F455631

General Info

Members Datasets Scaffolds Average Seq Length
501 361 1002 237

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10140533|rootH1_101405333
Length 281
Sequence MHGLARLTEIWVYLAASPLLGLTTTLVAYLVALWVYRRLGFNPLANPVLMAIAIVVSILTVTGTPYKTYFEGAQFVHFMLGPATVALAMPLYKQWHNLRRAAVPLLLGLAAGSITAVVSAVGIAYAMGASPQIMASLAPKSATTPIAMAISERFGGLPSLTAVLVICTGILGAVLARYVLNFLRIDSHPVRGFALGVASHGIGTARALQVSAEMGAFAGLGMGLNGVFTAIVVPLAMPVFLRWIGAXAYLAGLGHQGGTLNCSTRKSRMRWTLGGRWVRVG

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
141 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
256 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
261 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
262 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
263 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
264 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
265 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
266 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
267 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
268 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
269 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
270 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
271 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
272 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
273 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
274 2519103095 Burkholderia sp. KJ006 Isolate Nodule
275 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
276 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
277 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
278 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
279 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
280 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
281 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
282 2643221629 Devosia sp. Root105 Isolate Unclassified
283 2643221660 Methylibium sp. Root1272 Isolate Unclassified
284 2643221662 Devosia sp. Root413D1 Isolate Unclassified
285 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
286 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
287 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
288 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
289 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
290 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
291 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
292 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
293 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
294 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
295 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
296 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
297 2818991452 Burkholderia cepacia 561 Isolate Unclassified
298 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
299 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
300 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
301 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
302 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
303 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
304 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
305 2854911287 Brucella lupini LUP21 Isolate Unclassified
306 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
307 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
308 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
309 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
310 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
311 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
312 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
313 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
314 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
315 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
316 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
317 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
318 2904564687 Burkholderia sp. 571 Isolate Unclassified
319 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
320 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
321 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
322 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
323 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
324 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
325 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
326 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
327 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
328 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
329 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
330 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
331 2928163908 Burkholderia sp. 567 Isolate Unclassified
332 2928170801 Burkholderia sp. 572 Isolate Unclassified
333 2928536128 Burkholderia sola 565 Isolate Unclassified
334 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
335 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
336 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
337 2952252522 Salinicola sp. DM10 Isolate Unclassified
338 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
339 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
340 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
341 639633007 Azoarcus olearius BH72 Isolate Unclassified
342 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
343 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
344 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
345 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
346 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
347 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
348 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
349 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
350 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
351 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
352 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
353 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
354 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
355 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
356 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
357 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
358 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
359 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
360 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
361 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.64
Metatranscriptomes 0.2
Isolates 20.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.97
Nodule 3.59
Rhizoplane 2.4
Rhizosphere 60.28
Stem 0
Stem Tuber 0.2
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10140533 3300003323 Bacteria 4346
2 MBSR1b_contig_5299885 2162886012 Bacteria 1269
3 JGI24739J22299_10042487 3300001989 Bacteria 1508
4 JGI24738J21930_10003472 3300002075 Bacteria 3970
5 JGI25156J39149_1000324 3300002705 Bacteria 31611
6 JGI25156J39149_1000538 3300002705 Bacteria 21818
7 JGI25156J39149_1001082 3300002705 Bacteria 12500
8 JGI25151J46595_10010762 3300003187 Bacteria 4233
9 JGI25151J46595_10012830 3300003187 Bacteria 3794
10 JGI25406J46586_10002487 3300003203 Bacteria 8709
11 JGI25406J46586_10010509 3300003203 Bacteria 4104
12 rootH1_10088861 3300003316 Bacteria 1638
13 rootH2_10160365 3300003320 Bacteria 3244
14 Ga0006562J51391_1092728 3300003578 Bacteria 1990
15 JGI25404J52841_10006008 3300003659 Bacteria 2525
16 Ga0055538_1000016 3300003751 Bacteria 305460
17 Ga0055539_1000021 3300003752 Bacteria 305460
18 Ga0055533_1000029 3300003756 Bacteria 305460
19 Ga0055533_1000088 3300003756 Bacteria 122346
20 Ga0055532_1000036 3300003758 Bacteria 208233
21 Ga0055532_1000230 3300003758 Bacteria 41833
22 Ga0055532_1001110 3300003758 Bacteria 8295
23 Ga0055525_1000033 3300003759 Bacteria 305460
24 Ga0055527_1000022 3300003760 Bacteria 208676
25 Ga0055527_1000042 3300003760 Bacteria 115844
26 Ga0055527_1000270 3300003760 Bacteria 31387
27 Ga0055535_1000026 3300003761 Bacteria 208676
28 Ga0055535_1000036 3300003761 Bacteria 162035
29 Ga0055535_1000066 3300003761 Bacteria 115844
30 Ga0055542_1000042 3300003762 Bacteria 208676
31 Ga0055542_1000061 3300003762 Bacteria 162035
32 Ga0055542_1001559 3300003762 Bacteria 10785
33 Ga0055529_1000048 3300003763 Bacteria 208676
34 Ga0055529_1000069 3300003763 Bacteria 162035
35 Ga0055526_1007223 3300003771 Bacteria 5829
36 Ga0055526_1007931 3300003771 Bacteria 5399
37 Ga0055526_1008895 3300003771 Bacteria 4927
38 Ga0055524_1001130 3300003775 Bacteria 16051
39 Ga0055524_1007709 3300003775 Bacteria 4544
40 Ga0055536_1014442 3300003781 Bacteria 2773
41 Ga0055534_1000584 3300003784 Bacteria 19110
42 Ga0055534_1001032 3300003784 Bacteria 12182
43 Ga0055528_1009412 3300003790 Bacteria 4082
44 Ga0055541_1000029 3300003841 Bacteria 199874
45 Ga0065707_10397350 3300005295 Bacteria 857
46 Ga0070666_10309439 3300005335 Bacteria 1126
47 Ga0068868_100100017 3300005338 Bacteria 2346
48 Ga0070668_100135141 3300005347 Bacteria 1983
49 Ga0070669_100068610 3300005353 Bacteria 2618
50 Ga0070671_100002464 3300005355 Bacteria 14306
51 Ga0070674_100102174 3300005356 Bacteria 2090
52 Ga0070667_100132106 3300005367 Bacteria 2180
53 Ga0070708_100004175 3300005445 Bacteria 11345
54 Ga0070708_100030458 3300005445 Bacteria 4664
55 Ga0070708_100074912 3300005445 Bacteria 3054
56 Ga0070706_100052557 3300005467 Bacteria 3760
57 Ga0070699_100022908 3300005518 Bacteria 5381
58 Ga0070697_100004370 3300005536 Bacteria 10845
59 Ga0070697_100618378 3300005536 Bacteria 953
60 Ga0068853_100311184 3300005539 Bacteria 1458
61 Ga0070672_100014436 3300005543 Bacteria 5598
62 Ga0070696_100276174 3300005546 Bacteria 1279
63 Ga0070665_100410181 3300005548 Bacteria 1363
64 Ga0068855_100000147 3300005563 Bacteria 89526
65 Ga0068857_100361113 3300005577 Bacteria 1346
66 Ga0068854_100473752 3300005578 Bacteria 1050
67 Ga0068852_100027760 3300005616 Bacteria 4619
68 Ga0068852_100072423 3300005616 Bacteria 3028
69 Ga0068859_100347924 3300005617 Bacteria 1577
70 Ga0068861_100436405 3300005719 Bacteria 1170
71 Ga0068851_10015065 3300005834 Bacteria 3680
72 Ga0081455_10006663 3300005937 Bacteria 12343
73 Ga0081538_10144481 3300005981 Bacteria 1090
74 Ga0081540_1003865 3300005983 Bacteria 11692
75 Ga0081540_1038308 3300005983 Bacteria 2528
76 Ga0081539_10000076 3300005985 Bacteria 229037
77 Ga0070716_100037082 3300006173 Bacteria 2692
78 Ga0070712_100356805 3300006175 Bacteria 1198
79 Ga0097621_100119293 3300006237 Bacteria 2236
80 Ga0068871_100036991 3300006358 Bacteria 3890
81 Ga0075428_100897952 3300006844 Bacteria 940
82 Ga0075430_100135393 3300006846 Bacteria 2053
83 Ga0075433_10257054 3300006852 Bacteria 1549
84 Ga0075434_100305865 3300006871 Bacteria 1610
85 Ga0075436_100027272 3300006914 Bacteria 3932
86 Ga0097620_100347895 3300006931 Bacteria 1577
87 Ga0079104_1005059 3300006946 Bacteria 5380
88 Ga0099826_10000018 3300006948 Bacteria 198330
89 Ga0099794_10009418 3300007265 Bacteria 4106
90 Ga0099794_10015928 3300007265 Bacteria 3326
91 Ga0099794_10041726 3300007265 Bacteria 2185
92 Ga0099794_10060004 3300007265 Bacteria 1846
93 Ga0099795_10047545 3300007788 Bacteria 1551
94 Ga0105251_10045303 3300009011 Bacteria 2121
95 Ga0105240_10000090 3300009093 Bacteria 184256
96 Ga0105240_10135340 3300009093 Bacteria 2951
97 Ga0105240_10211935 3300009093 Bacteria 2263
98 Ga0105240_10333227 3300009093 Bacteria 1726
99 Ga0111539_10003803 3300009094 Bacteria 19856
100 Ga0105245_10371803 3300009098 Bacteria 1421
101 Ga0114129_10070409 3300009147 Bacteria 4877
102 Ga0114129_10373272 3300009147 Bacteria 1885
103 Ga0105248_10032018 3300009177 Bacteria 5875
104 Ga0105237_10071477 3300009545 Bacteria 3465
105 Ga0105237_10077314 3300009545 Bacteria 3318
106 Ga0105238_10007697 3300009551 Bacteria 10773
107 Ga0105238_10342581 3300009551 Bacteria 1483
108 Ga0105249_10284653 3300009553 Bacteria 1652
109 Ga0099796_10010023 3300010159 Bacteria 2588
110 Ga0099796_10161267 3300010159 Bacteria 889
111 Ga0105239_10042948 3300010375 Bacteria 4954
112 Ga0157371_10219542 3300013102 Bacteria 1365
113 Ga0157374_11084294 3300013296 Bacteria 821
114 Ga0157378_10040563 3300013297 Bacteria 4128
115 Ga0163162_10144710 3300013306 Bacteria 2492
116 Ga0157375_10222242 3300013308 Bacteria 2047
117 Ga0163163_10109637 3300014325 Bacteria 2788
118 Ga0157380_10328804 3300014326 Bacteria 1421
119 Ga0182008_10000969 3300014497 Bacteria 19939
120 Ga0182008_10029666 3300014497 Bacteria 2762
121 Ga0182006_1002233 3300015261 Bacteria 10719
122 Ga0182006_1054833 3300015261 Bacteria 1523
123 Ga0182007_10017310 3300015262 Bacteria 2635
124 Ga0182005_1053547 3300015265 Bacteria 1099
125 Ga0213872_10000017 3300021361 Bacteria 178787
126 Ga0213872_10002147 3300021361 Bacteria 11824
127 Ga0213872_10006862 3300021361 Bacteria 5667
128 Ga0213872_10008650 3300021361 Bacteria 4916
129 Ga0209784_100033 3300025224 Bacteria 305649
130 Ga0209566_100037 3300025225 Bacteria 305649
131 Ga0209566_105426 3300025225 Bacteria 1607
132 Ga0209674_100011 3300025226 Bacteria 997175
133 Ga0209674_100048 3300025226 Bacteria 353032
134 Ga0209674_100055 3300025226 Bacteria 305649
135 Ga0209672_100002 3300025228 Bacteria 1733325
136 Ga0209672_100035 3300025228 Bacteria 303111
137 Ga0209672_100090 3300025228 Bacteria 119861
138 Ga0209147_100003 3300025229 Bacteria 1733325
139 Ga0209147_100041 3300025229 Bacteria 303111
140 Ga0209147_100132 3300025229 Bacteria 119628
141 Ga0209563_100056 3300025230 Bacteria 305649
142 Ga0209563_100233 3300025230 Bacteria 26917
143 Ga0209258_100005 3300025242 Bacteria 1087938
144 Ga0209258_100063 3300025242 Bacteria 303577
145 Ga0209258_100211 3300025242 Bacteria 116100
146 Ga0209677_100034 3300025253 Bacteria 305649
147 Ga0209148_1000006 3300025254 Bacteria 1733325
148 Ga0209148_1000088 3300025254 Bacteria 258188
149 Ga0209148_1000443 3300025254 Bacteria 45551
150 Ga0209759_1000002 3300025256 Bacteria 1027596
151 Ga0209759_1000009 3300025256 Bacteria 446623
152 Ga0209759_1000039 3300025256 Bacteria 256444
153 Ga0209759_1002739 3300025256 Bacteria 7487
154 Ga0209233_1028893 3300025261 Bacteria 1325
155 Ga0209565_1000093 3300025263 Bacteria 138690
156 Ga0209455_1000003 3300025272 Bacteria 1471893
157 Ga0209455_1000075 3300025272 Bacteria 285430
158 Ga0209455_1000631 3300025272 Bacteria 21732
159 Ga0209673_1000061 3300025273 Bacteria 262274
160 Ga0209675_1000100 3300025291 Bacteria 128565
161 Ga0209675_1001317 3300025291 Bacteria 14718
162 Ga0209675_1017050 3300025291 Bacteria 2090
163 Ga0209676_1000141 3300025292 Bacteria 175894
164 Ga0209025_1000390 3300025294 Bacteria 90952
165 Ga0209025_1000755 3300025294 Bacteria 54059
166 Ga0209025_1001457 3300025294 Bacteria 30940
167 Ga0209025_1011865 3300025294 Bacteria 5672
168 Ga0209564_1001462 3300025295 Bacteria 23992
169 Ga0209564_1001510 3300025295 Bacteria 23291
170 Ga0209564_1004397 3300025295 Bacteria 8638
171 Ga0209564_1013615 3300025295 Bacteria 3435
172 Ga0209758_1026270 3300025297 Bacteria 2526
173 Ga0209256_1000434 3300025299 Bacteria 64801
174 Ga0209256_1001596 3300025299 Bacteria 22189
175 Ga0209051_1015883 3300025303 Bacteria 3445
176 Ga0209051_1045626 3300025303 Bacteria 1515
177 Ga0207656_10014256 3300025321 Bacteria 3057
178 Ga0207680_10094243 3300025903 Bacteria 1911
179 Ga0207647_10023740 3300025904 Bacteria 4052
180 Ga0207684_10146413 3300025910 Bacteria 2032
181 Ga0207695_10000176 3300025913 Bacteria 187773
182 Ga0207695_10454963 3300025913 Bacteria 1163
183 Ga0207671_10028213 3300025914 Bacteria 4196
184 Ga0207663_10310358 3300025916 Bacteria 1182
185 Ga0207681_10040657 3300025923 Bacteria 3096
186 Ga0207644_10003288 3300025931 Bacteria 10445
187 Ga0207644_10137078 3300025931 Bacteria 1880
188 Ga0207690_10036841 3300025932 Bacteria 3171
189 Ga0207706_10086893 3300025933 Bacteria 2749
190 Ga0207669_10029144 3300025937 Bacteria 3048
191 Ga0207665_10016025 3300025939 Bacteria 4922
192 Ga0207691_10018336 3300025940 Bacteria 6630
193 Ga0207711_10010976 3300025941 Bacteria 7525
194 Ga0207689_10669198 3300025942 Bacteria 875
195 Ga0207679_10698759 3300025945 Bacteria 920
196 Ga0207667_10000034 3300025949 Bacteria 304569
197 Ga0207658_10018474 3300025986 Bacteria 4816
198 Ga0207658_10277798 3300025986 Bacteria 1435
199 Ga0207677_10013750 3300026023 Bacteria 4700
200 Ga0207677_10131314 3300026023 Bacteria 1902
201 Ga0207678_10185309 3300026067 Bacteria 1778
202 Ga0207648_10576990 3300026089 Bacteria 1035
203 Ga0207674_10008843 3300026116 Bacteria 11585
204 Ga0207675_100043789 3300026118 Bacteria 4180
205 Ga0207675_100221438 3300026118 Unclassified 1823
206 Ga0209281_1006244 3300027111 Bacteria 3141
207 Ga0209371_1000179 3300027312 Bacteria 93861
208 Ga0209371_1007175 3300027312 Bacteria 3939
209 Ga0209179_1050239 3300027512 Bacteria 893
210 Ga0209968_1000828 3300027526 Bacteria 4792
211 Ga0209282_1000063 3300027666 Bacteria 93789
212 Ga0209588_1012156 3300027671 Bacteria 2610
213 Ga0209588_1048524 3300027671 Bacteria 1374
214 Ga0209588_1053176 3300027671 Bacteria 1310
215 Ga0209966_1000113 3300027695 Bacteria 35785
216 Ga0207428_10000053 3300027907 Bacteria 175238
217 Ga0268265_10616096 3300028380 Bacteria 1039
218 Ga0268265_11025098 3300028380 Unclassified 816
219 Ga0268256_1000149 3300030500 Bacteria 93861
220 Ga0268256_1007359 3300030500 Bacteria 3939
221 Ga0265330_10059521 3300031235 Bacteria 1663
222 Ga0265332_10000004 3300031238 Bacteria 426592
223 Ga0265332_10063984 3300031238 Bacteria 1571
224 Ga0265328_10130958 3300031239 Bacteria 939
225 Ga0265325_10004532 3300031241 Bacteria 8754
226 Ga0265340_10010495 3300031247 Bacteria 4952
227 Ga0265339_10048781 3300031249 Bacteria 2321
228 Ga0265327_10033395 3300031251 Bacteria 2867
229 Ga0265316_10321300 3300031344 Bacteria 1124
230 Ga0316579_10153961 3300031691 Bacteria 1110
231 Ga0265314_10126154 3300031711 Bacteria 1603
232 Ga0316576_10000081 3300031727 Bacteria 32958
233 Ga0316576_10155073 3300031727 Bacteria 1726
234 Ga0316578_10153176 3300031728 Bacteria 1389
235 Ga0316577_10002634 3300031733 Bacteria 8909
236 Ga0316577_10202973 3300031733 Bacteria 1120
237 Ga0307412_10000015 3300031911 Bacteria 333589
238 Ga0307412_10001867 3300031911 Bacteria 11649
239 Ga0307416_100708478 3300032002 Bacteria 1096
240 Ga0316574_0105614 3300035398 Bacteria 1804
241 Ga0373947_0466682 3300035725 Bacteria 856
242 Ga0373937_0619578 3300036401 Bacteria 1027
243 Ga0316582_0230158 3300036647 Bacteria 1269
244 Ga0316584_0000228 3300036712 Bacteria 27809
245 Ga0316584_0024488 3300036712 Bacteria 4417
246 Ga0316584_0109821 3300036712 Bacteria 2064
247 Ga0395899_0031605 3300037312 Bacteria 3978
248 Ga0395899_0303829 3300037312 Bacteria 1079
249 Ga0395900_0369450 3300037418 Bacteria 1404
250 Ga0395900_0495532 3300037418 Bacteria 1173
251 Ga0395900_0528583 3300037418 Bacteria 1126
252 Ga0395900_0578127 3300037418 Bacteria 1065
253 Ga0395898_0126774 3300037466 Bacteria 2445
254 Ga0395898_0352630 3300037466 Bacteria 1403
255 Ga0395901_0193712 3300038443 Bacteria 2131
256 Ga0400490_56776 3300038726 Bacteria 13571
257 Ga0436361_0044094 3300039447 Bacteria 14634
258 Ga0436361_0248460 3300039447 Bacteria 20376
259 Ga0436361_0579422 3300039447 Bacteria 4882
260 Ga0436361_0626929 3300039447 Bacteria 1068
261 Ga0436361_0851104 3300039447 Bacteria 2188
262 Ga0436361_0878688 3300039447 Bacteria 1229
263 Ga0436361_1101954 3300039447 Bacteria 36014
264 Ga0436361_1217079 3300039447 Bacteria 818
265 Ga0439443_006206 3300042003 Bacteria 1629
266 Ga0439435_0005209 3300042436 Bacteria 2850
267 Ga0439460_0033628 3300042461 Bacteria 1474
268 Ga0451577_0152857 3300042876 Bacteria 2077
269 Ga0466966_0245837 3300044684 Bacteria 1078
270 Ga0466961_0000755 3300044693 Bacteria 20249
271 Ga0453684_0042947 3300044712 Bacteria 6085
272 Ga0466957_0007062 3300044842 Bacteria 6349
273 Ga0466957_0246282 3300044842 Bacteria 1187
274 Ga0451576_0000692 3300045051 Bacteria 68341
275 Ga0451576_0016722 3300045051 Bacteria 8091
276 Ga0495592_0012491 3300046454 Bacteria 6453
277 Ga0495603_0153449 3300046455 Bacteria 1337
278 Ga0495590_0026395 3300046457 Bacteria 2039
279 Ga0495629_0011848 3300046459 Bacteria 6324
280 Ga0495629_0022657 3300046459 Bacteria 4476
281 Ga0495651_0257897 3300046462 Bacteria 1187
282 Ga0495653_0007072 3300046463 Bacteria 9203
283 Ga0495653_0029358 3300046463 Bacteria 4390
284 Ga0495650_0007390 3300046471 Bacteria 6610
285 Ga0495580_0000112 3300046472 Bacteria 55094
286 Ga0495580_0009334 3300046472 Bacteria 7718
287 Ga0495580_0052398 3300046472 Bacteria 2882
288 Ga0495582_0054507 3300046473 Bacteria 2204
289 Ga0495605_0005870 3300046474 Bacteria 7095
290 Ga0495664_0041802 3300046477 Bacteria 2713
291 Ga0495584_0029381 3300046491 Bacteria 2785
292 Ga0495596_0000845 3300046500 Bacteria 18533
293 Ga0495596_0058588 3300046500 Bacteria 1502
294 Ga0495607_0010604 3300046501 Bacteria 6184
295 Ga0495606_0009167 3300046507 Bacteria 8418
296 Ga0495606_0037375 3300046507 Bacteria 3298
297 Ga0495608_0004356 3300046511 Bacteria 10145
298 Ga0495610_0001412 3300046512 Bacteria 21246
299 Ga0495610_0005804 3300046512 Bacteria 8682
300 Ga0495616_0005226 3300046513 Bacteria 8020
301 Ga0495618_0010664 3300046514 Bacteria 5562
302 Ga0495628_0077184 3300046516 Bacteria 2591
303 Ga0495628_0195170 3300046516 Bacteria 1527
304 Ga0495630_0051661 3300046517 Bacteria 3076
305 Ga0495643_0048902 3300046522 Bacteria 2283
306 Ga0495648_0009388 3300046524 Bacteria 7591
307 Ga0495666_0024845 3300046526 Bacteria 2959
308 Ga0495642_0010666 3300046528 Bacteria 3519
309 Ga0495652_0010131 3300046529 Bacteria 8549
310 Ga0495652_0475679 3300046529 Bacteria 870
311 Ga0495665_0017881 3300046531 Bacteria 3810
312 Ga0495586_0006096 3300046535 Bacteria 6445
313 Ga0495609_0007836 3300046538 Bacteria 5283
314 Ga0495611_0124308 3300046648 Bacteria 1203
315 Ga0495635_0046356 3300046663 Bacteria 2998
316 Ga0495661_0021128 3300046665 Bacteria 4246
317 Ga0495657_0011116 3300046675 Bacteria 6746
318 Ga0495657_0176159 3300046675 Bacteria 1315
319 Ga0495657_0237395 3300046675 Bacteria 1101
320 Ga0495623_0003925 3300046679 Bacteria 9804
321 Ga0495646_0014800 3300046680 Bacteria 4958
322 Ga0495669_0151277 3300046684 Bacteria 1099
323 Ga0495624_0000022 3300046690 Bacteria 99926
324 Ga0495624_0007374 3300046690 Bacteria 7724
325 Ga0495624_0022254 3300046690 Bacteria 4193
326 Ga0495589_0101358 3300046794 Bacteria 1393
327 Ga0495589_0109001 3300046794 Bacteria 1337
328 Ga0495600_0005987 3300046809 Bacteria 7362
329 Ga0495581_0033928 3300047315 Bacteria 2953
330 Ga0495604_0004345 3300047317 Bacteria 11224
331 Ga0495604_0076124 3300047317 Bacteria 2525
332 Ga0495604_0181604 3300047317 Bacteria 1471
333 Ga0495604_0224675 3300047317 Bacteria 1291
334 Ga0495636_0034528 3300047318 Bacteria 2082
335 Ga0495674_0037727 3300047319 Bacteria 4341
336 Ga0495674_0072442 3300047319 Bacteria 2971
337 Ga0495676_0034347 3300047321 Bacteria 4257
338 Ga0495680_0039831 3300047322 Bacteria 3746
339 Ga0495680_0040149 3300047322 Bacteria 3729
340 Ga0495683_0024656 3300047323 Bacteria 3086
341 Ga0495683_0061579 3300047323 Bacteria 1858
342 Ga0495687_009669 3300047443 Bacteria 5365
343 Ga0495675_0011853 3300047444 Bacteria 5479
344 Ga0495675_0014736 3300047444 Bacteria 4941
345 Ga0495675_0029972 3300047444 Bacteria 3471
346 Ga0495684_0063898 3300047471 Bacteria 2798
347 Ga0495684_0345405 3300047471 Bacteria 1058
348 Ga0495593_0005220 3300047673 Bacteria 7675
349 Ga0495593_0030119 3300047673 Bacteria 2971
350 Ga0495602_0007772 3300048088 Bacteria 11206
351 Ga0495602_0071685 3300048088 Bacteria 2957
352 Ga0495602_0139954 3300048088 Bacteria 1916
353 Ga0495602_0199272 3300048088 Bacteria 1529
354 Ga0495614_0006924 3300048089 Bacteria 5070
355 Ga0496101_0330854 3300048904 Bacteria 1196
356 Ga0496102_0432787 3300048905 Bacteria 1235
357 Ga0496104_0024116 3300048907 Bacteria 5598
358 Ga0496111_0234256 3300048914 Bacteria 1364
359 Ga0496114_0099159 3300048917 Bacteria 2485
360 Ga0496114_0225670 3300048917 Bacteria 1645
361 Ga0496114_0746069 3300048917 Bacteria 856
362 Ga0496116_0021730 3300048919 Bacteria 4829
363 Ga0496116_0034665 3300048919 Bacteria 3557
364 Ga0496117_0008631 3300048920 Bacteria 9646
365 Ga0496117_0013313 3300048920 Bacteria 7186
366 Ga0496118_0004934 3300048921 Bacteria 15482
367 Ga0496118_0006320 3300048921 Bacteria 13092
368 Ga0496120_0073609 3300048923 Bacteria 1869
369 Ga0496121_0031882 3300048924 Bacteria 4805
370 Ga0496121_0300625 3300048924 Bacteria 1089
371 Ga0496122_0010577 3300048925 Bacteria 9480
372 Ga0496122_0015798 3300048925 Bacteria 7192
373 Ga0496123_0005043 3300048926 Bacteria 13508
374 Ga0496123_0150391 3300048926 Bacteria 1257
375 Ga0496124_0030758 3300048927 Bacteria 4758
376 Ga0496124_0060021 3300048927 Bacteria 3192
377 Ga0496124_0100475 3300048927 Bacteria 2345
378 Ga0496124_0234815 3300048927 Bacteria 1368
379 Ga0496125_0000101 3300048928 Bacteria 202248
380 Ga0496125_0000306 3300048928 Bacteria 96360
381 Ga0496126_0000328 3300048929 Bacteria 101511
382 Ga0496126_0001426 3300048929 Bacteria 37638
383 Ga0501033_0201344 3300049570 Bacteria 1422
384 Ga0501034_0006359 3300049571 Bacteria 12720
385 Ga0501034_0206998 3300049571 Bacteria 1918
386 Ga0501034_0426398 3300049571 Bacteria 1247
387 Ga0501081_0126559 3300049743 Bacteria 1823
388 Ga0501035_0123283 3300049822 Bacteria 2264
389 Ga0501035_0261782 3300049822 Bacteria 1466
390 nmdc:mga05p37_628724_c1 3300050507 Bacteria 1207
391 nmdc:mga08y16_30_c1 3300050511 Bacteria 197110
392 nmdc:mga08x19_40983_c1 3300050514 Bacteria 2949
393 Ga0500643_042724 3300053087 Bacteria 1325
394 Ga0500618_000162 3300053125 Bacteria 55775
395 Ga0500618_003946 3300053125 Bacteria 4914
396 Ga0500636_0000001 3300053177 Bacteria 324086
397 Ga0500645_008571 3300053730 Bacteria 3484
398 Ga0501082_0422328 3300060353 Bacteria 1164
399 Ga0530510_0181169 3300061734 Bacteria 1562
400 Ga0530510_0356069 3300061734 Bacteria 1100
401 2501071191 2501025501 Bacteria 7768574
402 2501078643 2501025502 Bacteria 9641094
403 2501414071 2501025504 Bacteria 8008976
404 2509128351 2508501125 Bacteria 7208311
405 2511089290 2510917013 Bacteria 9951648
406 2511094671 2510917014 Bacteria 8296963
407 2511104378 2510917015 Bacteria 7950052
408 2513555980 2513237082 Bacteria 8640282
409 2513565533 2513237083 Bacteria 8410967
410 2513954360 2513237150 Bacteria 6553639
411 2513958919 2513237151 Bacteria 6309801
412 2514040960 2513237165 Bacteria 6771773
413 2516025346 2515154189 Bacteria 9629850
414 2519463296 2519103095 Bacteria 6629912
415 2527076201 2526164713 Bacteria 6780608
416 2553003572 2551306416 Bacteria 6152985
417 2574430403 2574179768 Bacteria 4907129
418 2585295107 2582581311 Bacteria 6763856
419 2599738901 2599185239 Bacteria 8686614
420 2599746391 2599185240 Bacteria 7968121
421 2600208214 2599185355 Bacteria 7968906
422 2644169428 2643221629 Bacteria 5850260
423 2644339264 2643221660 Bacteria 4208257
424 2644350825 2643221662 Bacteria 5851492
425 2676743896 2675903129 Bacteria 7964495
426 2687579077 2687453129 Bacteria 4387428
427 2715499024 2713897090 Bacteria 3353799
428 2723879426 2721755763 Bacteria 4464185
429 2738822923 2738541296 Bacteria 7285013
430 2738835130 2738541298 Bacteria 7286732
431 2738876609 2738541306 Bacteria 7284992
432 2739188553 2738543002 Bacteria 7284546
433 2739223205 2738543008 Bacteria 7282815
434 2817263327 2816332253 Bacteria 6764532
435 2817276708 2816332256 Bacteria 6891714
436 2817452784 2816332286 Bacteria 6853759
437 2819631474 2818991452 Bacteria 8442785
438 2819714099 2818991466 Bacteria 4748179
439 2834581185 2834578030 Bacteria 3530182
440 2834645575 2834641062 Bacteria 5559922
441 2842778445 2842775625 Bacteria 5587290
442 2846953420 2846952575 Bacteria 6587527
443 2848858894 2848858292 Bacteria 7391279
444 2854681365 2854681122 Bacteria 4548679
445 2854916179 2854911287 Bacteria 5582813
446 2855021966 2855020534 Bacteria 3204685
447 2856291592 2856287931 Bacteria 7223934
448 2857364650 2857357740 Bacteria 9937880
449 2863426664 2863421361 Bacteria 7300805
450 2870075889 2870068957 Bacteria 8925310
451 2883093846 2883087390 Bacteria 9532701
452 2891636105 2891633521 Bacteria 4602265
453 2898797858 2898795034 Bacteria 4294459
454 2899278004 2899275550 Bacteria 3958688
455 2900640838 2900634093 Bacteria 10263517
456 2901312266 2901300506 Bacteria 8463898
457 2904534534 2904530477 Bacteria 5876334
458 2904566747 2904564687 Bacteria 7609577
459 2904573792 2904571731 Bacteria 7608790
460 2904584426 2904584206 Bacteria 6028872
461 2904590894 2904589729 Bacteria 6113573
462 2904603265 2904601388 Bacteria 5884906
463 2919047276 2919046199 Bacteria 5567169
464 2919080832 2919079590 Bacteria 5946433
465 2919527526 2919527303 Bacteria 7718827
466 2919679283 2919679072 Bacteria 4629602
467 2919708100 2919704043 Bacteria 5560311
468 2923512411 2923510766 Bacteria 5926163
469 2924787065 2924784321 Bacteria 7416538
470 2928132461 2928130867 Bacteria 5467269
471 2928166538 2928163908 Bacteria 7561269
472 2928176056 2928170801 Bacteria 8785406
473 2928542976 2928536128 Bacteria 7657547
474 2928970208 2928968154 Bacteria 4633371
475 2929205170 2929199973 Bacteria 7260745
476 2945939087 2945934425 Bacteria 7444609
477 2952252730 2952252522 Bacteria 4171745
478 2981996505 2981990288 Bacteria 7590678
479 2990709090 2990703756 Bacteria 7715990
480 3000019404 3000017691 Bacteria 3772574
481 639786286 639633007 Bacteria 4376040
482 642421320 641736151 Bacteria 7477263
483 642415268 641736154 Bacteria 7689995
484 642616431 642555113 Bacteria 8214658
485 644748890 644736347 Bacteria 6476522
486 8003400788 8003400568 Bacteria 5535898
487 8003961807 8003955200 Bacteria 8601927
488 8018847207 8018845410 Bacteria 8933938
489 8020812321 8020807995 Bacteria 6801506
490 8020950974 8020945358 Bacteria 8467355
491 8021126072 8021120328 Bacteria 8782274
492 8039099949 8039098773 Bacteria 6602928
493 8040172028 8040167225 Bacteria 6542727
494 8040177991 8040173305 Bacteria 6827067
495 8045864717 8045864390 Bacteria 5043873
496 8054568666 8054563764 Bacteria 5592885
497 8055269743 8055266321 Bacteria 7999742
498 8055305938 8055301274 Bacteria 8587385
499 8055915141 8055909800 Bacteria 7278581
500 8057134230 8057132660 Bacteria 4061191
501 8057161784 8057160832 Bacteria 3268302
502 rootH1_10140533
503 MBSR1b_contig_5299885
504 JGI24739J22299_10042487
505 JGI24738J21930_10003472
506 JGI25156J39149_1000324
507 JGI25156J39149_1000538
508 JGI25156J39149_1001082
509 JGI25151J46595_10010762
510 JGI25151J46595_10012830
511 JGI25406J46586_10002487
512 JGI25406J46586_10010509
513 rootH1_10088861
514 rootH2_10160365
515 Ga0006562J51391_1092728
516 JGI25404J52841_10006008
517 Ga0055538_1000016
518 Ga0055539_1000021
519 Ga0055533_1000029
520 Ga0055533_1000088
521 Ga0055532_1000036
522 Ga0055532_1000230
523 Ga0055532_1001110
524 Ga0055525_1000033
525 Ga0055527_1000022
526 Ga0055527_1000042
527 Ga0055527_1000270
528 Ga0055535_1000026
529 Ga0055535_1000036
530 Ga0055535_1000066
531 Ga0055542_1000042
532 Ga0055542_1000061
533 Ga0055542_1001559
534 Ga0055529_1000048
535 Ga0055529_1000069
536 Ga0055526_1007223
537 Ga0055526_1007931
538 Ga0055526_1008895
539 Ga0055524_1001130
540 Ga0055524_1007709
541 Ga0055536_1014442
542 Ga0055534_1000584
543 Ga0055534_1001032
544 Ga0055528_1009412
545 Ga0055541_1000029
546 Ga0065707_10397350
547 Ga0070666_10309439
548 Ga0068868_100100017
549 Ga0070668_100135141
550 Ga0070669_100068610
551 Ga0070671_100002464
552 Ga0070674_100102174
553 Ga0070667_100132106
554 Ga0070708_100004175
555 Ga0070708_100030458
556 Ga0070708_100074912
557 Ga0070706_100052557
558 Ga0070699_100022908
559 Ga0070697_100004370
560 Ga0070697_100618378
561 Ga0068853_100311184
562 Ga0070672_100014436
563 Ga0070696_100276174
564 Ga0070665_100410181
565 Ga0068855_100000147
566 Ga0068857_100361113
567 Ga0068854_100473752
568 Ga0068852_100027760
569 Ga0068852_100072423
570 Ga0068859_100347924
571 Ga0068861_100436405
572 Ga0068851_10015065
573 Ga0081455_10006663
574 Ga0081538_10144481
575 Ga0081540_1003865
576 Ga0081540_1038308
577 Ga0081539_10000076
578 Ga0070716_100037082
579 Ga0070712_100356805
580 Ga0097621_100119293
581 Ga0068871_100036991
582 Ga0075428_100897952
583 Ga0075430_100135393
584 Ga0075433_10257054
585 Ga0075434_100305865
586 Ga0075436_100027272
587 Ga0097620_100347895
588 Ga0079104_1005059
589 Ga0099826_10000018
590 Ga0099794_10009418
591 Ga0099794_10015928
592 Ga0099794_10041726
593 Ga0099794_10060004
594 Ga0099795_10047545
595 Ga0105251_10045303
596 Ga0105240_10000090
597 Ga0105240_10135340
598 Ga0105240_10211935
599 Ga0105240_10333227
600 Ga0111539_10003803
601 Ga0105245_10371803
602 Ga0114129_10070409
603 Ga0114129_10373272
604 Ga0105248_10032018
605 Ga0105237_10071477
606 Ga0105237_10077314
607 Ga0105238_10007697
608 Ga0105238_10342581
609 Ga0105249_10284653
610 Ga0099796_10010023
611 Ga0099796_10161267
612 Ga0105239_10042948
613 Ga0157371_10219542
614 Ga0157374_11084294
615 Ga0157378_10040563
616 Ga0163162_10144710
617 Ga0157375_10222242
618 Ga0163163_10109637
619 Ga0157380_10328804
620 Ga0182008_10000969
621 Ga0182008_10029666
622 Ga0182006_1002233
623 Ga0182006_1054833
624 Ga0182007_10017310
625 Ga0182005_1053547
626 Ga0213872_10000017
627 Ga0213872_10002147
628 Ga0213872_10006862
629 Ga0213872_10008650
630 Ga0209784_100033
631 Ga0209566_100037
632 Ga0209566_105426
633 Ga0209674_100011
634 Ga0209674_100048
635 Ga0209674_100055
636 Ga0209672_100002
637 Ga0209672_100035
638 Ga0209672_100090
639 Ga0209147_100003
640 Ga0209147_100041
641 Ga0209147_100132
642 Ga0209563_100056
643 Ga0209563_100233
644 Ga0209258_100005
645 Ga0209258_100063
646 Ga0209258_100211
647 Ga0209677_100034
648 Ga0209148_1000006
649 Ga0209148_1000088
650 Ga0209148_1000443
651 Ga0209759_1000002
652 Ga0209759_1000009
653 Ga0209759_1000039
654 Ga0209759_1002739
655 Ga0209233_1028893
656 Ga0209565_1000093
657 Ga0209455_1000003
658 Ga0209455_1000075
659 Ga0209455_1000631
660 Ga0209673_1000061
661 Ga0209675_1000100
662 Ga0209675_1001317
663 Ga0209675_1017050
664 Ga0209676_1000141
665 Ga0209025_1000390
666 Ga0209025_1000755
667 Ga0209025_1001457
668 Ga0209025_1011865
669 Ga0209564_1001462
670 Ga0209564_1001510
671 Ga0209564_1004397
672 Ga0209564_1013615
673 Ga0209758_1026270
674 Ga0209256_1000434
675 Ga0209256_1001596
676 Ga0209051_1015883
677 Ga0209051_1045626
678 Ga0207656_10014256
679 Ga0207680_10094243
680 Ga0207647_10023740
681 Ga0207684_10146413
682 Ga0207695_10000176
683 Ga0207695_10454963
684 Ga0207671_10028213
685 Ga0207663_10310358
686 Ga0207681_10040657
687 Ga0207644_10003288
688 Ga0207644_10137078
689 Ga0207690_10036841
690 Ga0207706_10086893
691 Ga0207669_10029144
692 Ga0207665_10016025
693 Ga0207691_10018336
694 Ga0207711_10010976
695 Ga0207689_10669198
696 Ga0207679_10698759
697 Ga0207667_10000034
698 Ga0207658_10018474
699 Ga0207658_10277798
700 Ga0207677_10013750
701 Ga0207677_10131314
702 Ga0207678_10185309
703 Ga0207648_10576990
704 Ga0207674_10008843
705 Ga0207675_100043789
706 Ga0207675_100221438
707 Ga0209281_1006244
708 Ga0209371_1000179
709 Ga0209371_1007175
710 Ga0209179_1050239
711 Ga0209968_1000828
712 Ga0209282_1000063
713 Ga0209588_1012156
714 Ga0209588_1048524
715 Ga0209588_1053176
716 Ga0209966_1000113
717 Ga0207428_10000053
718 Ga0268265_10616096
719 Ga0268265_11025098
720 Ga0268256_1000149
721 Ga0268256_1007359
722 Ga0265330_10059521
723 Ga0265332_10000004
724 Ga0265332_10063984
725 Ga0265328_10130958
726 Ga0265325_10004532
727 Ga0265340_10010495
728 Ga0265339_10048781
729 Ga0265327_10033395
730 Ga0265316_10321300
731 Ga0316579_10153961
732 Ga0265314_10126154
733 Ga0316576_10000081
734 Ga0316576_10155073
735 Ga0316578_10153176
736 Ga0316577_10002634
737 Ga0316577_10202973
738 Ga0307412_10000015
739 Ga0307412_10001867
740 Ga0307416_100708478
741 Ga0316574_0105614
742 Ga0373947_0466682
743 Ga0373937_0619578
744 Ga0316582_0230158
745 Ga0316584_0000228
746 Ga0316584_0024488
747 Ga0316584_0109821
748 Ga0395899_0031605
749 Ga0395899_0303829
750 Ga0395900_0369450
751 Ga0395900_0495532
752 Ga0395900_0528583
753 Ga0395900_0578127
754 Ga0395898_0126774
755 Ga0395898_0352630
756 Ga0395901_0193712
757 Ga0400490_56776
758 Ga0436361_0044094
759 Ga0436361_0248460
760 Ga0436361_0579422
761 Ga0436361_0626929
762 Ga0436361_0851104
763 Ga0436361_0878688
764 Ga0436361_1101954
765 Ga0436361_1217079
766 Ga0439443_006206
767 Ga0439435_0005209
768 Ga0439460_0033628
769 Ga0451577_0152857
770 Ga0466966_0245837
771 Ga0466961_0000755
772 Ga0453684_0042947
773 Ga0466957_0007062
774 Ga0466957_0246282
775 Ga0451576_0000692
776 Ga0451576_0016722
777 Ga0495592_0012491
778 Ga0495603_0153449
779 Ga0495590_0026395
780 Ga0495629_0011848
781 Ga0495629_0022657
782 Ga0495651_0257897
783 Ga0495653_0007072
784 Ga0495653_0029358
785 Ga0495650_0007390
786 Ga0495580_0000112
787 Ga0495580_0009334
788 Ga0495580_0052398
789 Ga0495582_0054507
790 Ga0495605_0005870
791 Ga0495664_0041802
792 Ga0495584_0029381
793 Ga0495596_0000845
794 Ga0495596_0058588
795 Ga0495607_0010604
796 Ga0495606_0009167
797 Ga0495606_0037375
798 Ga0495608_0004356
799 Ga0495610_0001412
800 Ga0495610_0005804
801 Ga0495616_0005226
802 Ga0495618_0010664
803 Ga0495628_0077184
804 Ga0495628_0195170
805 Ga0495630_0051661
806 Ga0495643_0048902
807 Ga0495648_0009388
808 Ga0495666_0024845
809 Ga0495642_0010666
810 Ga0495652_0010131
811 Ga0495652_0475679
812 Ga0495665_0017881
813 Ga0495586_0006096
814 Ga0495609_0007836
815 Ga0495611_0124308
816 Ga0495635_0046356
817 Ga0495661_0021128
818 Ga0495657_0011116
819 Ga0495657_0176159
820 Ga0495657_0237395
821 Ga0495623_0003925
822 Ga0495646_0014800
823 Ga0495669_0151277
824 Ga0495624_0000022
825 Ga0495624_0007374
826 Ga0495624_0022254
827 Ga0495589_0101358
828 Ga0495589_0109001
829 Ga0495600_0005987
830 Ga0495581_0033928
831 Ga0495604_0004345
832 Ga0495604_0076124
833 Ga0495604_0181604
834 Ga0495604_0224675
835 Ga0495636_0034528
836 Ga0495674_0037727
837 Ga0495674_0072442
838 Ga0495676_0034347
839 Ga0495680_0039831
840 Ga0495680_0040149
841 Ga0495683_0024656
842 Ga0495683_0061579
843 Ga0495687_009669
844 Ga0495675_0011853
845 Ga0495675_0014736
846 Ga0495675_0029972
847 Ga0495684_0063898
848 Ga0495684_0345405
849 Ga0495593_0005220
850 Ga0495593_0030119
851 Ga0495602_0007772
852 Ga0495602_0071685
853 Ga0495602_0139954
854 Ga0495602_0199272
855 Ga0495614_0006924
856 Ga0496101_0330854
857 Ga0496102_0432787
858 Ga0496104_0024116
859 Ga0496111_0234256
860 Ga0496114_0099159
861 Ga0496114_0225670
862 Ga0496114_0746069
863 Ga0496116_0021730
864 Ga0496116_0034665
865 Ga0496117_0008631
866 Ga0496117_0013313
867 Ga0496118_0004934
868 Ga0496118_0006320
869 Ga0496120_0073609
870 Ga0496121_0031882
871 Ga0496121_0300625
872 Ga0496122_0010577
873 Ga0496122_0015798
874 Ga0496123_0005043
875 Ga0496123_0150391
876 Ga0496124_0030758
877 Ga0496124_0060021
878 Ga0496124_0100475
879 Ga0496124_0234815
880 Ga0496125_0000101
881 Ga0496125_0000306
882 Ga0496126_0000328
883 Ga0496126_0001426
884 Ga0501033_0201344
885 Ga0501034_0006359
886 Ga0501034_0206998
887 Ga0501034_0426398
888 Ga0501081_0126559
889 Ga0501035_0123283
890 Ga0501035_0261782
891 nmdc:mga05p37_628724_c1
892 nmdc:mga08y16_30_c1
893 nmdc:mga08x19_40983_c1
894 Ga0500643_042724
895 Ga0500618_000162
896 Ga0500618_003946
897 Ga0500636_0000001
898 Ga0500645_008571
899 Ga0501082_0422328
900 Ga0530510_0181169
901 Ga0530510_0356069
902 2501071191
903 2501078643
904 2501414071
905 2509128351
906 2511089290
907 2511094671
908 2511104378
909 2513555980
910 2513565533
911 2513954360
912 2513958919
913 2514040960
914 2516025346
915 2519463296
916 2527076201
917 2553003572
918 2574430403
919 2585295107
920 2599738901
921 2599746391
922 2600208214
923 2644169428
924 2644339264
925 2644350825
926 2676743896
927 2687579077
928 2715499024
929 2723879426
930 2738822923
931 2738835130
932 2738876609
933 2739188553
934 2739223205
935 2817263327
936 2817276708
937 2817452784
938 2819631474
939 2819714099
940 2834581185
941 2834645575
942 2842778445
943 2846953420
944 2848858894
945 2854681365
946 2854916179
947 2855021966
948 2856291592
949 2857364650
950 2863426664
951 2870075889
952 2883093846
953 2891636105
954 2898797858
955 2899278004
956 2900640838
957 2901312266
958 2904534534
959 2904566747
960 2904573792
961 2904584426
962 2904590894
963 2904603265
964 2919047276
965 2919080832
966 2919527526
967 2919679283
968 2919708100
969 2923512411
970 2924787065
971 2928132461
972 2928166538
973 2928176056
974 2928542976
975 2928970208
976 2929205170
977 2945939087
978 2952252730
979 2981996505
980 2990709090
981 3000019404
982 639786286
983 642421320
984 642415268
985 642616431
986 644748890
987 8003400788
988 8003961807
989 8018847207
990 8020812321
991 8020950974
992 8021126072
993 8039099949
994 8040172028
995 8040177991
996 8045864717
997 8054568666
998 8055269743
999 8055305938
1000 8055915141
1001 8057134230
1002 8057161784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04172

LrgB

LrgB-like family

25

239

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xat-assembly1.cif.gz_D structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.3591 22 238
5xat-assembly1.cif.gz_D structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.3316 22 238
6z3z-assembly1.cif.gz_B cryoem structure of horse sodium/proton exchanger nhe9 without c-terminal regulatory domain in an inward-facing conformation 0.3048 16 237
6z3z-assembly1.cif.gz_B cryoem structure of horse sodium/proton exchanger nhe9 without c-terminal regulatory domain in an inward-facing conformation 0.2882 16 237
6h5a-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate 0.2738 120 235
ID Description Score Start End Superfamily
af_P62723_18_326_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.5068 19 236 1.20.1530.20
af_P62723_18_326_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.471 19 236 1.20.1530.20
af_A0A1D8PCL5_75_277_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4026 128 237 1.20.1250.20
af_O44695_7_274_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3974 158 236 1.20.1070.10
af_Q0DVI9_1_189_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.3767 1 237 1.20.1530.20
ID Description Score Start End GO Terms
AF-J3HZ25-F1-model_v4 Putative effector of murein hydrolase 0.9744 106 239 GO:0016020
GO:0016787
AF-A0A257PNX9-F1-model_v4 LrgB family protein 0.9741 120 239 GO:0016020
AF-A0A7X7MUN7-F1-model_v4 LrgB family protein 0.9678 126 239 GO:0016020
AF-A0A0M2NM45-F1-model_v4 deleted 0.9628 117 237
AF-C2WAI0-F1-model_v4 deleted 0.9627 95 236

Map