335 Ga0207652_103613351 246
21 3300025927 Ga0207687_10008994 Ga0207687_100089944 246
22 iso_pu_bacteria 2511231010 2511287882 246
23 iso_pu_bacteria 2511231011 2511294897 246
24 iso_pu_bacteria 2600255318 2601796591 246
25 iso_pu_bacteria 2603880185 2606073741 246
26 iso_pu_bacteria 2603880199 2606126615 246
27 iso_pu_bacteria 2623620443 2624482291 246
28 iso_pu_bacteria 2713897149 2715755321 246
29 iso_pu_bacteria 2773857673 2774133174 246
30 iso_pu_bacteria 2784132063 2784262968 246
31 iso_pu_bacteria 2818991456 2819655967 246
32 iso_pu_bacteria 2852657418 2852661205 246
33 iso_pu_bacteria 2878029506 2878034215 246
34 iso_pu_bacteria 2880230671 2880234837 246
35 iso_pu_bacteria 2904518522 2904522304 246
36 iso_pu_bacteria 2919063839 2919066723 246
37 iso_pu_bacteria 3007718800 3007721015 246
38 iso_pu_bacteria 8056569372 8056574885 246
39 3300046507 Ga0495606_0137104 Ga0495606_0137104_245_1027 247
40 iso_pu_bacteria 2511231024 2511376691 247
41 iso_pu_bacteria 2554235231 2555249316 247
42 iso_pu_bacteria 2585428062 2587758250 247
43 iso_pu_bacteria 2597489888 2597865552 247
44 iso_pu_bacteria 2599185288 2599882112 247
45 iso_pu_bacteria 2599185303 2599949989 247
46 iso_pu_bacteria 2600254954 2600442411 247
47 iso_pu_bacteria 2600255389 2602009628 247
48 iso_pu_bacteria 2619619299 2621297952 247
49 iso_pu_bacteria 2643221713 2644625004 247
50 iso_pu_bacteria 2675903420 2677901204 247
51 iso_pu_bacteria 2738541265 2738670692 247
52 iso_pu_bacteria 2738541282 2738749085 247
53 iso_pu_bacteria 2738541294 2738811570 247
54 iso_pu_bacteria 2738541303 2738858127 247
55 iso_pu_bacteria 2738541309 2738898930 247
56 iso_pu_bacteria 2738543020 2739285829 247
57 iso_pu_bacteria 2738543021 2739291142 247
58 iso_pu_bacteria 2765235841 2765585588 247
59 iso_pu_bacteria 2806310737 2807407023 247
60 iso_pu_bacteria 2806310745 2807455355 247
61 iso_pu_bacteria 2808606385 2808979537 247
62 iso_pu_bacteria 2808606388 2808995193 247
63 iso_pu_bacteria 2816332298 2817492911 247
64 iso_pu_bacteria 2842805378 2842807419 247
65 iso_pu_bacteria 2852612431 2852612702 247
66 iso_pu_bacteria 2852667396 2852669562 247
67 iso_pu_bacteria 2908446538 2908451474 247
68 iso_pu_bacteria 2912963787 2912967829 247
69 iso_pu_bacteria 2919493220 2919493252 247
70 iso_pu_bacteria 2919543075 2919543123 247
71 iso_pu_bacteria 2923525760 2923528358 247
72 iso_pu_bacteria 2946027586 2946032574 247
73 iso_pu_bacteria 3007803356 3007804181 247
74 iso_pu_bacteria 8011350971 8011353996 247
75 iso_pu_bacteria 8054285046 8054291076 247
76 iso_pu_bacteria 8054503363 8054507888 247
77 iso_pu_bacteria 8054929484 8054932756 247
78 iso_pu_bacteria 8055878733 8055882644 247
79 iso_pu_bacteria 8056120720 8056124713 247
80 iso_pu_bacteria 8056131705 8056136254 247
81 iso_pu_bacteria 8056137416 8056138689 247
82 iso_pu_bacteria 8056161164 8056162514 247
83 iso_pu_bacteria 8057304971 8057307943 247
84 3300003323 rootH1_10168422 rootH1_101684224 248
85 3300053139 Ga0500568_0062735 Ga0500568_0062735_548_1306 248
86 iso_pu_bacteria 2834641062 2834645182 248
87 iso_pu_bacteria 2929189879 2929194068 248
88 iso_pu_bacteria 8003400568 8003403601 248
89 3300025913 Ga0207695_10720142 Ga0207695_107201421 249
90 3300028016 Ga0265354_1001650 Ga0265354_10016502 249
91 3300030878 Ga0265770_1001999 Ga0265770_10019992 249
92 3300031090 Ga0265760_10009511 Ga0265760_100095112 249
93 3300031241 Ga0265325_10036504 Ga0265325_100365042 249
94 iso_pu_bacteria 2537561836 2538832439 249
95 iso_pu_bacteria 2643221579 2643908922 249
96 iso_pu_bacteria 2767802112 2768646689 249
97 iso_pu_bacteria 2849281842 2849285879 249
98 iso_pu_bacteria 2857627736 2857631068 249
99 iso_pu_bacteria 2946019816 2946021834 249
100 3300003316 rootH1_10102956 rootH1_101029562 250
101 3300003322 rootL2_10072587 rootL2_100725873 250
102 3300003323 rootH1_10304896 rootH1_103048964 250
103 3300003781 Ga0055536_1003931 Ga0055536_10039315 250
104 3300005353 Ga0070669_100021771 Ga0070669_1000217713 250
105 3300005457 Ga0070662_100045527 Ga0070662_1000455274 250
106 3300005539 Ga0068853_100007420 Ga0068853_1000074209 250
107 3300009093 Ga0105240_10000086 Ga0105240_1000008689 250
108 3300009093 Ga0105240_10000105 Ga0105240_1000010594 250
109 3300009174 Ga0105241_10066868 Ga0105241_100668681 250
110 3300009545 Ga0105237_10001124 Ga0105237_100011247 250
111 3300009545 Ga0105237_10164968 Ga0105237_101649683 250
112 3300009551 Ga0105238_10041794 Ga0105238_100417945 250
113 3300010375 Ga0105239_10001195 Ga0105239_100011957 250
114 3300010375 Ga0105239_10070439 Ga0105239_100704395 250
115 3300025292 Ga0209676_1000034 Ga0209676_100003485 250
116 3300025913 Ga0207695_10000175 Ga0207695_1000017556 250
117 3300025913 Ga0207695_10000193 Ga0207695_1000019344 250
118 3300025913 Ga0207695_10421063 Ga0207695_104210632 250
119 3300025914 Ga0207671_10002219 Ga0207671_1000221911 250
120 3300025914 Ga0207671_10169161 Ga0207671_101691612 250
121 3300026041 Ga0207639_10036111 Ga0207639_100361115 250
122 3300042012 Ga0439455_0019102 Ga0439455_0019102_465_1220 250
123 3300042139 Ga0450904_000381 Ga0450904_000381_3358_4113 250
124 3300042876 Ga0451577_0108375 Ga0451577_0108375_66_830 250
125 3300044673 Ga0453683_0052298 Ga0453683_0052298_1143_1907 250
126 3300044683 Ga0466965_0055885 Ga0466965_0055885_993_1757 250
127 3300044706 Ga0466964_0022819 Ga0466964_0022819_835_1599 250
128 3300044712 Ga0453684_0341856 Ga0453684_0341856_324_1088 250
129 3300044735 Ga0466968_0229604 Ga0466968_0229604_60_824 250
130 3300044765 Ga0466970_0043780 Ga0466970_0043780_1001_1765 250
131 3300045051 Ga0451576_0003410 Ga0451576_0003410_18097_18861 250
132 3300046522 Ga0495643_0000987 Ga0495643_0000987_12446_13201 250
133 3300046648 Ga0495611_0000010 Ga0495611_0000010_97184_97948 250
134 3300046660 Ga0495625_0036734 Ga0495625_0036734_2712_3467 250
135 3300048912 Ga0496109_0005041 Ga0496109_0005041_10235_11005 250
136 3300048913 Ga0496110_0739749 Ga0496110_0739749_38_808 250
137 3300048923 Ga0496120_0039924 Ga0496120_0039924_1213_2022 250
138 3300048929 Ga0496126_0423550 Ga0496126_0423550_239_1003 250
139 3300053088 Ga0500644_0004953 Ga0500644_0004953_638_1393 250
140 3300053108 Ga0500562_000013 Ga0500562_000013_82856_83611 250
141 3300053136 Ga0500559_0002144 Ga0500559_0002144_7087_7854 250
142 3300053136 Ga0500559_0008868 Ga0500559_0008868_2735_3502 250
143 3300053153 Ga0500616_0003799 Ga0500616_0003799_8743_9561 250
144 3300000546 LJNas_1000819 LJNas_10008192 251
145 3300002737 JGI25162J39368_1001014 JGI25162J39368_10010142 251
146 3300002772 JGI25164J39214_1000217 JGI25164J39214_100021717 251
147 3300003214 JGI25165J46597_1000453 JGI25165J46597_100045328 251
148 3300003316 rootH1_10008883 rootH1_100088835 251
149 3300003751 Ga0055538_1000002 Ga0055538_100000228 251
150 3300003752 Ga0055539_1000002 Ga0055539_100000228 251
151 3300003756 Ga0055533_1000004 Ga0055533_100000428 251
152 3300003759 Ga0055525_1000002 Ga0055525_100000228 251
153 3300003760 Ga0055527_1003396 Ga0055527_10033962 251
154 3300003761 Ga0055535_1000615 Ga0055535_100061529 251
155 3300003762 Ga0055542_1000147 Ga0055542_100014761 251
156 3300003762 Ga0055542_1000619 Ga0055542_100061917 251
157 3300003763 Ga0055529_1000116 Ga0055529_100011617 251
158 3300003841 Ga0055541_1000002 Ga0055541_1000002812 251
159 3300003856 Ga0058692_1014932 Ga0058692_10149322 251
160 3300003856 Ga0058692_1029743 Ga0058692_10297431 251
161 3300004625 Ga0055543_1006402 Ga0055543_10064023 251
162 3300005337 Ga0070682_100045132 Ga0070682_1000451325 251
163 3300005344 Ga0070661_100238376 Ga0070661_1002383762 251
164 3300005367 Ga0070667_100000251 Ga0070667_10000025113 251
165 3300005367 Ga0070667_100102908 Ga0070667_1001029082 251
166 3300005436 Ga0070713_100531819 Ga0070713_1005318192 251
167 3300005437 Ga0070710_10297837 Ga0070710_102978371 251
168 3300005439 Ga0070711_100028860 Ga0070711_1000288603 251
169 3300005455 Ga0070663_100026361 Ga0070663_1000263613 251
170 3300005456 Ga0070678_100060386 Ga0070678_1000603862 251
171 3300005457 Ga0070662_100574704 Ga0070662_1005747041 251
172 3300005459 Ga0068867_100000302 Ga0068867_10000030222 251
173 3300005468 Ga0070707_100252504 Ga0070707_1002525041 251
174 3300005471 Ga0070698_100014619 Ga0070698_1000146195 251
175 3300005539 Ga0068853_100392269 Ga0068853_1003922692 251
176 3300005547 Ga0070693_100309746 Ga0070693_1003097461 251
177 3300005548 Ga0070665_100246746 Ga0070665_1002467462 251
178 3300005548 Ga0070665_100269519 Ga0070665_1002695191 251
179 3300005563 Ga0068855_100000055 Ga0068855_10000005593 251
180 3300005563 Ga0068855_100012086 Ga0068855_1000120866 251
181 3300005614 Ga0068856_100452951 Ga0068856_1004529511 251
182 3300005614 Ga0068856_101039822 Ga0068856_1010398221 251
183 3300005843 Ga0068860_100403390 Ga0068860_1004033902 251
184 3300006051 Ga0075364_10009094 Ga0075364_100090948 251
185 3300006173 Ga0070716_100001017 Ga0070716_1000010174 251
186 3300006175 Ga0070712_100050578 Ga0070712_1000505783 251
187 3300006195 Ga0075366_10161138 Ga0075366_101611381 251
188 3300006353 Ga0075370_10330774 Ga0075370_103307741 251
189 3300006847 Ga0075431_100013464 Ga0075431_1000134646 251
190 3300006946 Ga0079104_1000527 Ga0079104_100052710 251
191 3300009036 Ga0105244_10001221 Ga0105244_1000122113 251
192 3300009036 Ga0105244_10020914 Ga0105244_100209144 251
193 3300009093 Ga0105240_10004624 Ga0105240_1000462417 251
194 3300009093 Ga0105240_10172361 Ga0105240_101723612 251
195 3300009093 Ga0105240_10188112 Ga0105240_101881122 251
196 3300009148 Ga0105243_10000444 Ga0105243_1000044420 251
197 3300009174 Ga0105241_10499252 Ga0105241_104992521 251
198 3300009545 Ga0105237_10020043 Ga0105237_100200432 251
199 3300009545 Ga0105237_10321101 Ga0105237_103211011 251
200 3300009551 Ga0105238_10040073 Ga0105238_100400737 251
201 3300009551 Ga0105238_10093526 Ga0105238_100935261 251
202 3300010159 Ga0099796_10070933 Ga0099796_100709332 251
203 3300010375 Ga0105239_10091400 Ga0105239_100914003 251
204 3300013105 Ga0157369_10061441 Ga0157369_100614413 251
205 3300013306 Ga0163162_10000425 Ga0163162_1000042528 251
206 3300013307 Ga0157372_10101090 Ga0157372_101010902 251
207 3300013308 Ga0157375_10000392 Ga0157375_1000039231 251
208 3300013308 Ga0157375_10763003 Ga0157375_107630031 251
209 3300014745 Ga0157377_10000097 Ga0157377_1000009737 251
210 3300015261 Ga0182006_1004778 Ga0182006_10047787 251
211 3300017792 Ga0163161_10041418 Ga0163161_100414182 251
212 3300021361 Ga0213872_10000286 Ga0213872_1000028618 251
213 3300021361 Ga0213872_10005608 Ga0213872_100056081 251
214 3300021361 Ga0213872_10013145 Ga0213872_100131453 251
215 3300025224 Ga0209784_100002 Ga0209784_100002270 251
216 3300025225 Ga0209566_100003 Ga0209566_100003270 251
217 3300025226 Ga0209674_100004 Ga0209674_100004270 251
218 3300025226 Ga0209674_100556 Ga0209674_10055615 251
219 3300025226 Ga0209674_107256 Ga0209674_1072562 251
220 3300025228 Ga0209672_100045 Ga0209672_10004517 251
221 3300025228 Ga0209672_100207 Ga0209672_10020710 251
222 3300025230 Ga0209563_100006 Ga0209563_100006270 251
223 3300025231 Ga0207427_100228 Ga0207427_10022817 251
224 3300025233 Ga0209437_100370 Ga0209437_10037034 251
225 3300025233 Ga0209437_101529 Ga0209437_1015297 251
226 3300025242 Ga0209258_100111 Ga0209258_10011160 251
227 3300025242 Ga0209258_100200 Ga0209258_100200105 251
228 3300025246 Ga0209646_1000702 Ga0209646_100070214 251
229 3300025250 Ga0209026_1000589 Ga0209026_100058917 251
230 3300025253 Ga0209677_100003 Ga0209677_100003270 251
231 3300025254 Ga0209148_1000045 Ga0209148_1000045388 251
232 3300025254 Ga0209148_1000099 Ga0209148_1000099154 251
233 3300025254 Ga0209148_1001448 Ga0209148_10014489 251
234 3300025256 Ga0209759_1000247 Ga0209759_100024717 251
235 3300025261 Ga0209233_1000336 Ga0209233_100033617 251
236 3300025272 Ga0209455_1000035 Ga0209455_1000035389 251
237 3300025272 Ga0209455_1026699 Ga0209455_10266992 251
238 3300025284 Ga0209130_1033067 Ga0209130_10330672 251
239 3300025298 Ga0209050_1005127 Ga0209050_10051275 251
240 3300025299 Ga0209256_1000143 Ga0209256_100014338 251
241 3300025302 Ga0207426_1014646 Ga0207426_10146463 251
242 3300025303 Ga0209051_1026369 Ga0209051_10263693 251
243 3300025728 Ga0207655_1001378 Ga0207655_100137815 251
244 3300025728 Ga0207655_1023687 Ga0207655_10236872 251
245 3300025898 Ga0207692_10056550 Ga0207692_100565502 251
246 3300025913 Ga0207695_10026518 Ga0207695_100265184 251
247 3300025913 Ga0207695_10037034 Ga0207695_100370343 251
248 3300025913 Ga0207695_10305684 Ga0207695_103056841 251
249 3300025914 Ga0207671_10066307 Ga0207671_100663073 251
250 3300025916 Ga0207663_10026425 Ga0207663_100264252 251
251 3300025919 Ga0207657_10266483 Ga0207657_102664832 251
252 3300025922 Ga0207646_10045746 Ga0207646_100457464 251
253 3300025935 Ga0207709_10002441 Ga0207709_100024416 251
254 3300025939 Ga0207665_10002541 Ga0207665_100025414 251
255 3300025949 Ga0207667_10000032 Ga0207667_1000003282 251
256 3300025949 Ga0207667_10211609 Ga0207667_102116092 251
257 3300025949 Ga0207667_10313024 Ga0207667_103130242 251
258 3300025986 Ga0207658_10074330 Ga0207658_100743302 251
259 3300026067 Ga0207678_10040393 Ga0207678_100403933 251
260 3300026078 Ga0207702_10419796 Ga0207702_104197962 251
261 3300026089 Ga0207648_10000471 Ga0207648_1000047118 251
262 3300026095 Ga0207676_10155315 Ga0207676_101553151 251
263 3300026116 Ga0207674_10317344 Ga0207674_103173442 251
264 3300026121 Ga0207683_10110824 Ga0207683_101108242 251
265 3300027111 Ga0209281_1004131 Ga0209281_10041314 251
266 3300027312 Ga0209371_1000543 Ga0209371_100054315 251
267 3300027312 Ga0209371_1007320 Ga0209371_10073203 251
268 3300028379 Ga0268266_10278533 Ga0268266_102785332 251
269 3300028381 Ga0268264_10163344 Ga0268264_101633442 251
270 3300028794 Ga0307515_10001082 Ga0307515_1000108241 251
271 3300028794 Ga0307515_10004543 Ga0307515_100045438 251
272 3300028794 Ga0307515_10015316 Ga0307515_100153168 251
273 3300028794 Ga0307515_10126894 Ga0307515_101268943 251
274 3300028794 Ga0307515_10263107 Ga0307515_102631072 251
275 3300028800 Ga0265338_10299641 Ga0265338_102996412 251
276 3300030500 Ga0268256_1000223 Ga0268256_100022314 251
277 3300030500 Ga0268256_1007511 Ga0268256_10075113 251
278 3300030521 Ga0307511_10094736 Ga0307511_100947362 251
279 3300030522 Ga0307512_10094973 Ga0307512_100949732 251
280 3300030522 Ga0307512_10206620 Ga0307512_102066201 251
281 3300031239 Ga0265328_10019344 Ga0265328_100193442 251
282 3300031241 Ga0265325_10049366 Ga0265325_100493661 251
283 3300031250 Ga0265331_10000259 Ga0265331_1000025930 251
284 3300031251 Ga0265327_10000595 Ga0265327_1000059539 251
285 3300031251 Ga0265327_10001925 Ga0265327_1000192517 251
286 3300031456 Ga0307513_10394370 Ga0307513_103943701 251
287 3300031507 Ga0307509_10033984 Ga0307509_100339842 251
288 3300031507 Ga0307509_10190428 Ga0307509_101904282 251
289 3300031548 Ga0307408_100000288 Ga0307408_10000028823 251
290 3300031616 Ga0307508_10000134 Ga0307508_1000013476 251
291 3300031649 Ga0307514_10008162 Ga0307514_100081625 251
292 3300031727 Ga0316576_10061913 Ga0316576_100619134 251
293 3300031730 Ga0307516_10045709 Ga0307516_100457095 251
294 3300031901 Ga0307406_10001222 Ga0307406_100012224 251
295 3300032005 Ga0307411_10499270 Ga0307411_104992701 251
296 3300032126 Ga0307415_100659752 Ga0307415_1006597521 251
297 3300035170 Ga0373943_0264730 Ga0373943_0264730_185_955 251
298 3300035398 Ga0316574_0261259 Ga0316574_0261259_241_999 251
299 3300035691 Ga0373931_0002162 Ga0373931_0002162_1757_2524 251
300 3300035724 Ga0373933_0276601 Ga0373933_0276601_101_856 251
301 3300036712 Ga0316584_0165202 Ga0316584_0165202_100_858 251
302 3300037312 Ga0395899_0000218 Ga0395899_0000218_33534_34292 251
303 3300037312 Ga0395899_0031757 Ga0395899_0031757_2017_2796 251
304 3300037312 Ga0395899_0094515 Ga0395899_0094515_188_952 251
305 3300037466 Ga0395898_0002578 Ga0395898_0002578_20229_20993 251
306 3300039447 Ga0436361_0034970 Ga0436361_0034970_49479_50255 251
307 3300039447 Ga0436361_0121645 Ga0436361_0121645_403_1179 251
308 3300039447 Ga0436361_0144002 Ga0436361_0144002_10354_11112 251
309 3300039447 Ga0436361_0695818 Ga0436361_0695818_336_1100 251
310 3300039447 Ga0436361_0835614 Ga0436361_0835614_899_1681 251
311 3300039447 Ga0436361_1002267 Ga0436361_1002267_330_1088 251
312 3300039447 Ga0436361_1065176 Ga0436361_1065176_2086_2862 251
313 3300039447 Ga0436361_1143736 Ga0436361_1143736_2953_3825 251
314 3300041505 Ga0451849_0319413 Ga0451849_0319413_1218_1988 251
315 3300041512 Ga0451853_0033037 Ga0451853_0033037_1181_1951 251
316 3300042134 Ga0450898_018758 Ga0450898_018758_410_1168 251
317 3300042876 Ga0451577_0005030 Ga0451577_0005030_9615_10382 251
318 3300044656 Ga0466969_0000028 Ga0466969_0000028_37888_38646 251
319 3300044656 Ga0466969_0019528 Ga0466969_0019528_331_1086 251
320 3300044672 Ga0466982_0000061 Ga0466982_0000061_12527_13297 251
321 3300044672 Ga0466982_0000083 Ga0466982_0000083_13792_14562 251
322 3300044683 Ga0466965_0016849 Ga0466965_0016849_1813_2568 251
323 3300044683 Ga0466965_0017451 Ga0466965_0017451_2455_3291 251
324 3300044684 Ga0466966_0003861 Ga0466966_0003861_3575_4333 251
325 3300044684 Ga0466966_0115988 Ga0466966_0115988_798_1553 251
326 3300044693 Ga0466961_0001799 Ga0466961_0001799_7850_8614 251
327 3300044693 Ga0466961_0008699 Ga0466961_0008699_3321_4157 251
328 3300044693 Ga0466961_0058367 Ga0466961_0058367_1592_2350 251
329 3300044693 Ga0466961_0116553 Ga0466961_0116553_474_1229 251
330 3300044712 Ga0453684_0006276 Ga0453684_0006276_2167_2934 251
331 3300044735 Ga0466968_0000746 Ga0466968_0000746_3123_3896 251
332 3300044765 Ga0466970_0008292 Ga0466970_0008292_3353_4111 251
333 3300044765 Ga0466970_0066109 Ga0466970_0066109_91_927 251
334 3300045049 Ga0466959_0071596 Ga0466959_0071596_727_1485 251
335 3300045049 Ga0466959_0132703 Ga0466959_0132703_939_1694 251
336 3300045836 Ga0466958_0001479 Ga0466958_0001479_62_841 251
337 3300045836 Ga0466958_0047730 Ga0466958_0047730_151_915 251
338 3300045836 Ga0466958_0161979 Ga0466958_0161979_395_1231 251
339 3300045976 Ga0466967_0811477 Ga0466967_0811477_11_769 251
340 3300046453 Ga0495627_032179 Ga0495627_032179_772_1530 251
341 3300046455 Ga0495603_0076741 Ga0495603_0076741_14_772 251
342 3300046458 Ga0495591_000521 Ga0495591_000521_8115_8873 251
343 3300046458 Ga0495591_003555 Ga0495591_003555_2315_3073 251
344 3300046459 Ga0495629_0009293 Ga0495629_0009293_2514_3272 251
345 3300046460 Ga0495638_0001696 Ga0495638_0001696_6978_7736 251
346 3300046460 Ga0495638_0020246 Ga0495638_0020246_1530_2288 251
347 3300046460 Ga0495638_0027004 Ga0495638_0027004_1533_2294 251
348 3300046471 Ga0495650_0007105 Ga0495650_0007105_4691_5449 251
349 3300046472 Ga0495580_0249174 Ga0495580_0249174_385_1143 251
350 3300046473 Ga0495582_0073770 Ga0495582_0073770_348_1106 251
351 3300046474 Ga0495605_0000002 Ga0495605_0000002_298257_299015 251
352 3300046474 Ga0495605_0009951 Ga0495605_0009951_541_1299 251
353 3300046477 Ga0495664_0004099 Ga0495664_0004099_3218_3976 251
354 3300046491 Ga0495584_0024529 Ga0495584_0024529_756_1514 251
355 3300046492 Ga0495585_0002302 Ga0495585_0002302_4899_5684 251
356 3300046499 Ga0495594_0004561 Ga0495594_0004561_5865_6623 251
357 3300046506 Ga0495583_0000012 Ga0495583_0000012_123123_123881 251
358 3300046506 Ga0495583_0015092 Ga0495583_0015092_319_1086 251
359 3300046507 Ga0495606_0004301 Ga0495606_0004301_8119_8877 251
360 3300046507 Ga0495606_0019485 Ga0495606_0019485_3952_4710 251
361 3300046507 Ga0495606_0167228 Ga0495606_0167228_68_826 251
362 3300046512 Ga0495610_0035738 Ga0495610_0035738_1072_1830 251
363 3300046515 Ga0495620_0000238 Ga0495620_0000238_39664_40422 251
364 3300046515 Ga0495620_0151332 Ga0495620_0151332_75_833 251
365 3300046516 Ga0495628_0118011 Ga0495628_0118011_174_932 251
366 3300046517 Ga0495630_0130077 Ga0495630_0130077_1124_1882 251
367 3300046518 Ga0495631_0010865 Ga0495631_0010865_3662_4420 251
368 3300046519 Ga0495632_0014166 Ga0495632_0014166_1826_2599 251
369 3300046520 Ga0495637_0117310 Ga0495637_0117310_221_979 251
370 3300046522 Ga0495643_0000084 Ga0495643_0000084_26044_26802 251
371 3300046522 Ga0495643_0009058 Ga0495643_0009058_1642_2409 251
372 3300046524 Ga0495648_0003416 Ga0495648_0003416_1272_2030 251
373 3300046526 Ga0495666_0026566 Ga0495666_0026566_110_868 251
374 3300046528 Ga0495642_0005114 Ga0495642_0005114_4176_4934 251
375 3300046529 Ga0495652_0094252 Ga0495652_0094252_1348_2106 251
376 3300046529 Ga0495652_0351369 Ga0495652_0351369_20_799 251
377 3300046530 Ga0495654_0000283 Ga0495654_0000283_37439_38197 251
378 3300046530 Ga0495654_0058767 Ga0495654_0058767_525_1283 251
379 3300046535 Ga0495586_0040428 Ga0495586_0040428_1151_1909 251
380 3300046536 Ga0495587_0077445 Ga0495587_0077445_359_1117 251
381 3300046537 Ga0495598_0013242 Ga0495598_0013242_843_1610 251
382 3300046538 Ga0495609_0000008 Ga0495609_0000008_259075_259833 251
383 3300046539 Ga0495621_0006438 Ga0495621_0006438_2022_2789 251
384 3300046542 Ga0495597_0087109 Ga0495597_0087109_90_848 251
385 3300046542 Ga0495597_0137277 Ga0495597_0137277_188_946 251
386 3300046557 Ga0495622_0033634 Ga0495622_0033634_1276_2034 251
387 3300046558 Ga0495633_0000009 Ga0495633_0000009_280451_281209 251
388 3300046615 Ga0495656_0083878 Ga0495656_0083878_375_1142 251
389 3300046642 Ga0495634_0277505 Ga0495634_0277505_99_857 251
390 3300046648 Ga0495611_0000555 Ga0495611_0000555_507_1265 251
391 3300046648 Ga0495611_0228611 Ga0495611_0228611_40_801 251
392 3300046660 Ga0495625_0014561 Ga0495625_0014561_1144_1917 251
393 3300046660 Ga0495625_0108245 Ga0495625_0108245_61_819 251
394 3300046665 Ga0495661_0000029 Ga0495661_0000029_406_1164 251
395 3300046665 Ga0495661_0009314 Ga0495661_0009314_1650_2408 251
396 3300046679 Ga0495623_0271144 Ga0495623_0271144_83_841 251
397 3300046684 Ga0495669_0006744 Ga0495669_0006744_2682_3440 251
398 3300046690 Ga0495624_0096708 Ga0495624_0096708_547_1305 251
399 3300046690 Ga0495624_0176295 Ga0495624_0176295_509_1267 251
400 3300046691 Ga0495670_0032487 Ga0495670_0032487_754_1512 251
401 3300046691 Ga0495670_0077899 Ga0495670_0077899_725_1492 251
402 3300046691 Ga0495670_0115701 Ga0495670_0115701_598_1356 251
403 3300046692 Ga0495671_0007125 Ga0495671_0007125_5140_5898 251
404 3300046692 Ga0495671_0007969 Ga0495671_0007969_3038_3796 251
405 3300046694 Ga0495649_0005625 Ga0495649_0005625_1735_2493 251
406 3300046694 Ga0495649_0085782 Ga0495649_0085782_836_1603 251
407 3300046694 Ga0495649_0133284 Ga0495649_0133284_397_1155 251
408 3300046794 Ga0495589_0000579 Ga0495589_0000579_12029_12787 251
409 3300046794 Ga0495589_0003295 Ga0495589_0003295_7340_8098 251
410 3300046809 Ga0495600_0199742 Ga0495600_0199742_309_1067 251
411 3300046810 Ga0495660_0001737 Ga0495660_0001737_5168_5926 251
412 3300046810 Ga0495660_0093737 Ga0495660_0093737_412_1170 251
413 3300047317 Ga0495604_0151724 Ga0495604_0151724_253_1011 251
414 3300047319 Ga0495674_0052443 Ga0495674_0052443_1498_2256 251
415 3300047320 Ga0495672_0083437 Ga0495672_0083437_413_1180 251
416 3300047322 Ga0495680_0028864 Ga0495680_0028864_1494_2252 251
417 3300047322 Ga0495680_0125163 Ga0495680_0125163_994_1752 251
418 3300047323 Ga0495683_0000039 Ga0495683_0000039_59931_60689 251
419 3300047323 Ga0495683_0123120 Ga0495683_0123120_227_985 251
420 3300047443 Ga0495687_000022 Ga0495687_000022_268356_269264 251
421 3300047444 Ga0495675_0221626 Ga0495675_0221626_110_868 251
422 3300047445 Ga0495677_0002850 Ga0495677_0002850_871_1638 251
423 3300047446 Ga0495679_000160 Ga0495679_000160_22875_23633 251
424 3300047469 Ga0495673_0007499 Ga0495673_0007499_1727_2485 251
425 3300047470 Ga0495681_0004251 Ga0495681_0004251_841_1599 251
426 3300047470 Ga0495681_0068106 Ga0495681_0068106_397_1155 251
427 3300047472 Ga0495686_0138292 Ga0495686_0138292_446_1207 251
428 3300047673 Ga0495593_0036087 Ga0495593_0036087_153_911 251
429 3300047673 Ga0495593_0064278 Ga0495593_0064278_1000_1758 251
430 3300048088 Ga0495602_0107686 Ga0495602_0107686_100_1005 251
431 3300048088 Ga0495602_0116704 Ga0495602_0116704_928_1686 251
432 3300048088 Ga0495602_0131600 Ga0495602_0131600_237_995 251
433 3300048089 Ga0495614_0118778 Ga0495614_0118778_293_1051 251
434 3300048903 Ga0496100_0002671 Ga0496100_0002671_3430_4188 251
435 3300048904 Ga0496101_0006867 Ga0496101_0006867_4608_5366 251
436 3300048905 Ga0496102_0049582 Ga0496102_0049582_3006_3764 251
437 3300048910 Ga0496107_0126217 Ga0496107_0126217_93_851 251
438 3300048917 Ga0496114_0111176 Ga0496114_0111176_1078_1836 251
439 3300048918 Ga0496115_0033193 Ga0496115_0033193_2598_3359 251
440 3300048918 Ga0496115_0059499 Ga0496115_0059499_939_1697 251
441 3300048923 Ga0496120_0253578 Ga0496120_0253578_50_808 251
442 3300048924 Ga0496121_0020713 Ga0496121_0020713_2627_3403 251
443 3300048924 Ga0496121_0268183 Ga0496121_0268183_386_1144 251
444 3300048928 Ga0496125_0004319 Ga0496125_0004319_4732_5505 251
445 3300048929 Ga0496126_0009096 Ga0496126_0009096_4880_5662 251
446 3300048929 Ga0496126_0347493 Ga0496126_0347493_182_940 251
447 3300049459 Ga0495678_000011 Ga0495678_000011_272957_273715 251
448 3300049593 Ga0501077_0083438 Ga0501077_0083438_754_1521 251
449 3300049775 Ga0501279_022452 Ga0501279_022452_44_823 251
450 3300049822 Ga0501035_0120412 Ga0501035_0120412_25_783 251
451 3300049823 Ga0501044_0000336 Ga0501044_0000336_54204_55013 251
452 3300050491 nmdc:mga00v17_6399_c1 nmdc:mga00v17_6399_c1_204_971 251
453 3300050493 nmdc:mga0k408_118853_c1 nmdc:mga0k408_118853_c1_794_1552 251
454 3300050493 nmdc:mga0k408_217142_c1 nmdc:mga0k408_217142_c1_158_931 251
455 3300050496 nmdc:mga07m45_258048_c1 nmdc:mga07m45_258048_c1_206_970 251
456 3300050510 nmdc:mga06r32_176219_c1 nmdc:mga06r32_176219_c1_237_1082 251
457 3300053088 Ga0500644_0001205 Ga0500644_0001205_3459_4220 251
458 3300053093 Ga0500651_0038530 Ga0500651_0038530_201_962 251
459 3300053104 Ga0500556_0018971 Ga0500556_0018971_1173_1934 251
460 3300053118 Ga0500594_0003066 Ga0500594_0003066_818_1579 251
461 3300053125 Ga0500618_050386 Ga0500618_050386_122_880 251
462 3300053134 Ga0500658_0155102 Ga0500658_0155102_245_1018 251
463 3300053136 Ga0500559_0000133 Ga0500559_0000133_51074_51835 251
464 3300053136 Ga0500559_0166938 Ga0500559_0166938_107_865 251
465 3300053153 Ga0500616_0014394 Ga0500616_0014394_1008_1772 251
466 3300053156 Ga0500622_0181110 Ga0500622_0181110_26_793 251
467 3300053161 Ga0500634_0018370 Ga0500634_0018370_388_1155 251
468 3300053177 Ga0500636_0008922 Ga0500636_0008922_216_977 251
469 3300053730 Ga0500645_064222 Ga0500645_064222_20_787 251
470 3300053739 Ga0500587_008835 Ga0500587_008835_85_858 251
471 3300061719 Ga0466962_0008179 Ga0466962_0008179_1360_2196 251
472 3300061719 Ga0466962_0010934 Ga0466962_0010934_2638_3393 251
473 iso_pu_bacteria 2511231026 2511387082 251
474 iso_pu_bacteria 2513237093 2513634499 251
475 iso_pu_bacteria 2513237103 2513709430 251
476 iso_pu_bacteria 2515075009 2515111057 251
477 iso_pu_bacteria 2516653077 2517039703 251
478 iso_pu_bacteria 2517093000 2517093827 251
479 iso_pu_bacteria 2517287029 2517405639 251
480 iso_pu_bacteria 2521172590 2521558551 251
481 iso_pu_bacteria 2551306416 2553004179 251
482 iso_pu_bacteria 2593339238 2595447741 251
483 iso_pu_bacteria 2643221596 2643990118 251
484 iso_pu_bacteria 2724679232 2725948303 251
485 iso_pu_bacteria 2765235838 2765569661 251
486 iso_pu_bacteria 2765235942 2766067832 251
487 iso_pu_bacteria 2839094727 2839097419 251
488 iso_pu_bacteria 2842110456 2842115881 251
489 iso_pu_bacteria 2842217011 2842220811 251
490 iso_pu_bacteria 2842341865 2842345481 251
491 iso_pu_bacteria 2857516855 2857520523 251
492 iso_pu_bacteria 2919046199 2919046982 251
493 iso_pu_bacteria 2923510766 2923512016 251
494 iso_pu_bacteria 2928115317 2928117189 251
495 iso_pu_bacteria 2928130867 2928131734 251
496 iso_pu_bacteria 2933586486 2933592159 251
497 iso_pu_bacteria 639633055 639647221 251
498 iso_pu_bacteria 8005460587 8005461698 251
499 iso_pu_bacteria 8024479707 8024480871 251
500 iso_pu_bacteria 8057575449 8057579030 251
501 iso_pu_bacteria 8057874678 8057881756 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

54

253

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

60

301

0.94

PF08659

KR

KR domain

55

237

0.85

PF23441

135

302

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3icc-assembly1.cif.gz_A crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution 0.9561 4 251
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.9541 3 249
7nm7-assembly1.cif.gz_AAA the crystal structure of the antimycin pathway standalone ketoreductase, antm 0.9539 4 244
4i5g-assembly1.cif.gz_C crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a 0.9526 3 249
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9524 3 249
ID Description Score Start End Superfamily
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9429 1 251 3.40.50.720
3i3oG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9408 4 247 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9408 4 249 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9386 4 251 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9357 3 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X2MTI2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9882 1 72
AF-A0A442GTY0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9871 4 164
AF-A0A0B6S5B2-F1-model_v4 Putative short-chain dehydrogenase/reductase SDR 0.9838 2 251
AF-A0A0E3VWU8-F1-model_v4 Putative oxidoreductase 0.9803 21 244 GO:0016616
GO:0030497
AF-A0A0B6S5B2-F1-model_v4 Putative short-chain dehydrogenase/reductase SDR 0.9761 2 251

Feature Viewer

pLDDT pTM Quality
93.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map