F455666

General Info

Members Datasets Scaffolds Average Seq Length
501 248 1002 265

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10139890|Ga0081455_101398902
Length 315
Sequence MAVAVPRPQRIGRLERPALTGVLVREIVNYSSYWRSATFSSTVEPTIYLLAFGFGFGSLVSTVGGYDYVEFVGTGTVATAVLFSSAFPAMFGTFVKYQFQRTYDAILAAPVDTEELVTAEALWMATRAGVYGCVPMLVAMAFGLDPSWGMLTVPFIAFISGLGWALFGIAVAGERPRHAADERYAFERARACSPVDDVGAGDLPELARRRRCDVEHAHQAGAVGKGERPEQDRVRQAEHGAVQPDADRQRADDLEMFRRRAADQITCRPEPQPCHRAAPTARGVRVLIAAAYHPTAEAPGIPADVEQVFESVRFP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
162 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
163 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
164 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
168 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
169 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
170 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 9.78
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10139890 3300005937 Bacteria 1881
2 ARcpr5yngRDRAFT_c005256 3300000043 Bacteria 1198
3 ARSoilOldRDRAFT_c004427 3300000044 Bacteria 1193
4 ARCol0yngRDRAFT_1004086 3300000652 Bacteria 1061
5 JGI25407J50210_10027898 3300003373 Bacteria 1465
6 JGI25407J50210_10044320 3300003373 Bacteria 1136
7 JGI25407J50210_10044952 3300003373 Bacteria 1127
8 Ga0070658_10097276 3300005327 Bacteria 2431
9 Ga0070676_10199927 3300005328 Bacteria 1310
10 Ga0070683_100010259 3300005329 Bacteria 8051
11 Ga0070683_100035176 3300005329 Bacteria 4579
12 Ga0070683_100083453 3300005329 Bacteria 2993
13 Ga0070680_100026181 3300005336 Bacteria 4665
14 Ga0070680_100072403 3300005336 Bacteria 2832
15 Ga0070682_100010327 3300005337 Bacteria 5298
16 Ga0068868_100184831 3300005338 Bacteria 1731
17 Ga0070691_10009808 3300005341 Bacteria 4367
18 Ga0070661_100044199 3300005344 Bacteria 3254
19 Ga0070692_10003883 3300005345 Bacteria 6157
20 Ga0070692_10015300 3300005345 Bacteria 3627
21 Ga0070668_100033565 3300005347 Bacteria 3909
22 Ga0070668_100157718 3300005347 Bacteria 1839
23 Ga0070675_100057876 3300005354 Bacteria 3196
24 Ga0070675_100094745 3300005354 Bacteria 2506
25 Ga0070674_100061318 3300005356 Bacteria 2624
26 Ga0070674_100391675 3300005356 Bacteria 1133
27 Ga0070673_100379057 3300005364 Bacteria 1261
28 Ga0070659_100030486 3300005366 Bacteria 4174
29 Ga0070659_100324962 3300005366 Bacteria 1287
30 Ga0070709_10080682 3300005434 Bacteria 2121
31 Ga0070714_100063217 3300005435 Bacteria 3182
32 Ga0070714_100079978 3300005435 Unclassified 2843
33 Ga0070713_100790297 3300005436 Bacteria 909
34 Ga0070710_10009849 3300005437 Bacteria 4684
35 Ga0070711_100036363 3300005439 Bacteria 3299
36 Ga0070705_100062184 3300005440 Bacteria 2222
37 Ga0070694_100204032 3300005444 Bacteria 1475
38 Ga0070678_100215939 3300005456 Bacteria 1592
39 Ga0070662_100051427 3300005457 Bacteria 2975
40 Ga0070662_100304111 3300005457 Bacteria 1296
41 Ga0070681_10328523 3300005458 Bacteria 1439
42 Ga0068867_100089906 3300005459 Bacteria 2329
43 Ga0068867_100244147 3300005459 Bacteria 1457
44 Ga0070698_100168121 3300005471 Bacteria 2134
45 Ga0070699_100143154 3300005518 Bacteria 2112
46 Ga0070679_100012195 3300005530 Bacteria 8211
47 Ga0070679_100086393 3300005530 Bacteria 3123
48 Ga0070684_100012129 3300005535 Bacteria 6892
49 Ga0070684_100083520 3300005535 Bacteria 2830
50 Ga0070684_100303707 3300005535 Bacteria 1465
51 Ga0068853_100054549 3300005539 Bacteria 3445
52 Ga0068853_100136092 3300005539 Bacteria 2203
53 Ga0070672_100390946 3300005543 Bacteria 1191
54 Ga0070686_100015577 3300005544 Bacteria 4407
55 Ga0070686_100154477 3300005544 Bacteria 1610
56 Ga0070695_100013356 3300005545 Bacteria 4933
57 Ga0070696_100024508 3300005546 Bacteria 4101
58 Ga0070696_100406139 3300005546 Bacteria 1067
59 Ga0070693_100010563 3300005547 Bacteria 4629
60 Ga0070693_100020344 3300005547 Bacteria 3498
61 Ga0070704_100030501 3300005549 Bacteria 3614
62 Ga0070704_100093566 3300005549 Bacteria 2246
63 Ga0068855_100016680 3300005563 Bacteria 8832
64 Ga0070664_100041549 3300005564 Bacteria 3881
65 Ga0068857_100004517 3300005577 Bacteria 11767
66 Ga0068857_100020142 3300005577 Bacteria 5864
67 Ga0068857_100032490 3300005577 Bacteria 4615
68 Ga0068857_100097901 3300005577 Bacteria 2631
69 Ga0068854_100487744 3300005578 Bacteria 1036
70 Ga0068856_100023786 3300005614 Bacteria 5958
71 Ga0068856_100029604 3300005614 Bacteria 5349
72 Ga0070702_100034782 3300005615 Bacteria 2779
73 Ga0070702_100094261 3300005615 Bacteria 1822
74 Ga0068859_100233281 3300005617 Bacteria 1929
75 Ga0068859_100261878 3300005617 Bacteria 1821
76 Ga0068866_10012840 3300005718 Bacteria 3659
77 Ga0068861_100000835 3300005719 Bacteria 18614
78 Ga0068861_100059570 3300005719 Bacteria 2924
79 Ga0068858_100273413 3300005842 Bacteria 1608
80 Ga0068862_100212111 3300005844 Bacteria 1750
81 Ga0068862_100477423 3300005844 Bacteria 1180
82 Ga0068862_100686566 3300005844 Bacteria 991
83 Ga0081455_10009750 3300005937 Bacteria 9836
84 Ga0081455_10025013 3300005937 Bacteria 5517
85 Ga0081455_10030462 3300005937 Bacteria 4899
86 Ga0081538_10005180 3300005981 Bacteria 11799
87 Ga0081538_10006257 3300005981 Bacteria 10530
88 Ga0081540_1003335 3300005983 Bacteria 12734
89 Ga0081540_1035145 3300005983 Bacteria 2691
90 Ga0081539_10000244 3300005985 Bacteria 127514
91 Ga0081539_10000388 3300005985 Bacteria 95218
92 Ga0081539_10012066 3300005985 Bacteria 6719
93 Ga0070717_10158692 3300006028 Bacteria 1961
94 Ga0070717_10178533 3300006028 Bacteria 1850
95 Ga0075365_10019685 3300006038 Bacteria 4172
96 Ga0075365_10019894 3300006038 Bacteria 4153
97 Ga0075368_10045502 3300006042 Bacteria 1734
98 Ga0075364_10032114 3300006051 Bacteria 3373
99 Ga0075432_10000019 3300006058 Bacteria 29747
100 Ga0070716_100135648 3300006173 Bacteria 1562
101 Ga0070712_100097127 3300006175 Bacteria 2170
102 Ga0070712_100162034 3300006175 Bacteria 1728
103 Ga0075428_100000253 3300006844 Bacteria 52531
104 Ga0075428_100047708 3300006844 Bacteria 4703
105 Ga0075430_100148396 3300006846 Bacteria 1953
106 Ga0075430_100379568 3300006846 Bacteria 1166
107 Ga0075430_100492541 3300006846 Bacteria 1011
108 Ga0075431_100322376 3300006847 Bacteria 1558
109 Ga0075431_100451885 3300006847 Bacteria 1280
110 Ga0075433_10036961 3300006852 Bacteria 4210
111 Ga0075429_100139461 3300006880 Bacteria 2122
112 Ga0068865_100028260 3300006881 Bacteria 3712
113 Ga0075436_100451773 3300006914 Bacteria 936
114 Ga0097620_100233292 3300006931 Bacteria 1929
115 Ga0097620_100261845 3300006931 Bacteria 1821
116 Ga0075435_100045914 3300007076 Bacteria 3503
117 Ga0105240_10118188 3300009093 Bacteria 3195
118 Ga0105240_10142498 3300009093 Bacteria 2864
119 Ga0111539_10002125 3300009094 Bacteria 26493
120 Ga0105245_10003050 3300009098 Bacteria 14989
121 Ga0105245_10051364 3300009098 Bacteria 3696
122 Ga0105245_10105169 3300009098 Bacteria 2618
123 Ga0105245_10148910 3300009098 Bacteria 2211
124 Ga0105247_10197518 3300009101 Bacteria 1350
125 Ga0114129_10012503 3300009147 Bacteria 12085
126 Ga0114129_10059761 3300009147 Bacteria 5329
127 Ga0105243_10014730 3300009148 Bacteria 5914
128 Ga0105243_10167933 3300009148 Bacteria 1898
129 Ga0105243_10287388 3300009148 Bacteria 1484
130 Ga0105243_10538988 3300009148 Bacteria 1113
131 Ga0105242_10030770 3300009176 Bacteria 4287
132 Ga0105242_10908504 3300009176 Bacteria 881
133 Ga0105249_10008908 3300009553 Bacteria 8763
134 Ga0105239_10076277 3300010375 Bacteria 3686
135 Ga0105239_10082582 3300010375 Bacteria 3539
136 Ga0105246_10030107 3300011119 Bacteria 3582
137 Ga0157342_1001265 3300012507 Bacteria 1825
138 Ga0157370_10212234 3300013104 Bacteria 1794
139 Ga0157369_10065539 3300013105 Bacteria 3909
140 Ga0157369_10437378 3300013105 Bacteria 1355
141 Ga0163162_10009946 3300013306 Bacteria 9251
142 Ga0163162_10664987 3300013306 Bacteria 1165
143 Ga0157372_10092250 3300013307 Bacteria 3445
144 Ga0163163_10393919 3300014325 Bacteria 1443
145 Ga0157377_10041146 3300014745 Bacteria 2562
146 Ga0157377_10056370 3300014745 Bacteria 2231
147 Ga0157379_10272958 3300014968 Bacteria 1538
148 Ga0207653_10050068 3300025885 Bacteria 1388
149 Ga0207692_10011962 3300025898 Bacteria 3714
150 Ga0207688_10038544 3300025901 Bacteria 2653
151 Ga0207699_10078089 3300025906 Bacteria 2044
152 Ga0207645_10074301 3300025907 Bacteria 2176
153 Ga0207643_10036128 3300025908 Bacteria 2770
154 Ga0207705_10069678 3300025909 Bacteria 2548
155 Ga0207707_10009759 3300025912 Bacteria 8328
156 Ga0207707_10040408 3300025912 Bacteria 4074
157 Ga0207695_10509755 3300025913 Bacteria 1085
158 Ga0207695_10760505 3300025913 Bacteria 849
159 Ga0207671_10126021 3300025914 Bacteria 1962
160 Ga0207693_10030065 3300025915 Bacteria 4289
161 Ga0207663_10004992 3300025916 Bacteria 6652
162 Ga0207660_10004077 3300025917 Bacteria 9522
163 Ga0207660_10027200 3300025917 Bacteria 3900
164 Ga0207660_10051223 3300025917 Bacteria 2935
165 Ga0207660_10110897 3300025917 Bacteria 2064
166 Ga0207662_10097843 3300025918 Bacteria 1814
167 Ga0207657_10031515 3300025919 Bacteria 4801
168 Ga0207649_10043346 3300025920 Bacteria 2751
169 Ga0207652_10058528 3300025921 Bacteria 3321
170 Ga0207652_10079301 3300025921 Bacteria 2868
171 Ga0207659_10042356 3300025926 Bacteria 3192
172 Ga0207687_10018179 3300025927 Bacteria 4637
173 Ga0207687_10081224 3300025927 Bacteria 2342
174 Ga0207687_10154703 3300025927 Bacteria 1753
175 Ga0207687_10398317 3300025927 Bacteria 1132
176 Ga0207700_10000004 3300025928 Bacteria 443409
177 Ga0207700_10068236 3300025928 Bacteria 2725
178 Ga0207690_10019560 3300025932 Bacteria 4172
179 Ga0207706_10138783 3300025933 Bacteria 2138
180 Ga0207709_10027638 3300025935 Bacteria 3271
181 Ga0207709_10050511 3300025935 Bacteria 2544
182 Ga0207709_10074491 3300025935 Bacteria 2166
183 Ga0207709_10323641 3300025935 Bacteria 1155
184 Ga0207669_10069591 3300025937 Bacteria 2203
185 Ga0207704_10067740 3300025938 Bacteria 2247
186 Ga0207665_10095469 3300025939 Bacteria 2066
187 Ga0207689_10162226 3300025942 Bacteria 1842
188 Ga0207661_10007047 3300025944 Bacteria 7978
189 Ga0207661_10021920 3300025944 Bacteria 4797
190 Ga0207661_10241645 3300025944 Bacteria 1602
191 Ga0207679_10015106 3300025945 Bacteria 5093
192 Ga0207679_10041789 3300025945 Bacteria 3290
193 Ga0207679_10609192 3300025945 Bacteria 985
194 Ga0207667_10159767 3300025949 Bacteria 2318
195 Ga0207651_10212271 3300025960 Bacteria 1559
196 Ga0207712_10077585 3300025961 Bacteria 2408
197 Ga0207668_10220148 3300025972 Bacteria 1524
198 Ga0207668_10235151 3300025972 Bacteria 1479
199 Ga0207640_10108196 3300025981 Bacteria 1964
200 Ga0207640_10149617 3300025981 Bacteria 1713
201 Ga0207677_10031810 3300026023 Bacteria 3383
202 Ga0207677_10163952 3300026023 Bacteria 1730
203 Ga0207677_10409681 3300026023 Bacteria 1152
204 Ga0207639_10063581 3300026041 Bacteria 2858
205 Ga0207639_10084087 3300026041 Bacteria 2527
206 Ga0207708_10020213 3300026075 Bacteria 5022
207 Ga0207708_10045340 3300026075 Bacteria 3351
208 Ga0207708_10125056 3300026075 Bacteria 2006
209 Ga0207648_10003410 3300026089 Bacteria 16677
210 Ga0207648_10081455 3300026089 Bacteria 2823
211 Ga0207648_10234376 3300026089 Bacteria 1633
212 Ga0207674_10003925 3300026116 Bacteria 18101
213 Ga0207674_10022514 3300026116 Bacteria 6766
214 Ga0207674_10027663 3300026116 Bacteria 5994
215 Ga0207674_10073079 3300026116 Bacteria 3444
216 Ga0207675_100000592 3300026118 Bacteria 35478
217 Ga0207675_100014786 3300026118 Bacteria 7282
218 Ga0207675_100046605 3300026118 Bacteria 4050
219 Ga0207683_10097290 3300026121 Bacteria 2625
220 Ga0207683_10582074 3300026121 Bacteria 1035
221 Ga0207698_10056455 3300026142 Bacteria 3032
222 Ga0209998_10012419 3300027717 Bacteria 1768
223 Ga0207428_10000223 3300027907 Bacteria 78687
224 Ga0207428_10023010 3300027907 Bacteria 5248
225 Ga0268265_10170039 3300028380 Bacteria 1862
226 Ga0268265_10484777 3300028380 Bacteria 1162
227 Ga0268264_10386339 3300028381 Bacteria 1341
228 Ga0307408_100033515 3300031548 Bacteria 3589
229 Ga0307408_100740895 3300031548 Bacteria 887
230 Ga0307405_10026783 3300031731 Bacteria 3332
231 Ga0307405_10057305 3300031731 Bacteria 2447
232 Ga0307405_10107114 3300031731 Bacteria 1886
233 Ga0307405_10146492 3300031731 Bacteria 1655
234 Ga0307413_10010460 3300031824 Bacteria 4501
235 Ga0307413_10241259 3300031824 Bacteria 1334
236 Ga0307410_10007785 3300031852 Bacteria 5890
237 Ga0307410_10017623 3300031852 Bacteria 4295
238 Ga0307410_10272922 3300031852 Bacteria 1323
239 Ga0307406_10010250 3300031901 Bacteria 5280
240 Ga0307406_10017023 3300031901 Bacteria 4231
241 Ga0307406_10093689 3300031901 Bacteria 2028
242 Ga0307406_10114842 3300031901 Bacteria 1860
243 Ga0307406_10128912 3300031901 Unclassified 1772
244 Ga0307407_10004236 3300031903 Bacteria 6053
245 Ga0307407_10041307 3300031903 Bacteria 2578
246 Ga0307407_10179092 3300031903 Bacteria 1403
247 Ga0307407_10240944 3300031903 Bacteria 1234
248 Ga0307407_10280184 3300031903 Bacteria 1154
249 Ga0307412_10038189 3300031911 Bacteria 3090
250 Ga0307409_100004461 3300031995 Bacteria 7869
251 Ga0307409_100012637 3300031995 Bacteria 5391
252 Ga0307409_100017387 3300031995 Bacteria 4791
253 Ga0307409_100039285 3300031995 Bacteria 3510
254 Ga0307409_100113384 3300031995 Bacteria 2278
255 Ga0307409_100363296 3300031995 Bacteria 1370
256 Ga0307409_100546447 3300031995 Bacteria 1136
257 Ga0307416_100033831 3300032002 Bacteria 3880
258 Ga0307416_100066107 3300032002 Bacteria 2975
259 Ga0307416_100125720 3300032002 Bacteria 2296
260 Ga0307416_100372329 3300032002 Bacteria 1455
261 Ga0307416_100732267 3300032002 Bacteria 1080
262 Ga0307416_100903464 3300032002 Bacteria 983
263 Ga0307414_10147811 3300032004 Bacteria 1849
264 Ga0307411_10023643 3300032005 Bacteria 3645
265 Ga0307411_10040027 3300032005 Bacteria 2970
266 Ga0307411_10173863 3300032005 Bacteria 1627
267 Ga0307415_100007247 3300032126 Bacteria 6054
268 Ga0307415_100011531 3300032126 Bacteria 5063
269 Ga0307415_100109079 3300032126 Bacteria 2049
270 Ga0373944_0072285 3300035089 Bacteria 1126
271 Ga0373945_0057790 3300035116 Bacteria 1442
272 Ga0373931_0181313 3300035691 Unclassified 1247
273 Ga0373947_0019528 3300035725 Bacteria 3909
274 Ga0373947_0267347 3300035725 Bacteria 1134
275 Ga0373925_0226993 3300037068 Bacteria 1492
276 Ga0395899_0001945 3300037312 Bacteria 16998
277 Ga0395899_0008339 3300037312 Bacteria 7979
278 Ga0395899_0021799 3300037312 Bacteria 4859
279 Ga0395899_0035631 3300037312 Bacteria 3735
280 Ga0395899_0082577 3300037312 Bacteria 2337
281 Ga0395899_0129600 3300037312 Bacteria 1802
282 Ga0395899_0319093 3300037312 Bacteria 1047
283 Ga0395899_0426892 3300037312 Bacteria 872
284 Ga0395900_0001270 3300037418 Bacteria 30846
285 Ga0395900_0003985 3300037418 Bacteria 15767
286 Ga0395900_0011288 3300037418 Bacteria 9138
287 Ga0395900_0019224 3300037418 Bacteria 6965
288 Ga0395900_0029815 3300037418 Bacteria 5600
289 Ga0395900_0030789 3300037418 Bacteria 5510
290 Ga0395900_0040688 3300037418 Bacteria 4790
291 Ga0395900_0043484 3300037418 Bacteria 4630
292 Ga0395900_0067187 3300037418 Bacteria 3683
293 Ga0395900_0080270 3300037418 Bacteria 3352
294 Ga0395900_0104691 3300037418 Bacteria 2907
295 Ga0395900_0180417 3300037418 Bacteria 2146
296 Ga0395900_0186514 3300037418 Bacteria 2105
297 Ga0395900_0300554 3300037418 Bacteria 1591
298 Ga0395900_0308851 3300037418 Bacteria 1565
299 Ga0395900_0347916 3300037418 Bacteria 1456
300 Ga0395900_0406116 3300037418 Bacteria 1325
301 Ga0395900_0611251 3300037418 Bacteria 1030
302 Ga0395898_0004491 3300037466 Bacteria 15260
303 Ga0395898_0007634 3300037466 Bacteria 11481
304 Ga0395898_0015529 3300037466 Bacteria 7809
305 Ga0395898_0040511 3300037466 Bacteria 4606
306 Ga0395898_0059173 3300037466 Bacteria 3728
307 Ga0395898_0060152 3300037466 Bacteria 3693
308 Ga0395898_0103130 3300037466 Bacteria 2737
309 Ga0395898_0144939 3300037466 Bacteria 2273
310 Ga0395898_0201846 3300037466 Bacteria 1898
311 Ga0395898_0201981 3300037466 Bacteria 1897
312 Ga0395898_0225831 3300037466 Bacteria 1786
313 Ga0395898_0375990 3300037466 Bacteria 1355
314 Ga0395905_0002430 3300037471 Bacteria 20667
315 Ga0395905_0003633 3300037471 Bacteria 16385
316 Ga0395905_0009001 3300037471 Bacteria 9797
317 Ga0395905_0026108 3300037471 Bacteria 5508
318 Ga0395905_0028069 3300037471 Bacteria 5306
319 Ga0395905_0034407 3300037471 Bacteria 4758
320 Ga0395905_0063373 3300037471 Bacteria 3459
321 Ga0395905_0088809 3300037471 Bacteria 2897
322 Ga0395905_0135390 3300037471 Bacteria 2317
323 Ga0395905_0160199 3300037471 Bacteria 2115
324 Ga0395905_0381006 3300037471 Bacteria 1304
325 Ga0395901_0001327 3300038443 Bacteria 26037
326 Ga0395901_0008091 3300038443 Bacteria 10621
327 Ga0395901_0015427 3300038443 Bacteria 7780
328 Ga0395901_0016197 3300038443 Bacteria 7595
329 Ga0395901_0017842 3300038443 Bacteria 7244
330 Ga0395901_0018819 3300038443 Bacteria 7059
331 Ga0395901_0021604 3300038443 Bacteria 6594
332 Ga0395901_0021766 3300038443 Bacteria 6570
333 Ga0395901_0027561 3300038443 Bacteria 5838
334 Ga0395901_0034598 3300038443 Bacteria 5218
335 Ga0395901_0050073 3300038443 Bacteria 4341
336 Ga0395901_0078166 3300038443 Bacteria 3454
337 Ga0395901_0090619 3300038443 Bacteria 3200
338 Ga0395901_0112573 3300038443 Bacteria 2858
339 Ga0395901_0213478 3300038443 Bacteria 2019
340 Ga0395901_0391650 3300038443 Bacteria 1428
341 Ga0395901_0408367 3300038443 Bacteria 1394
342 Ga0395901_0757767 3300038443 Bacteria 963
343 Ga0395901_0879240 3300038443 Bacteria 879
344 Ga0439466_0073222 3300041411 Bacteria 1089
345 Ga0451807_2682662 3300041486 Bacteria 1914
346 Ga0451845_0371016 3300041501 Bacteria 2314
347 Ga0451847_0414892 3300041503 Bacteria 1630
348 Ga0451849_0581205 3300041505 Bacteria 2096
349 Ga0451851_1045005 3300041507 Bacteria 1848
350 Ga0451855_0856449 3300041511 Bacteria 2098
351 Ga0451853_0951078 3300041512 Bacteria 1802
352 Ga0439448_0011988 3300042005 Bacteria 2589
353 Ga0439451_006304 3300042009 Bacteria 2424
354 Ga0439454_010897 3300042011 Bacteria 1205
355 Ga0439454_028630 3300042011 Bacteria 862
356 Ga0439455_0020820 3300042012 Bacteria 1558
357 Ga0450906_003148 3300042145 Bacteria 3565
358 Ga0466972_0123199 3300044658 Bacteria 1222
359 Ga0466968_0046811 3300044735 Bacteria 1838
360 Ga0466968_0116166 3300044735 Bacteria 1207
361 Ga0466960_0129689 3300044901 Bacteria 1329
362 Ga0451576_0037000 3300045051 Bacteria 5171
363 Ga0451576_0314676 3300045051 Bacteria 1638
364 Ga0466967_0000244 3300045976 Bacteria 23876
365 Ga0466967_0470540 3300045976 Bacteria 1230
366 Ga0466967_0508274 3300045976 Bacteria 1183
367 Ga0495603_0114188 3300046455 Bacteria 1575
368 Ga0495641_0070883 3300046461 Bacteria 1565
369 Ga0495582_0015700 3300046473 Bacteria 4156
370 Ga0495662_0212945 3300046476 Bacteria 953
371 Ga0495585_0157587 3300046492 Bacteria 1180
372 Ga0495583_0121882 3300046506 Unclassified 1097
373 Ga0495630_0036006 3300046517 Bacteria 3700
374 Ga0495644_0057092 3300046523 Bacteria 1467
375 Ga0495665_0040516 3300046531 Bacteria 2480
376 Ga0495586_0023753 3300046535 Bacteria 3274
377 Ga0495586_0060232 3300046535 Bacteria 2064
378 Ga0495656_0077383 3300046615 Bacteria 1493
379 Ga0495668_0216884 3300046616 Bacteria 1048
380 Ga0495658_0135437 3300046683 Bacteria 1503
381 Ga0495658_0268803 3300046683 Bacteria 1074
382 Ga0495613_0069888 3300046689 Bacteria 2560
383 Ga0495670_0030066 3300046691 Bacteria 2698
384 Ga0495589_0117251 3300046794 Bacteria 1283
385 Ga0495589_0138461 3300046794 Bacteria 1167
386 Ga0495636_0107192 3300047318 Bacteria 1227
387 Ga0495676_0045789 3300047321 Bacteria 3557
388 Ga0495676_0062903 3300047321 Bacteria 2895
389 Ga0496100_0093526 3300048903 Bacteria 2057
390 Ga0496100_0379525 3300048903 Bacteria 1073
391 Ga0496101_0070413 3300048904 Bacteria 2561
392 Ga0496101_0240949 3300048904 Bacteria 1407
393 Ga0496101_0549160 3300048904 Bacteria 913
394 Ga0496102_0021657 3300048905 Bacteria 5686
395 Ga0496102_0074017 3300048905 Bacteria 3131
396 Ga0496102_0081163 3300048905 Bacteria 2989
397 Ga0496104_0000471 3300048907 Bacteria 34675
398 Ga0496104_0122456 3300048907 Bacteria 2497
399 Ga0496104_0132208 3300048907 Bacteria 2397
400 Ga0496104_0232368 3300048907 Unclassified 1756
401 Ga0496105_0004026 3300048908 Bacteria 10995
402 Ga0496106_0111093 3300048909 Bacteria 2134
403 Ga0496106_0121801 3300048909 Bacteria 2039
404 Ga0496107_0006885 3300048910 Bacteria 7830
405 Ga0496107_0069638 3300048910 Bacteria 2554
406 Ga0496107_0208913 3300048910 Bacteria 1451
407 Ga0496108_0005911 3300048911 Bacteria 9917
408 Ga0496108_0011012 3300048911 Bacteria 7344
409 Ga0496108_0326751 3300048911 Bacteria 1337
410 Ga0496108_0562769 3300048911 Bacteria 994
411 Ga0496109_0003223 3300048912 Bacteria 13591
412 Ga0496109_0038896 3300048912 Bacteria 4303
413 Ga0496109_0050160 3300048912 Bacteria 3801
414 Ga0496109_0172752 3300048912 Bacteria 2028
415 Ga0496109_0198766 3300048912 Bacteria 1885
416 Ga0496110_0000975 3300048913 Bacteria 20055
417 Ga0496110_0017033 3300048913 Bacteria 6073
418 Ga0496110_0018000 3300048913 Bacteria 5918
419 Ga0496110_0031662 3300048913 Bacteria 4564
420 Ga0496110_0037698 3300048913 Bacteria 4202
421 Ga0496110_0604945 3300048913 Bacteria 994
422 Ga0496110_0646831 3300048913 Bacteria 957
423 Ga0496111_0000526 3300048914 Bacteria 19794
424 Ga0496111_0004115 3300048914 Bacteria 9131
425 Ga0496111_0004673 3300048914 Bacteria 8681
426 Ga0496111_0220923 3300048914 Bacteria 1407
427 Ga0496112_0000082 3300048915 Bacteria 62404
428 Ga0496112_0035458 3300048915 Bacteria 4860
429 Ga0496112_0145545 3300048915 Bacteria 2338
430 Ga0496113_0000069 3300048916 Bacteria 45043
431 Ga0496113_0015924 3300048916 Bacteria 5183
432 Ga0496113_0259846 3300048916 Bacteria 1387
433 Ga0496114_0023576 3300048917 Bacteria 5023
434 Ga0496114_0063070 3300048917 Bacteria 3102
435 Ga0496115_0008718 3300048918 Bacteria 7516
436 Ga0496115_0467970 3300048918 Bacteria 1016
437 Ga0501033_0021453 3300049570 Bacteria 4873
438 Ga0501034_0220751 3300049571 Bacteria 1848
439 Ga0501036_0010897 3300049572 Bacteria 7515
440 Ga0501038_0016358 3300049574 Bacteria 6725
441 Ga0501039_0038150 3300049575 Bacteria 3711
442 Ga0501040_0096910 3300049576 Bacteria 2054
443 Ga0501041_0174013 3300049577 Bacteria 1347
444 Ga0501042_0179975 3300049578 Bacteria 1525
445 Ga0501046_0074399 3300049580 Bacteria 2635
446 Ga0501047_0031969 3300049581 Bacteria 5078
447 Ga0501047_0547727 3300049581 Bacteria 981
448 Ga0501048_0105130 3300049582 Bacteria 1992
449 Ga0501048_0220644 3300049582 Bacteria 1345
450 Ga0501048_0422520 3300049582 Bacteria 953
451 Ga0501067_0005949 3300049583 Bacteria 6762
452 Ga0501067_0296372 3300049583 Bacteria 900
453 Ga0501068_0001958 3300049584 Bacteria 10952
454 Ga0501068_0002301 3300049584 Bacteria 10170
455 Ga0501069_0064206 3300049585 Bacteria 2052
456 Ga0501069_0316050 3300049585 Bacteria 917
457 Ga0501070_0056454 3300049586 Bacteria 3255
458 Ga0501071_0093637 3300049587 Bacteria 2209
459 Ga0501071_0137241 3300049587 Bacteria 1820
460 Ga0501072_0003717 3300049588 Bacteria 11505
461 Ga0501072_0161035 3300049588 Bacteria 1790
462 Ga0501073_0123165 3300049589 Bacteria 1797
463 Ga0501074_0069265 3300049590 Bacteria 2537
464 Ga0501075_0117441 3300049591 Bacteria 2022
465 Ga0501075_0193673 3300049591 Bacteria 1550
466 Ga0501076_0024087 3300049592 Bacteria 4702
467 Ga0501077_0007251 3300049593 Bacteria 6838
468 Ga0501077_0113975 3300049593 Bacteria 1714
469 Ga0501079_0014505 3300049741 Bacteria 6009
470 Ga0501079_0114246 3300049741 Bacteria 2099
471 Ga0501080_0129290 3300049742 Bacteria 2338
472 Ga0501081_0013779 3300049743 Bacteria 5319
473 Ga0501081_0077838 3300049743 Bacteria 2318
474 Ga0501044_0204637 3300049823 Bacteria 1931
475 Ga0501045_0001270 3300049824 Bacteria 16746
476 nmdc:mga00v17_107743_c1 3300050491 Bacteria 1765
477 nmdc:mga00v17_41953_c1 3300050491 Bacteria 2750
478 nmdc:mga0yw44_23329_c1 3300050492 Bacteria 3484
479 nmdc:mga0yw44_244758_c1 3300050492 Bacteria 1193
480 nmdc:mga05p37_11665_c1 3300050507 Bacteria 10472
481 nmdc:mga05p37_202519_c1 3300050507 Bacteria 2403
482 nmdc:mga05p37_229151_c1 3300050507 Bacteria 2239
483 nmdc:mga05p37_45633_c1 3300050507 Bacteria 5389
484 nmdc:mga09592_178311_c1 3300050508 Bacteria 1838
485 nmdc:mga0qj67_54177_c1 3300050509 Bacteria 3176
486 nmdc:mga06r32_332357_c1 3300050510 Bacteria 1505
487 nmdc:mga08y16_152545_c1 3300050511 Bacteria 2402
488 nmdc:mga08y16_399_c1 3300050511 Bacteria 39798
489 nmdc:mga08y16_57755_c1 3300050511 Bacteria 4054
490 nmdc:mga0n895_178177_c1 3300050512 Bacteria 2157
491 nmdc:mga0n895_178363_c1 3300050512 Bacteria 2155
492 nmdc:mga0a205_13680_c1 3300050515 Bacteria 6169
493 nmdc:mga0a205_2605_c1 3300050515 Bacteria 15936
494 Ga0501084_0005781 3300054114 Bacteria 10171
495 Ga0501084_0572718 3300054114 Bacteria 954
496 Ga0590075_008201 3300059424 Bacteria 2490
497 Ga0501082_0158917 3300060353 Bacteria 1964
498 Ga0501082_0506577 3300060353 Bacteria 1055
499 Ga0530510_0025641 3300061734 Bacteria 4216
500 Ga0530510_0030259 3300061734 Bacteria 3888
501 Ga0530510_0042621 3300061734 Bacteria 3279
502 Ga0081455_10139890
503 ARcpr5yngRDRAFT_c005256
504 ARSoilOldRDRAFT_c004427
505 ARCol0yngRDRAFT_1004086
506 JGI25407J50210_10027898
507 JGI25407J50210_10044320
508 JGI25407J50210_10044952
509 Ga0070658_10097276
510 Ga0070676_10199927
511 Ga0070683_100010259
512 Ga0070683_100035176
513 Ga0070683_100083453
514 Ga0070680_100026181
515 Ga0070680_100072403
516 Ga0070682_100010327
517 Ga0068868_100184831
518 Ga0070691_10009808
519 Ga0070661_100044199
520 Ga0070692_10003883
521 Ga0070692_10015300
522 Ga0070668_100033565
523 Ga0070668_100157718
524 Ga0070675_100057876
525 Ga0070675_100094745
526 Ga0070674_100061318
527 Ga0070674_100391675
528 Ga0070673_100379057
529 Ga0070659_100030486
530 Ga0070659_100324962
531 Ga0070709_10080682
532 Ga0070714_100063217
533 Ga0070714_100079978
534 Ga0070713_100790297
535 Ga0070710_10009849
536 Ga0070711_100036363
537 Ga0070705_100062184
538 Ga0070694_100204032
539 Ga0070678_100215939
540 Ga0070662_100051427
541 Ga0070662_100304111
542 Ga0070681_10328523
543 Ga0068867_100089906
544 Ga0068867_100244147
545 Ga0070698_100168121
546 Ga0070699_100143154
547 Ga0070679_100012195
548 Ga0070679_100086393
549 Ga0070684_100012129
550 Ga0070684_100083520
551 Ga0070684_100303707
552 Ga0068853_100054549
553 Ga0068853_100136092
554 Ga0070672_100390946
555 Ga0070686_100015577
556 Ga0070686_100154477
557 Ga0070695_100013356
558 Ga0070696_100024508
559 Ga0070696_100406139
560 Ga0070693_100010563
561 Ga0070693_100020344
562 Ga0070704_100030501
563 Ga0070704_100093566
564 Ga0068855_100016680
565 Ga0070664_100041549
566 Ga0068857_100004517
567 Ga0068857_100020142
568 Ga0068857_100032490
569 Ga0068857_100097901
570 Ga0068854_100487744
571 Ga0068856_100023786
572 Ga0068856_100029604
573 Ga0070702_100034782
574 Ga0070702_100094261
575 Ga0068859_100233281
576 Ga0068859_100261878
577 Ga0068866_10012840
578 Ga0068861_100000835
579 Ga0068861_100059570
580 Ga0068858_100273413
581 Ga0068862_100212111
582 Ga0068862_100477423
583 Ga0068862_100686566
584 Ga0081455_10009750
585 Ga0081455_10025013
586 Ga0081455_10030462
587 Ga0081538_10005180
588 Ga0081538_10006257
589 Ga0081540_1003335
590 Ga0081540_1035145
591 Ga0081539_10000244
592 Ga0081539_10000388
593 Ga0081539_10012066
594 Ga0070717_10158692
595 Ga0070717_10178533
596 Ga0075365_10019685
597 Ga0075365_10019894
598 Ga0075368_10045502
599 Ga0075364_10032114
600 Ga0075432_10000019
601 Ga0070716_100135648
602 Ga0070712_100097127
603 Ga0070712_100162034
604 Ga0075428_100000253
605 Ga0075428_100047708
606 Ga0075430_100148396
607 Ga0075430_100379568
608 Ga0075430_100492541
609 Ga0075431_100322376
610 Ga0075431_100451885
611 Ga0075433_10036961
612 Ga0075429_100139461
613 Ga0068865_100028260
614 Ga0075436_100451773
615 Ga0097620_100233292
616 Ga0097620_100261845
617 Ga0075435_100045914
618 Ga0105240_10118188
619 Ga0105240_10142498
620 Ga0111539_10002125
621 Ga0105245_10003050
622 Ga0105245_10051364
623 Ga0105245_10105169
624 Ga0105245_10148910
625 Ga0105247_10197518
626 Ga0114129_10012503
627 Ga0114129_10059761
628 Ga0105243_10014730
629 Ga0105243_10167933
630 Ga0105243_10287388
631 Ga0105243_10538988
632 Ga0105242_10030770
633 Ga0105242_10908504
634 Ga0105249_10008908
635 Ga0105239_10076277
636 Ga0105239_10082582
637 Ga0105246_10030107
638 Ga0157342_1001265
639 Ga0157370_10212234
640 Ga0157369_10065539
641 Ga0157369_10437378
642 Ga0163162_10009946
643 Ga0163162_10664987
644 Ga0157372_10092250
645 Ga0163163_10393919
646 Ga0157377_10041146
647 Ga0157377_10056370
648 Ga0157379_10272958
649 Ga0207653_10050068
650 Ga0207692_10011962
651 Ga0207688_10038544
652 Ga0207699_10078089
653 Ga0207645_10074301
654 Ga0207643_10036128
655 Ga0207705_10069678
656 Ga0207707_10009759
657 Ga0207707_10040408
658 Ga0207695_10509755
659 Ga0207695_10760505
660 Ga0207671_10126021
661 Ga0207693_10030065
662 Ga0207663_10004992
663 Ga0207660_10004077
664 Ga0207660_10027200
665 Ga0207660_10051223
666 Ga0207660_10110897
667 Ga0207662_10097843
668 Ga0207657_10031515
669 Ga0207649_10043346
670 Ga0207652_10058528
671 Ga0207652_10079301
672 Ga0207659_10042356
673 Ga0207687_10018179
674 Ga0207687_10081224
675 Ga0207687_10154703
676 Ga0207687_10398317
677 Ga0207700_10000004
678 Ga0207700_10068236
679 Ga0207690_10019560
680 Ga0207706_10138783
681 Ga0207709_10027638
682 Ga0207709_10050511
683 Ga0207709_10074491
684 Ga0207709_10323641
685 Ga0207669_10069591
686 Ga0207704_10067740
687 Ga0207665_10095469
688 Ga0207689_10162226
689 Ga0207661_10007047
690 Ga0207661_10021920
691 Ga0207661_10241645
692 Ga0207679_10015106
693 Ga0207679_10041789
694 Ga0207679_10609192
695 Ga0207667_10159767
696 Ga0207651_10212271
697 Ga0207712_10077585
698 Ga0207668_10220148
699 Ga0207668_10235151
700 Ga0207640_10108196
701 Ga0207640_10149617
702 Ga0207677_10031810
703 Ga0207677_10163952
704 Ga0207677_10409681
705 Ga0207639_10063581
706 Ga0207639_10084087
707 Ga0207708_10020213
708 Ga0207708_10045340
709 Ga0207708_10125056
710 Ga0207648_10003410
711 Ga0207648_10081455
712 Ga0207648_10234376
713 Ga0207674_10003925
714 Ga0207674_10022514
715 Ga0207674_10027663
716 Ga0207674_10073079
717 Ga0207675_100000592
718 Ga0207675_100014786
719 Ga0207675_100046605
720 Ga0207683_10097290
721 Ga0207683_10582074
722 Ga0207698_10056455
723 Ga0209998_10012419
724 Ga0207428_10000223
725 Ga0207428_10023010
726 Ga0268265_10170039
727 Ga0268265_10484777
728 Ga0268264_10386339
729 Ga0307408_100033515
730 Ga0307408_100740895
731 Ga0307405_10026783
732 Ga0307405_10057305
733 Ga0307405_10107114
734 Ga0307405_10146492
735 Ga0307413_10010460
736 Ga0307413_10241259
737 Ga0307410_10007785
738 Ga0307410_10017623
739 Ga0307410_10272922
740 Ga0307406_10010250
741 Ga0307406_10017023
742 Ga0307406_10093689
743 Ga0307406_10114842
744 Ga0307406_10128912
745 Ga0307407_10004236
746 Ga0307407_10041307
747 Ga0307407_10179092
748 Ga0307407_10240944
749 Ga0307407_10280184
750 Ga0307412_10038189
751 Ga0307409_100004461
752 Ga0307409_100012637
753 Ga0307409_100017387
754 Ga0307409_100039285
755 Ga0307409_100113384
756 Ga0307409_100363296
757 Ga0307409_100546447
758 Ga0307416_100033831
759 Ga0307416_100066107
760 Ga0307416_100125720
761 Ga0307416_100372329
762 Ga0307416_100732267
763 Ga0307416_100903464
764 Ga0307414_10147811
765 Ga0307411_10023643
766 Ga0307411_10040027
767 Ga0307411_10173863
768 Ga0307415_100007247
769 Ga0307415_100011531
770 Ga0307415_100109079
771 Ga0373944_0072285
772 Ga0373945_0057790
773 Ga0373931_0181313
774 Ga0373947_0019528
775 Ga0373947_0267347
776 Ga0373925_0226993
777 Ga0395899_0001945
778 Ga0395899_0008339
779 Ga0395899_0021799
780 Ga0395899_0035631
781 Ga0395899_0082577
782 Ga0395899_0129600
783 Ga0395899_0319093
784 Ga0395899_0426892
785 Ga0395900_0001270
786 Ga0395900_0003985
787 Ga0395900_0011288
788 Ga0395900_0019224
789 Ga0395900_0029815
790 Ga0395900_0030789
791 Ga0395900_0040688
792 Ga0395900_0043484
793 Ga0395900_0067187
794 Ga0395900_0080270
795 Ga0395900_0104691
796 Ga0395900_0180417
797 Ga0395900_0186514
798 Ga0395900_0300554
799 Ga0395900_0308851
800 Ga0395900_0347916
801 Ga0395900_0406116
802 Ga0395900_0611251
803 Ga0395898_0004491
804 Ga0395898_0007634
805 Ga0395898_0015529
806 Ga0395898_0040511
807 Ga0395898_0059173
808 Ga0395898_0060152
809 Ga0395898_0103130
810 Ga0395898_0144939
811 Ga0395898_0201846
812 Ga0395898_0201981
813 Ga0395898_0225831
814 Ga0395898_0375990
815 Ga0395905_0002430
816 Ga0395905_0003633
817 Ga0395905_0009001
818 Ga0395905_0026108
819 Ga0395905_0028069
820 Ga0395905_0034407
821 Ga0395905_0063373
822 Ga0395905_0088809
823 Ga0395905_0135390
824 Ga0395905_0160199
825 Ga0395905_0381006
826 Ga0395901_0001327
827 Ga0395901_0008091
828 Ga0395901_0015427
829 Ga0395901_0016197
830 Ga0395901_0017842
831 Ga0395901_0018819
832 Ga0395901_0021604
833 Ga0395901_0021766
834 Ga0395901_0027561
835 Ga0395901_0034598
836 Ga0395901_0050073
837 Ga0395901_0078166
838 Ga0395901_0090619
839 Ga0395901_0112573
840 Ga0395901_0213478
841 Ga0395901_0391650
842 Ga0395901_0408367
843 Ga0395901_0757767
844 Ga0395901_0879240
845 Ga0439466_0073222
846 Ga0451807_2682662
847 Ga0451845_0371016
848 Ga0451847_0414892
849 Ga0451849_0581205
850 Ga0451851_1045005
851 Ga0451855_0856449
852 Ga0451853_0951078
853 Ga0439448_0011988
854 Ga0439451_006304
855 Ga0439454_010897
856 Ga0439454_028630
857 Ga0439455_0020820
858 Ga0450906_003148
859 Ga0466972_0123199
860 Ga0466968_0046811
861 Ga0466968_0116166
862 Ga0466960_0129689
863 Ga0451576_0037000
864 Ga0451576_0314676
865 Ga0466967_0000244
866 Ga0466967_0470540
867 Ga0466967_0508274
868 Ga0495603_0114188
869 Ga0495641_0070883
870 Ga0495582_0015700
871 Ga0495662_0212945
872 Ga0495585_0157587
873 Ga0495583_0121882
874 Ga0495630_0036006
875 Ga0495644_0057092
876 Ga0495665_0040516
877 Ga0495586_0023753
878 Ga0495586_0060232
879 Ga0495656_0077383
880 Ga0495668_0216884
881 Ga0495658_0135437
882 Ga0495658_0268803
883 Ga0495613_0069888
884 Ga0495670_0030066
885 Ga0495589_0117251
886 Ga0495589_0138461
887 Ga0495636_0107192
888 Ga0495676_0045789
889 Ga0495676_0062903
890 Ga0496100_0093526
891 Ga0496100_0379525
892 Ga0496101_0070413
893 Ga0496101_0240949
894 Ga0496101_0549160
895 Ga0496102_0021657
896 Ga0496102_0074017
897 Ga0496102_0081163
898 Ga0496104_0000471
899 Ga0496104_0122456
900 Ga0496104_0132208
901 Ga0496104_0232368
902 Ga0496105_0004026
903 Ga0496106_0111093
904 Ga0496106_0121801
905 Ga0496107_0006885
906 Ga0496107_0069638
907 Ga0496107_0208913
908 Ga0496108_0005911
909 Ga0496108_0011012
910 Ga0496108_0326751
911 Ga0496108_0562769
912 Ga0496109_0003223
913 Ga0496109_0038896
914 Ga0496109_0050160
915 Ga0496109_0172752
916 Ga0496109_0198766
917 Ga0496110_0000975
918 Ga0496110_0017033
919 Ga0496110_0018000
920 Ga0496110_0031662
921 Ga0496110_0037698
922 Ga0496110_0604945
923 Ga0496110_0646831
924 Ga0496111_0000526
925 Ga0496111_0004115
926 Ga0496111_0004673
927 Ga0496111_0220923
928 Ga0496112_0000082
929 Ga0496112_0035458
930 Ga0496112_0145545
931 Ga0496113_0000069
932 Ga0496113_0015924
933 Ga0496113_0259846
934 Ga0496114_0023576
935 Ga0496114_0063070
936 Ga0496115_0008718
937 Ga0496115_0467970
938 Ga0501033_0021453
939 Ga0501034_0220751
940 Ga0501036_0010897
941 Ga0501038_0016358
942 Ga0501039_0038150
943 Ga0501040_0096910
944 Ga0501041_0174013
945 Ga0501042_0179975
946 Ga0501046_0074399
947 Ga0501047_0031969
948 Ga0501047_0547727
949 Ga0501048_0105130
950 Ga0501048_0220644
951 Ga0501048_0422520
952 Ga0501067_0005949
953 Ga0501067_0296372
954 Ga0501068_0001958
955 Ga0501068_0002301
956 Ga0501069_0064206
957 Ga0501069_0316050
958 Ga0501070_0056454
959 Ga0501071_0093637
960 Ga0501071_0137241
961 Ga0501072_0003717
962 Ga0501072_0161035
963 Ga0501073_0123165
964 Ga0501074_0069265
965 Ga0501075_0117441
966 Ga0501075_0193673
967 Ga0501076_0024087
968 Ga0501077_0007251
969 Ga0501077_0113975
970 Ga0501079_0014505
971 Ga0501079_0114246
972 Ga0501080_0129290
973 Ga0501081_0013779
974 Ga0501081_0077838
975 Ga0501044_0204637
976 Ga0501045_0001270
977 nmdc:mga00v17_107743_c1
978 nmdc:mga00v17_41953_c1
979 nmdc:mga0yw44_23329_c1
980 nmdc:mga0yw44_244758_c1
981 nmdc:mga05p37_11665_c1
982 nmdc:mga05p37_202519_c1
983 nmdc:mga05p37_229151_c1
984 nmdc:mga05p37_45633_c1
985 nmdc:mga09592_178311_c1
986 nmdc:mga0qj67_54177_c1
987 nmdc:mga06r32_332357_c1
988 nmdc:mga08y16_152545_c1
989 nmdc:mga08y16_399_c1
990 nmdc:mga08y16_57755_c1
991 nmdc:mga0n895_178177_c1
992 nmdc:mga0n895_178363_c1
993 nmdc:mga0a205_13680_c1
994 nmdc:mga0a205_2605_c1
995 Ga0501084_0005781
996 Ga0501084_0572718
997 Ga0590075_008201
998 Ga0501082_0158917
999 Ga0501082_0506577
1000 Ga0530510_0025641
1001 Ga0530510_0030259
1002 Ga0530510_0042621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

18

174

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p05-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g 0.7339 18 259
7p03-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation without nucleotides 0.7259 18 256
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.6994 19 262
7lkz-assembly1.cif.gz_A structure of atp-bound human abca4 0.6914 69 260
7tc0-assembly1.cif.gz_A the structure of human abca1 in digitonin 0.6878 76 261
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8143 64 255 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7967 67 259 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7541 46 258 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6167 46 258 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6096 64 255 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7W0JLX3-F1-model_v4 ABC transporter permease 0.9798 56 265 GO:0043190
GO:0140359
AF-A0A7W0JLX3-F1-model_v4 ABC transporter permease 0.9752 56 265 GO:0043190
GO:0140359
AF-A0A7V9FL22-F1-model_v4 Transport permease protein 0.9724 90 265 GO:0043190
GO:0140359
AF-A0A7V9K3G7-F1-model_v4 Transport permease protein 0.9668 11 265 GO:0043190
GO:0140359
AF-A0A7V9K3G7-F1-model_v4 Transport permease protein 0.9631 11 265 GO:0043190
GO:0140359

Map