F455613

General Info

Members Datasets Scaffolds Average Seq Length
500 240 491 248

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0799683|Ga0501047_0799683_26_745
Length 232
Sequence VLVTGAARRIGAEVARTLHGAGYDLALHCRHSRAELDALLAELEQARAGSTLALQADLAEVAQLPVLVDATLARFGRLDGLVNNASVFQPTPIGGITAAQWDSLFAANARAPLFHLARQRGAIVNLVDIYAERPLPGHAVYCMAKAALVMATRALAQELAPDVRVNGVAPGAVLWPEHGEGAADRAALLARTPLARSGTPGEVAGAVLWLLRDARYTTGEIVRVDGGRSLAI

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
4 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
5 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
6 2739367700 Dyella sp. YR388 Isolate Unclassified
7 2884411467 Dyella sp. AD56 Isolate Rhizosphere
8 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
9 2928963466 Dyella japonica 1073 Isolate Unclassified
10 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
27 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
28 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
104 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
105 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
109 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
186 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 0.8
Isolates 2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19
Nodule 0
Rhizoplane 2.6
Rhizosphere 65.8
Stem 0
Stem Tuber 0
Unclassified 12.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10032961 3300001989 Bacteria 1777
2 JGI24737J22298_10002961 3300001990 Bacteria 6016
3 JGI24735J21928_10007207 3300002067 Bacteria 3627
4 JGI25156J39149_1001002 3300002705 Bacteria 13286
5 JGI25156J39149_1018491 3300002705 Bacteria 1285
6 JGI25162J39368_1000168 3300002737 Bacteria 72115
7 JGI25162J39368_1000538 3300002737 Bacteria 28189
8 JGI25162J39368_1000924 3300002737 Bacteria 18847
9 JGI25162J39368_1001519 3300002737 Bacteria 12020
10 JGI25162J39368_1001920 3300002737 Bacteria 9516
11 JGI25157J39369_1000196 3300002741 Bacteria 51212
12 JGI25157J39369_1000989 3300002741 Bacteria 13286
13 JGI25157J39369_1001449 3300002741 Bacteria 8885
14 JGI25157J39369_1001486 3300002741 Bacteria 8634
15 JGI25163J39215_1000537 3300002771 Bacteria 11106
16 JGI25164J39214_1000004 3300002772 Bacteria 350814
17 JGI25164J39214_1000132 3300002772 Bacteria 72064
18 JGI25164J39214_1000265 3300002772 Bacteria 38924
19 JGI25164J39214_1000665 3300002772 Bacteria 14025
20 JGI25165J46597_1000242 3300003214 Bacteria 74940
21 JGI25165J46597_1000271 3300003214 Bacteria 66785
22 JGI25165J46597_1000828 3300003214 Bacteria 23057
23 JGI25165J46597_1002100 3300003214 Bacteria 7287
24 JGI25153J46596_10012497 3300003215 Bacteria 3659
25 rootH1_10128341 3300003316 Bacteria 2835
26 rootH1_10128341 3300003323 Bacteria 1626
27 rootH2_10000507 3300003320 Bacteria 26810
28 rootH2_10086143 3300003320 Bacteria 2201
29 rootH2_10142418 3300003320 Bacteria 1206
30 rootL2_10137420 3300003322 Bacteria 3224
31 rootH1_10247911 3300003323 Bacteria 1901
32 Ga0006562J51391_1074911 3300003578 Bacteria 9320
33 Ga0006562J51391_1074912 3300003578 Bacteria 9492
34 Ga0055538_1004343 3300003751 Bacteria 1622
35 Ga0055539_1002899 3300003752 Bacteria 2497
36 Ga0055539_1010088 3300003752 Bacteria 1170
37 Ga0055533_1001034 3300003756 Bacteria 8054
38 Ga0055533_1002026 3300003756 Bacteria 4921
39 Ga0055533_1011226 3300003756 Bacteria 981
40 Ga0055525_1000152 3300003759 Bacteria 93935
41 Ga0055527_1000059 3300003760 Bacteria 93123
42 Ga0055527_1000452 3300003760 Bacteria 16214
43 Ga0055535_1000207 3300003761 Bacteria 62292
44 Ga0055535_1000232 3300003761 Bacteria 58526
45 Ga0055535_1000511 3300003761 Bacteria 34261
46 Ga0055535_1000726 3300003761 Bacteria 24973
47 Ga0055535_1001120 3300003761 Bacteria 16214
48 Ga0055535_1001270 3300003761 Bacteria 13884
49 Ga0055535_1012508 3300003761 Bacteria 1293
50 Ga0055542_1000137 3300003762 Bacteria 93123
51 Ga0055542_1000207 3300003762 Bacteria 72115
52 Ga0055542_1000239 3300003762 Bacteria 63224
53 Ga0055542_1000417 3300003762 Bacteria 41501
54 Ga0055542_1000438 3300003762 Bacteria 39848
55 Ga0055542_1001106 3300003762 Bacteria 16214
56 Ga0055529_1000092 3300003763 Bacteria 137763
57 Ga0055529_1000225 3300003763 Bacteria 72635
58 Ga0055529_1000909 3300003763 Bacteria 16214
59 Ga0055529_1001010 3300003763 Bacteria 13545
60 Ga0055529_1014227 3300003763 Bacteria 1009
61 Ga0065165_1001811 3300005262 Bacteria 20957
62 Ga0068869_100007763 3300005334 Bacteria 6881
63 Ga0070680_100326419 3300005336 Bacteria 1303
64 Ga0070682_100005615 3300005337 Bacteria 6991
65 Ga0070682_100042169 3300005337 Bacteria 2815
66 Ga0070682_100068361 3300005337 Bacteria 2266
67 Ga0068868_100108528 3300005338 Bacteria 2253
68 Ga0070660_100077922 3300005339 Bacteria 2598
69 Ga0070660_100177521 3300005339 Bacteria 1723
70 Ga0070689_100011511 3300005340 Bacteria 6341
71 Ga0070661_100070421 3300005344 Bacteria 2572
72 Ga0070661_100259887 3300005344 Bacteria 1342
73 Ga0070661_100265384 3300005344 Bacteria 1328
74 Ga0070692_10020881 3300005345 Bacteria 3180
75 Ga0070668_100013123 3300005347 Bacteria 6175
76 Ga0070675_100019450 3300005354 Bacteria 5412
77 Ga0070673_100107236 3300005364 Bacteria 2310
78 Ga0070688_100014451 3300005365 Bacteria 4474
79 Ga0070688_100116090 3300005365 Bacteria 1787
80 Ga0070659_100009262 3300005366 Bacteria 7228
81 Ga0070659_100014534 3300005366 Bacteria 5883
82 Ga0070659_100071500 3300005366 Bacteria 2758
83 Ga0070667_100032514 3300005367 Bacteria 4352
84 Ga0070667_100278592 3300005367 Bacteria 1501
85 Ga0070714_100030666 3300005435 Bacteria 4478
86 Ga0070713_100003472 3300005436 Bacteria 10404
87 Ga0070694_100115566 3300005444 Bacteria 1918
88 Ga0070663_100044233 3300005455 Bacteria 3138
89 Ga0070663_100068897 3300005455 Bacteria 2569
90 Ga0070663_100107391 3300005455 Bacteria 2092
91 Ga0070663_100219202 3300005455 Bacteria 1493
92 Ga0070678_100008384 3300005456 Bacteria 6188
93 Ga0070662_100054768 3300005457 Bacteria 2891
94 Ga0070681_10003497 3300005458 Bacteria 14707
95 Ga0070681_10116968 3300005458 Bacteria 2603
96 Ga0070681_10917353 3300005458 Bacteria 795
97 Ga0068867_100010992 3300005459 Bacteria 6381
98 Ga0070685_10001702 3300005466 Bacteria 11560
99 Ga0070685_10009310 3300005466 Bacteria 5069
100 Ga0070679_100071824 3300005530 Bacteria 3453
101 Ga0068853_100019439 3300005539 Bacteria 5631
102 Ga0068853_100255467 3300005539 Bacteria 1609
103 Ga0070672_100018395 3300005543 Bacteria 5052
104 Ga0070696_100009794 3300005546 Bacteria 6412
105 Ga0070696_100060683 3300005546 Bacteria 2645
106 Ga0070696_100318545 3300005546 Bacteria 1196
107 Ga0070693_100009002 3300005547 Bacteria 4953
108 Ga0070665_100279080 3300005548 Bacteria 1672
109 Ga0068855_100003107 3300005563 Bacteria 20323
110 Ga0068855_100027990 3300005563 Bacteria 6742
111 Ga0068855_100061053 3300005563 Bacteria 4405
112 Ga0068857_100000582 3300005577 Bacteria 26722
113 Ga0068857_100072494 3300005577 Bacteria 3069
114 Ga0068857_100077446 3300005577 Bacteria 2967
115 Ga0068857_100080611 3300005577 Bacteria 2906
116 Ga0068857_100154037 3300005577 Bacteria 2084
117 Ga0068857_100308452 3300005577 Bacteria 1460
118 Ga0068854_100000823 3300005578 Bacteria 18509
119 Ga0068854_100015025 3300005578 Bacteria 5117
120 Ga0068854_100060365 3300005578 Bacteria 2743
121 Ga0068856_100001041 3300005614 Bacteria 29447
122 Ga0068856_100004908 3300005614 Bacteria 13238
123 Ga0068856_100045402 3300005614 Bacteria 4326
124 Ga0068856_100767128 3300005614 Bacteria 984
125 Ga0068852_100492115 3300005616 Bacteria 1220
126 Ga0068852_100733441 3300005616 Bacteria 999
127 Ga0068859_100056245 3300005617 Bacteria 3958
128 Ga0068861_100037616 3300005719 Bacteria 3598
129 Ga0068870_10058983 3300005840 Bacteria 2056
130 Ga0068863_100385756 3300005841 Bacteria 1368
131 Ga0068858_100577313 3300005842 Bacteria 1089
132 Ga0068860_100011841 3300005843 Bacteria 8597
133 Ga0068860_100125921 3300005843 Bacteria 2455
134 Ga0075366_10257400 3300006195 Bacteria 1065
135 Ga0097621_100037576 3300006237 Bacteria 3882
136 Ga0068871_100260384 3300006358 Bacteria 1513
137 Ga0075428_100083984 3300006844 Bacteria 3474
138 Ga0075430_100018223 3300006846 Bacteria 5975
139 Ga0068865_100041015 3300006881 Bacteria 3148
140 Ga0075436_100000939 3300006914 Bacteria 19466
141 Ga0097620_100056245 3300006931 Bacteria 3958
142 Ga0105240_10001890 3300009093 Bacteria 34813
143 Ga0105240_10003120 3300009093 Bacteria 26093
144 Ga0105240_10004144 3300009093 Bacteria 22213
145 Ga0105240_10021623 3300009093 Bacteria 8556
146 Ga0105240_10082857 3300009093 Bacteria 3938
147 Ga0105240_10268428 3300009093 Bacteria 1966
148 Ga0105245_10162716 3300009098 Bacteria 2119
149 Ga0105245_10326348 3300009098 Bacteria 1513
150 Ga0114129_10014152 3300009147 Bacteria 11367
151 Ga0105237_10000036 3300009545 Bacteria 191142
152 Ga0105237_10137205 3300009545 Bacteria 2440
153 Ga0105238_10000775 3300009551 Bacteria 33222
154 Ga0105238_10017198 3300009551 Bacteria 7345
155 Ga0105238_10021100 3300009551 Bacteria 6637
156 Ga0105238_10026616 3300009551 Bacteria 5897
157 Ga0105238_10058108 3300009551 Bacteria 3878
158 Ga0105238_10209813 3300009551 Bacteria 1924
159 Ga0105238_10566677 3300009551 Bacteria 1141
160 Ga0105249_10078210 3300009553 Bacteria 3069
161 Ga0105147_102258 3300009982 Bacteria 1594
162 Ga0105239_10000480 3300010375 Bacteria 58268
163 Ga0105239_10018925 3300010375 Bacteria 7610
164 Ga0105239_10163076 3300010375 Bacteria 2491
165 Ga0105239_10224846 3300010375 Bacteria 2105
166 Ga0105239_10427371 3300010375 Bacteria 1501
167 Ga0105246_10012639 3300011119 Bacteria 5273
168 Ga0157314_1000030 3300012500 Bacteria 14246
169 Ga0157373_10023309 3300013100 Bacteria 4488
170 Ga0157373_10034475 3300013100 Bacteria 3635
171 Ga0157373_10050254 3300013100 Bacteria 2969
172 Ga0157371_10008217 3300013102 Bacteria 8342
173 Ga0157371_10365529 3300013102 Bacteria 1052
174 Ga0157370_10002180 3300013104 Bacteria 23888
175 Ga0157370_10093126 3300013104 Bacteria 2828
176 Ga0157370_10104839 3300013104 Bacteria 2647
177 Ga0157369_10004089 3300013105 Bacteria 17276
178 Ga0157369_10162008 3300013105 Bacteria 2361
179 Ga0157369_10166672 3300013105 Bacteria 2323
180 Ga0157378_10000215 3300013297 Bacteria 55895
181 Ga0163162_10178019 3300013306 Bacteria 2252
182 Ga0163162_10506712 3300013306 Bacteria 1337
183 Ga0157372_10027601 3300013307 Bacteria 6186
184 Ga0157372_10259459 3300013307 Bacteria 2018
185 Ga0157372_10309981 3300013307 Bacteria 1837
186 Ga0182008_10036947 3300014497 Bacteria 2443
187 Ga0182008_10080605 3300014497 Bacteria 1602
188 Ga0157379_10004627 3300014968 Bacteria 11808
189 Ga0182007_10003520 3300015262 Bacteria 7371
190 Ga0182007_10033807 3300015262 Bacteria 1731
191 Ga0183369_1004 3300015685 Bacteria 539301
192 Ga0183368_1002 3300015687 Bacteria 1865598
193 Ga0183361_12171 3300016635 Bacteria 1053
194 Ga0206356_10173653 3300020070 Bacteria 1699
195 Ga0206353_11202800 3300020082 Bacteria 3011
196 Ga0209435_103044 3300025206 Bacteria 1927
197 Ga0209435_103569 3300025206 Bacteria 1772
198 Ga0209760_100687 3300025207 Bacteria 5285
199 Ga0209784_100131 3300025224 Bacteria 75418
200 Ga0209674_100014 3300025226 Bacteria 704989
201 Ga0209674_100058 3300025226 Bacteria 286902
202 Ga0209674_100657 3300025226 Bacteria 12395
203 Ga0209674_101021 3300025226 Bacteria 8548
204 Ga0209672_100043 3300025228 Bacteria 270302
205 Ga0209672_100061 3300025228 Bacteria 206098
206 Ga0209672_100070 3300025228 Bacteria 174481
207 Ga0209672_100250 3300025228 Bacteria 40232
208 Ga0209672_101112 3300025228 Bacteria 11315
209 Ga0209672_104065 3300025228 Bacteria 2820
210 Ga0209563_100062 3300025230 Bacteria 264769
211 Ga0207427_100031 3300025231 Bacteria 350866
212 Ga0207427_100161 3300025231 Bacteria 75712
213 Ga0207427_100194 3300025231 Bacteria 58375
214 Ga0207427_100226 3300025231 Bacteria 48141
215 Ga0209437_100061 3300025233 Bacteria 350866
216 Ga0209437_100116 3300025233 Bacteria 209449
217 Ga0209437_100121 3300025233 Bacteria 202531
218 Ga0209437_100257 3300025233 Bacteria 82683
219 Ga0209437_100464 3300025233 Bacteria 32024
220 Ga0209258_100054 3300025242 Bacteria 339063
221 Ga0209258_100076 3300025242 Bacteria 270302
222 Ga0209258_100092 3300025242 Bacteria 226544
223 Ga0209258_100097 3300025242 Bacteria 216963
224 Ga0209258_100104 3300025242 Bacteria 208582
225 Ga0209258_100715 3300025242 Bacteria 22208
226 Ga0209646_1000254 3300025246 Bacteria 53440
227 Ga0209646_1006130 3300025246 Bacteria 2037
228 Ga0209646_1012888 3300025246 Bacteria 1277
229 Ga0209026_1000143 3300025250 Bacteria 113602
230 Ga0209026_1000230 3300025250 Bacteria 75852
231 Ga0209026_1000277 3300025250 Bacteria 59750
232 Ga0209026_1000661 3300025250 Bacteria 21064
233 Ga0209026_1003690 3300025250 Bacteria 4899
234 Ga0209677_103617 3300025253 Bacteria 4889
235 Ga0209677_106391 3300025253 Bacteria 2795
236 Ga0209148_1000002 3300025254 Bacteria 2399500
237 Ga0209148_1000047 3300025254 Bacteria 434369
238 Ga0209148_1000063 3300025254 Bacteria 346881
239 Ga0209148_1000066 3300025254 Bacteria 339063
240 Ga0209148_1000082 3300025254 Bacteria 270302
241 Ga0209148_1000106 3300025254 Bacteria 208597
242 Ga0209759_1000308 3300025256 Bacteria 66182
243 Ga0209759_1000361 3300025256 Bacteria 58219
244 Ga0209759_1001242 3300025256 Bacteria 15474
245 Ga0209759_1009720 3300025256 Bacteria 2883
246 Ga0209759_1015953 3300025256 Bacteria 1917
247 Ga0209129_1005400 3300025258 Bacteria 4544
248 Ga0209233_1000076 3300025261 Bacteria 350866
249 Ga0209233_1000100 3300025261 Bacteria 293905
250 Ga0209233_1000112 3300025261 Bacteria 258251
251 Ga0209233_1000114 3300025261 Bacteria 246083
252 Ga0209233_1001902 3300025261 Bacteria 8009
253 Ga0209233_1018495 3300025261 Bacteria 1874
254 Ga0209233_1019881 3300025261 Bacteria 1774
255 Ga0209455_1000056 3300025272 Bacteria 349821
256 Ga0209455_1000078 3300025272 Bacteria 270237
257 Ga0209455_1000096 3300025272 Bacteria 217006
258 Ga0209455_1000101 3300025272 Bacteria 206098
259 Ga0209455_1000789 3300025272 Bacteria 17594
260 Ga0209455_1005056 3300025272 Bacteria 4172
261 Ga0209758_1000491 3300025297 Bacteria 64678
262 Ga0207680_10279727 3300025903 Bacteria 1159
263 Ga0207647_10001129 3300025904 Bacteria 20554
264 Ga0207647_10011422 3300025904 Bacteria 6230
265 Ga0207645_10230947 3300025907 Bacteria 1221
266 Ga0207643_10066663 3300025908 Bacteria 2065
267 Ga0207654_10373621 3300025911 Bacteria 986
268 Ga0207707_10019591 3300025912 Bacteria 5904
269 Ga0207707_10022271 3300025912 Bacteria 5540
270 Ga0207695_10000219 3300025913 Bacteria 153492
271 Ga0207695_10001444 3300025913 Bacteria 39750
272 Ga0207695_10001553 3300025913 Bacteria 37757
273 Ga0207695_10002198 3300025913 Bacteria 29376
274 Ga0207695_10002664 3300025913 Bacteria 26087
275 Ga0207695_10010679 3300025913 Bacteria 11216
276 Ga0207671_10000009 3300025914 Bacteria 724862
277 Ga0207671_10000135 3300025914 Bacteria 112401
278 Ga0207671_10018454 3300025914 Bacteria 5352
279 Ga0207671_10054425 3300025914 Bacteria 2965
280 Ga0207660_10218865 3300025917 Bacteria 1494
281 Ga0207657_10104289 3300025919 Bacteria 2349
282 Ga0207657_10582194 3300025919 Bacteria 874
283 Ga0207649_10101837 3300025920 Bacteria 1902
284 Ga0207649_10430847 3300025920 Bacteria 992
285 Ga0207652_10052676 3300025921 Bacteria 3494
286 Ga0207681_10015700 3300025923 Bacteria 4727
287 Ga0207694_10002806 3300025924 Bacteria 14067
288 Ga0207694_10024283 3300025924 Bacteria 4603
289 Ga0207694_10045581 3300025924 Bacteria 3387
290 Ga0207694_10090581 3300025924 Bacteria 2413
291 Ga0207694_10091757 3300025924 Bacteria 2397
292 Ga0207659_10009867 3300025926 Bacteria 5977
293 Ga0207687_10102928 3300025927 Bacteria 2105
294 Ga0207700_10001377 3300025928 Bacteria 13794
295 Ga0207664_10009261 3300025929 Bacteria 6902
296 Ga0207690_10014652 3300025932 Bacteria 4739
297 Ga0207690_10017061 3300025932 Bacteria 4428
298 Ga0207690_10040916 3300025932 Bacteria 3033
299 Ga0207690_10482901 3300025932 Bacteria 1000
300 Ga0207690_10540643 3300025932 Bacteria 946
301 Ga0207706_10014779 3300025933 Bacteria 7067
302 Ga0207670_10005876 3300025936 Bacteria 6772
303 Ga0207704_10023577 3300025938 Bacteria 3320
304 Ga0207691_10017492 3300025940 Bacteria 6797
305 Ga0207689_10017888 3300025942 Bacteria 5987
306 Ga0207667_10000193 3300025949 Bacteria 88949
307 Ga0207667_10000244 3300025949 Bacteria 76441
308 Ga0207667_10067422 3300025949 Bacteria 3728
309 Ga0207667_10098492 3300025949 Bacteria 3017
310 Ga0207651_10253855 3300025960 Bacteria 1440
311 Ga0207712_10046150 3300025961 Bacteria 3019
312 Ga0207668_10021092 3300025972 Bacteria 4151
313 Ga0207640_10000169 3300025981 Bacteria 47286
314 Ga0207640_10000189 3300025981 Bacteria 43839
315 Ga0207640_10047902 3300025981 Bacteria 2760
316 Ga0207640_10078339 3300025981 Bacteria 2249
317 Ga0207658_10216591 3300025986 Bacteria 1608
318 Ga0207658_10258818 3300025986 Bacteria 1482
319 Ga0207658_10505003 3300025986 Bacteria 1077
320 Ga0207677_10052268 3300026023 Bacteria 2775
321 Ga0207703_10406250 3300026035 Bacteria 1264
322 Ga0207639_10032144 3300026041 Bacteria 3862
323 Ga0207639_10275805 3300026041 Bacteria 1477
324 Ga0207678_10025885 3300026067 Bacteria 5121
325 Ga0207678_10030661 3300026067 Bacteria 4695
326 Ga0207678_10158690 3300026067 Bacteria 1932
327 Ga0207678_10227963 3300026067 Bacteria 1595
328 Ga0207702_10000037 3300026078 Bacteria 153366
329 Ga0207702_10000230 3300026078 Bacteria 64987
330 Ga0207702_10011445 3300026078 Bacteria 7396
331 Ga0207702_10331537 3300026078 Bacteria 1452
332 Ga0207641_10591455 3300026088 Bacteria 1085
333 Ga0207648_10019556 3300026089 Bacteria 6112
334 Ga0207676_10033753 3300026095 Bacteria 3869
335 Ga0207674_10000401 3300026116 Bacteria 56126
336 Ga0207674_10072075 3300026116 Bacteria 3471
337 Ga0207674_10158108 3300026116 Bacteria 2221
338 Ga0207675_100133265 3300026118 Bacteria 2356
339 Ga0207698_10271956 3300026142 Bacteria 1562
340 Ga0268266_10417202 3300028379 Bacteria 1271
341 Ga0268265_10181486 3300028380 Bacteria 1809
342 Ga0268265_10415500 3300028380 Bacteria 1247
343 Ga0268264_10018660 3300028381 Bacteria 5670
344 Ga0268264_10095513 3300028381 Bacteria 2572
345 Ga0307509_10336154 3300031507 Bacteria 1240
346 Ga0307516_10056297 3300031730 Bacteria 3834
347 Ga0307405_10169208 3300031731 Bacteria 1557
348 Ga0307414_10024617 3300032004 Bacteria 3842
349 Ga0307414_10817853 3300032004 Bacteria 850
350 Ga0307415_100230242 3300032126 Bacteria 1492
351 Ga0395899_0000215 3300037312 Bacteria 82905
352 Ga0395899_0001471 3300037312 Bacteria 20047
353 Ga0395899_0018330 3300037312 Bacteria 5321
354 Ga0395899_0218581 3300037312 Bacteria 1321
355 Ga0395900_0000117 3300037418 Bacteria 137733
356 Ga0395900_0001714 3300037418 Bacteria 25336
357 Ga0395900_0003030 3300037418 Bacteria 18287
358 Ga0395898_0000120 3300037466 Bacteria 209091
359 Ga0395898_0000411 3300037466 Bacteria 92170
360 Ga0395898_0013222 3300037466 Bacteria 8502
361 Ga0395898_0078346 3300037466 Bacteria 3188
362 Ga0395898_0080786 3300037466 Bacteria 3135
363 Ga0395905_0196425 3300037471 Bacteria 1892
364 Ga0395905_0366372 3300037471 Bacteria 1334
365 Ga0395901_0000413 3300038443 Bacteria 50350
366 Ga0395901_0022980 3300038443 Bacteria 6391
367 Ga0395901_0088231 3300038443 Bacteria 3244
368 Ga0395901_0151868 3300038443 Bacteria 2433
369 Ga0395901_0152233 3300038443 Bacteria 2430
370 Ga0395901_0155772 3300038443 Bacteria 2399
371 Ga0395901_0215481 3300038443 Bacteria 2008
372 Ga0451793_0489457 3300041452 Bacteria 1920
373 Ga0439448_0139168 3300042005 Bacteria 839
374 Ga0439459_0006821 3300042438 Bacteria 1912
375 Ga0466969_0006778 3300044656 Bacteria 6093
376 Ga0466969_0021366 3300044656 Bacteria 3346
377 Ga0466969_0101529 3300044656 Bacteria 1353
378 Ga0466972_0122583 3300044658 Bacteria 1225
379 Ga0466975_0029559 3300044661 Bacteria 3807
380 Ga0466982_0000001 3300044672 Bacteria 514662
381 Ga0466965_0361261 3300044683 Bacteria 797
382 Ga0466966_0002318 3300044684 Bacteria 12404
383 Ga0466966_0012350 3300044684 Bacteria 5659
384 Ga0466966_0225300 3300044684 Bacteria 1131
385 Ga0466966_0225301 3300044684 Bacteria 1131
386 Ga0466961_0000719 3300044693 Bacteria 20839
387 Ga0466961_0005754 3300044693 Bacteria 7846
388 Ga0466961_0007591 3300044693 Bacteria 6907
389 Ga0466961_0014899 3300044693 Bacteria 4994
390 Ga0466961_0019639 3300044693 Bacteria 4347
391 Ga0466964_0020308 3300044706 Bacteria 2558
392 Ga0466971_0032864 3300044719 Bacteria 2324
393 Ga0466971_0101572 3300044719 Bacteria 1322
394 Ga0466968_0004523 3300044735 Bacteria 5201
395 Ga0466970_0011662 3300044765 Bacteria 4484
396 Ga0466970_0013509 3300044765 Bacteria 4187
397 Ga0466957_0001903 3300044842 Bacteria 11068
398 Ga0466957_0013572 3300044842 Bacteria 4728
399 Ga0466957_0068963 3300044842 Bacteria 2184
400 Ga0466959_0016259 3300045049 Bacteria 5433
401 Ga0466959_0071612 3300045049 Bacteria 2510
402 Ga0466959_0144950 3300045049 Bacteria 1676
403 Ga0451576_0608679 3300045051 Bacteria 1148
404 Ga0466958_0038587 3300045836 Bacteria 2866
405 Ga0466958_0042424 3300045836 Bacteria 2739
406 Ga0466967_0107834 3300045976 Bacteria 2555
407 Ga0466967_0123024 3300045976 Bacteria 2400
408 Ga0495638_0000339 3300046460 Bacteria 59031
409 Ga0495638_0001037 3300046460 Bacteria 27481
410 Ga0495638_0011413 3300046460 Bacteria 6122
411 Ga0495650_0000064 3300046471 Bacteria 275412
412 Ga0495606_0000368 3300046507 Bacteria 77266
413 Ga0495622_0007604 3300046557 Bacteria 5031
414 Ga0495625_0022965 3300046660 Bacteria 4772
415 Ga0495625_0207015 3300046660 Bacteria 1291
416 Ga0495649_0037392 3300046694 Bacteria 2664
417 Ga0496100_0043702 3300048903 Bacteria 2867
418 Ga0496101_0037544 3300048904 Bacteria 3437
419 Ga0496104_0076731 3300048907 Bacteria 3183
420 Ga0496105_0001219 3300048908 Bacteria 17945
421 Ga0496107_0065801 3300048910 Bacteria 2628
422 Ga0496113_0022662 3300048916 Bacteria 4446
423 Ga0496113_0187457 3300048916 Bacteria 1641
424 Ga0496114_0104236 3300048917 Bacteria 2425
425 Ga0496115_0000283 3300048918 Bacteria 43828
426 Ga0496115_0001095 3300048918 Bacteria 19601
427 Ga0496115_0004542 3300048918 Bacteria 10043
428 Ga0496115_0178381 3300048918 Bacteria 1756
429 Ga0496116_0087751 3300048919 Bacteria 1903
430 Ga0496117_0026162 3300048920 Bacteria 4570
431 Ga0496117_0082787 3300048920 Bacteria 2100
432 Ga0496118_0000182 3300048921 Bacteria 110967
433 Ga0496118_0002818 3300048921 Bacteria 22746
434 Ga0496118_0005399 3300048921 Bacteria 14542
435 Ga0496118_0071172 3300048921 Bacteria 2505
436 Ga0496119_0000748 3300048922 Bacteria 43680
437 Ga0496119_0009539 3300048922 Bacteria 8311
438 Ga0496120_0000013 3300048923 Bacteria 331109
439 Ga0496120_0001574 3300048923 Bacteria 26674
440 Ga0496121_0000531 3300048924 Bacteria 72444
441 Ga0496121_0024261 3300048924 Bacteria 5809
442 Ga0496121_0035584 3300048924 Bacteria 4459
443 Ga0496121_0088996 3300048924 Bacteria 2418
444 Ga0496121_0114221 3300048924 Bacteria 2053
445 Ga0496125_0000647 3300048928 Bacteria 58140
446 Ga0496126_0001015 3300048929 Bacteria 47751
447 Ga0496126_0016981 3300048929 Bacteria 7261
448 Ga0496126_0042076 3300048929 Bacteria 4222
449 Ga0496126_0122427 3300048929 Bacteria 2254
450 Ga0495678_021921 3300049459 Bacteria 2803
451 Ga0495678_063227 3300049459 Bacteria 1383
452 Ga0501032_0083636 3300049569 Bacteria 2122
453 Ga0501032_0133273 3300049569 Bacteria 1638
454 Ga0501032_0292113 3300049569 Bacteria 1054
455 Ga0501033_0000339 3300049570 Bacteria 44797
456 Ga0501033_0203841 3300049570 Bacteria 1412
457 Ga0501034_0185491 3300049571 Bacteria 2044
458 Ga0501034_0195340 3300049571 Bacteria 1984
459 Ga0501036_0065670 3300049572 Bacteria 3070
460 Ga0501036_0498481 3300049572 Bacteria 1013
461 Ga0501037_0227202 3300049573 Bacteria 1311
462 Ga0501038_0384349 3300049574 Bacteria 1088
463 Ga0501039_0040266 3300049575 Bacteria 3607
464 Ga0501042_0595491 3300049578 Bacteria 804
465 Ga0501043_0049783 3300049579 Bacteria 3294
466 Ga0501043_0094814 3300049579 Bacteria 2345
467 Ga0501043_0135211 3300049579 Bacteria 1931
468 Ga0501043_0189186 3300049579 Bacteria 1601
469 Ga0501043_0425578 3300049579 Bacteria 1000
470 Ga0501046_0040210 3300049580 Bacteria 3738
471 Ga0501046_0527608 3300049580 Bacteria 843
472 Ga0501047_0003952 3300049581 Bacteria 13937
473 Ga0501047_0096823 3300049581 Bacteria 2829
474 Ga0501047_0449414 3300049581 Bacteria 1118
475 Ga0501047_0799683 3300049581 Bacteria 758
476 Ga0501048_0027958 3300049582 Bacteria 4096
477 Ga0501048_0034083 3300049582 Bacteria 3676
478 Ga0501070_0060054 3300049586 Bacteria 3152
479 Ga0501035_0017076 3300049822 Bacteria 6686
480 Ga0501035_0030015 3300049822 Bacteria 4958
481 Ga0501035_0036356 3300049822 Bacteria 4463
482 Ga0501035_0238240 3300049822 Bacteria 1548
483 Ga0501035_0258256 3300049822 Bacteria 1478
484 Ga0501035_0396171 3300049822 Bacteria 1149
485 Ga0501044_0008880 3300049823 Bacteria 10985
486 Ga0501044_0366541 3300049823 Bacteria 1358
487 Ga0501044_0670485 3300049823 Bacteria 924
488 nmdc:mga0qj67_106075_c1 3300050509 Bacteria 2267
489 nmdc:mga08x19_8611_c1 3300050514 Bacteria 6079
490 Ga0501084_0520096 3300054114 Bacteria 1006
491 Ga0466962_0004244 3300061719 Bacteria 6869

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0071612 Ga0466959_0071612_53_736 227
2 3300037418 Ga0395900_0000117 Ga0395900_0000117_51574_52386 228
3 3300038443 Ga0395901_0151868 Ga0395901_0151868_937_1749 228
4 3300002067 JGI24735J21928_10007207 JGI24735J21928_100072072 230
5 3300003316 rootH1_10128341 rootH1_101283411 230
6 3300049581 Ga0501047_0799683 Ga0501047_0799683_26_745 232
7 3300049579 Ga0501043_0425578 Ga0501043_0425578_35_781 234
8 3300049822 Ga0501035_0030015 Ga0501035_0030015_1277_2023 234
9 3300049823 Ga0501044_0008880 Ga0501044_0008880_5497_6243 234
10 3300003320 rootH2_10000507 rootH2_100005078 235
11 3300003323 rootH1_10247911 rootH1_102479112 236
12 3300025261 Ga0209233_1019881 Ga0209233_10198812 237
13 3300009093 Ga0105240_10001890 Ga0105240_1000189012 238
14 3300009545 Ga0105237_10137205 Ga0105237_101372052 238
15 3300009551 Ga0105238_10000775 Ga0105238_1000077529 238
16 3300010375 Ga0105239_10427371 Ga0105239_104273712 238
17 3300013307 Ga0157372_10309981 Ga0157372_103099811 238
18 3300048921 Ga0496118_0071172 Ga0496118_0071172_565_1281 238
19 3300037312 Ga0395899_0218581 Ga0395899_0218581_364_1110 240
20 3300038443 Ga0395901_0215481 Ga0395901_0215481_732_1478 240
21 3300002705 JGI25156J39149_1001002 JGI25156J39149_10010023 242
22 3300002737 JGI25162J39368_1001519 JGI25162J39368_10015198 242
23 3300002741 JGI25157J39369_1000989 JGI25157J39369_10009893 242
24 3300002772 JGI25164J39214_1000004 JGI25164J39214_1000004162 242
25 3300003214 JGI25165J46597_1000271 JGI25165J46597_100027140 242
26 3300003761 Ga0055535_1000726 Ga0055535_100072611 242
27 3300003762 Ga0055542_1000438 Ga0055542_10004388 242
28 3300003763 Ga0055529_1000092 Ga0055529_100009219 242
29 3300006844 Ga0075428_100083984 Ga0075428_1000839844 242
30 3300025228 Ga0209672_100070 Ga0209672_100070143 242
31 3300025231 Ga0207427_100031 Ga0207427_100031143 242
32 3300025233 Ga0209437_100061 Ga0209437_100061162 242
33 3300025242 Ga0209258_100097 Ga0209258_100097161 242
34 3300025246 Ga0209646_1006130 Ga0209646_10061302 242
35 3300025250 Ga0209026_1000661 Ga0209026_100066118 242
36 3300025254 Ga0209148_1000063 Ga0209148_1000063161 242
37 3300025256 Ga0209759_1000361 Ga0209759_100036125 242
38 3300025261 Ga0209233_1000076 Ga0209233_1000076143 242
39 3300025272 Ga0209455_1000096 Ga0209455_1000096161 242
40 3300031730 Ga0307516_10056297 Ga0307516_100562975 244
41 3300049571 Ga0501034_0195340 Ga0501034_0195340_1007_1744 244
42 iso_pu_bacteria 2643221577 2643896651 244
43 iso_pu_bacteria 2643221685 2644478599 244
44 iso_pu_bacteria 2687453130 2687584658 244
45 iso_pu_bacteria 2739367700 2739733389 244
46 iso_pu_bacteria 2884411467 2884412697 244
47 iso_pu_bacteria 2895395659 2895398189 244
48 iso_pu_bacteria 2928963466 2928965492 244
49 iso_pu_bacteria 2939611941 2939613902 244
50 3300032004 Ga0307414_10024617 Ga0307414_100246173 245
51 3300032004 Ga0307414_10817853 Ga0307414_108178531 245
52 3300006195 Ga0075366_10257400 Ga0075366_102574002 246
53 3300006914 Ga0075436_100000939 Ga0075436_1000009396 246
54 3300009147 Ga0114129_10014152 Ga0114129_100141528 246
55 3300031731 Ga0307405_10169208 Ga0307405_101692082 246
56 3300032126 Ga0307415_100230242 Ga0307415_1002302422 246
57 3300045051 Ga0451576_0608679 Ga0451576_0608679_330_1076 246
58 3300050514 nmdc:mga08x19_8611_c1 nmdc:mga08x19_8611_c1_1467_2213 246
59 3300005455 Ga0070663_100068897 Ga0070663_1000688971 247
60 3300005466 Ga0070685_10001702 Ga0070685_100017025 247
61 3300005616 Ga0068852_100492115 Ga0068852_1004921152 247
62 3300006846 Ga0075430_100018223 Ga0075430_1000182232 247
63 3300009982 Ga0105147_102258 Ga0105147_1022582 247
64 3300013307 Ga0157372_10259459 Ga0157372_102594592 247
65 3300025903 Ga0207680_10279727 Ga0207680_102797272 247
66 3300025913 Ga0207695_10000219 Ga0207695_1000021953 247
67 3300025914 Ga0207671_10018454 Ga0207671_100184544 247
68 3300025924 Ga0207694_10002806 Ga0207694_1000280611 247
69 3300026067 Ga0207678_10030661 Ga0207678_100306613 247
70 3300044656 Ga0466969_0006778 Ga0466969_0006778_4915_5658 247
71 3300044684 Ga0466966_0002318 Ga0466966_0002318_5916_6659 247
72 3300044693 Ga0466961_0007591 Ga0466961_0007591_5585_6328 247
73 3300044693 Ga0466961_0014899 Ga0466961_0014899_402_1145 247
74 3300044719 Ga0466971_0032864 Ga0466971_0032864_294_1037 247
75 3300044765 Ga0466970_0011662 Ga0466970_0011662_2618_3361 247
76 3300044842 Ga0466957_0013572 Ga0466957_0013572_1966_2709 247
77 3300045049 Ga0466959_0144950 Ga0466959_0144950_306_1049 247
78 3300049569 Ga0501032_0133273 Ga0501032_0133273_103_846 247
79 3300049570 Ga0501033_0203841 Ga0501033_0203841_157_900 247
80 3300049571 Ga0501034_0185491 Ga0501034_0185491_491_1234 247
81 3300049572 Ga0501036_0065670 Ga0501036_0065670_1855_2598 247
82 3300049573 Ga0501037_0227202 Ga0501037_0227202_314_1057 247
83 3300049578 Ga0501042_0595491 Ga0501042_0595491_37_780 247
84 3300049579 Ga0501043_0049783 Ga0501043_0049783_188_931 247
85 3300049581 Ga0501047_0003952 Ga0501047_0003952_4180_4923 247
86 3300049586 Ga0501070_0060054 Ga0501070_0060054_1778_2521 247
87 3300049822 Ga0501035_0036356 Ga0501035_0036356_932_1675 247
88 3300049823 Ga0501044_0670485 Ga0501044_0670485_86_829 247
89 3300050509 nmdc:mga0qj67_106075_c1 nmdc:mga0qj67_106075_c1_1460_2209 247
90 3300001989 JGI24739J22299_10032961 JGI24739J22299_100329612 248
91 3300001990 JGI24737J22298_10002961 JGI24737J22298_100029612 248
92 3300002705 JGI25156J39149_1018491 JGI25156J39149_10184912 248
93 3300002737 JGI25162J39368_1000168 JGI25162J39368_100016845 248
94 3300002737 JGI25162J39368_1000538 JGI25162J39368_100053811 248
95 3300002737 JGI25162J39368_1000924 JGI25162J39368_10009245 248
96 3300002737 JGI25162J39368_1001920 JGI25162J39368_10019207 248
97 3300002741 JGI25157J39369_1000196 JGI25157J39369_100019643 248
98 3300002741 JGI25157J39369_1001449 JGI25157J39369_10014496 248
99 3300002741 JGI25157J39369_1001486 JGI25157J39369_10014868 248
100 3300002771 JGI25163J39215_1000537 JGI25163J39215_10005377 248
101 3300002772 JGI25164J39214_1000132 JGI25164J39214_100013243 248
102 3300002772 JGI25164J39214_1000265 JGI25164J39214_100026518 248
103 3300002772 JGI25164J39214_1000665 JGI25164J39214_10006655 248
104 3300003214 JGI25165J46597_1000242 JGI25165J46597_100024245 248
105 3300003214 JGI25165J46597_1000828 JGI25165J46597_100082818 248
106 3300003214 JGI25165J46597_1002100 JGI25165J46597_10021007 248
107 3300003215 JGI25153J46596_10012497 JGI25153J46596_100124973 248
108 3300003320 rootH2_10086143 rootH2_100861432 248
109 3300003320 rootH2_10142418 rootH2_101424181 248
110 3300003322 rootL2_10137420 rootL2_101374203 248
111 3300003578 Ga0006562J51391_1074911 Ga0006562J51391_10749113 248
112 3300003578 Ga0006562J51391_1074912 Ga0006562J51391_107491211 248
113 3300003751 Ga0055538_1004343 Ga0055538_10043432 248
114 3300003752 Ga0055539_1002899 Ga0055539_10028993 248
115 3300003752 Ga0055539_1010088 Ga0055539_10100882 248
116 3300003756 Ga0055533_1001034 Ga0055533_10010346 248
117 3300003756 Ga0055533_1002026 Ga0055533_10020267 248
118 3300003756 Ga0055533_1011226 Ga0055533_10112261 248
119 3300003759 Ga0055525_1000152 Ga0055525_100015257 248
120 3300003760 Ga0055527_1000059 Ga0055527_100005956 248
121 3300003760 Ga0055527_1000452 Ga0055527_10004521 248
122 3300003761 Ga0055535_1000207 Ga0055535_100020718 248
123 3300003761 Ga0055535_1000232 Ga0055535_100023219 248
124 3300003761 Ga0055535_1000511 Ga0055535_100051118 248
125 3300003761 Ga0055535_1001120 Ga0055535_10011209 248
126 3300003761 Ga0055535_1001270 Ga0055535_10012705 248
127 3300003761 Ga0055535_1012508 Ga0055535_10125082 248
128 3300003762 Ga0055542_1000137 Ga0055542_100013756 248
129 3300003762 Ga0055542_1000207 Ga0055542_100020745 248
130 3300003762 Ga0055542_1000239 Ga0055542_100023931 248
131 3300003762 Ga0055542_1000417 Ga0055542_100041719 248
132 3300003762 Ga0055542_1001106 Ga0055542_10011061 248
133 3300003763 Ga0055529_1000225 Ga0055529_100022520 248
134 3300003763 Ga0055529_1000909 Ga0055529_10009091 248
135 3300003763 Ga0055529_1001010 Ga0055529_10010102 248
136 3300003763 Ga0055529_1014227 Ga0055529_10142271 248
137 3300005262 Ga0065165_1001811 Ga0065165_100181116 248
138 3300005334 Ga0068869_100007763 Ga0068869_1000077634 248
139 3300005336 Ga0070680_100326419 Ga0070680_1003264192 248
140 3300005337 Ga0070682_100005615 Ga0070682_1000056153 248
141 3300005337 Ga0070682_100042169 Ga0070682_1000421692 248
142 3300005337 Ga0070682_100068361 Ga0070682_1000683612 248
143 3300005338 Ga0068868_100108528 Ga0068868_1001085282 248
144 3300005339 Ga0070660_100077922 Ga0070660_1000779221 248
145 3300005339 Ga0070660_100177521 Ga0070660_1001775212 248
146 3300005340 Ga0070689_100011511 Ga0070689_1000115115 248
147 3300005344 Ga0070661_100070421 Ga0070661_1000704212 248
148 3300005344 Ga0070661_100259887 Ga0070661_1002598871 248
149 3300005344 Ga0070661_100265384 Ga0070661_1002653842 248
150 3300005345 Ga0070692_10020881 Ga0070692_100208814 248
151 3300005347 Ga0070668_100013123 Ga0070668_1000131235 248
152 3300005354 Ga0070675_100019450 Ga0070675_1000194506 248
153 3300005364 Ga0070673_100107236 Ga0070673_1001072362 248
154 3300005365 Ga0070688_100014451 Ga0070688_1000144511 248
155 3300005365 Ga0070688_100116090 Ga0070688_1001160902 248
156 3300005366 Ga0070659_100009262 Ga0070659_1000092626 248
157 3300005366 Ga0070659_100014534 Ga0070659_1000145346 248
158 3300005366 Ga0070659_100071500 Ga0070659_1000715002 248
159 3300005367 Ga0070667_100032514 Ga0070667_1000325145 248
160 3300005367 Ga0070667_100278592 Ga0070667_1002785921 248
161 3300005435 Ga0070714_100030666 Ga0070714_1000306663 248
162 3300005436 Ga0070713_100003472 Ga0070713_1000034723 248
163 3300005444 Ga0070694_100115566 Ga0070694_1001155662 248
164 3300005455 Ga0070663_100044233 Ga0070663_1000442332 248
165 3300005455 Ga0070663_100107391 Ga0070663_1001073912 248
166 3300005455 Ga0070663_100219202 Ga0070663_1002192022 248
167 3300005456 Ga0070678_100008384 Ga0070678_1000083848 248
168 3300005457 Ga0070662_100054768 Ga0070662_1000547682 248
169 3300005458 Ga0070681_10003497 Ga0070681_1000349710 248
170 3300005458 Ga0070681_10116968 Ga0070681_101169683 248
171 3300005458 Ga0070681_10917353 Ga0070681_109173531 248
172 3300005459 Ga0068867_100010992 Ga0068867_1000109924 248
173 3300005466 Ga0070685_10009310 Ga0070685_100093107 248
174 3300005530 Ga0070679_100071824 Ga0070679_1000718242 248
175 3300005539 Ga0068853_100019439 Ga0068853_1000194392 248
176 3300005539 Ga0068853_100255467 Ga0068853_1002554672 248
177 3300005543 Ga0070672_100018395 Ga0070672_1000183954 248
178 3300005546 Ga0070696_100009794 Ga0070696_1000097943 248
179 3300005546 Ga0070696_100060683 Ga0070696_1000606832 248
180 3300005546 Ga0070696_100318545 Ga0070696_1003185451 248
181 3300005547 Ga0070693_100009002 Ga0070693_1000090023 248
182 3300005548 Ga0070665_100279080 Ga0070665_1002790802 248
183 3300005563 Ga0068855_100003107 Ga0068855_10000310711 248
184 3300005563 Ga0068855_100027990 Ga0068855_1000279905 248
185 3300005563 Ga0068855_100061053 Ga0068855_1000610536 248
186 3300005577 Ga0068857_100000582 Ga0068857_10000058212 248
187 3300005577 Ga0068857_100072494 Ga0068857_1000724943 248
188 3300005577 Ga0068857_100077446 Ga0068857_1000774461 248
189 3300005577 Ga0068857_100080611 Ga0068857_1000806112 248
190 3300005577 Ga0068857_100154037 Ga0068857_1001540373 248
191 3300005577 Ga0068857_100308452 Ga0068857_1003084522 248
192 3300005578 Ga0068854_100000823 Ga0068854_1000008235 248
193 3300005578 Ga0068854_100015025 Ga0068854_1000150255 248
194 3300005578 Ga0068854_100060365 Ga0068854_1000603652 248
195 3300005614 Ga0068856_100001041 Ga0068856_10000104112 248
196 3300005614 Ga0068856_100004908 Ga0068856_1000049087 248
197 3300005614 Ga0068856_100045402 Ga0068856_1000454023 248
198 3300005614 Ga0068856_100767128 Ga0068856_1007671282 248
199 3300005616 Ga0068852_100733441 Ga0068852_1007334411 248
200 3300005617 Ga0068859_100056245 Ga0068859_1000562456 248
201 3300005719 Ga0068861_100037616 Ga0068861_1000376164 248
202 3300005840 Ga0068870_10058983 Ga0068870_100589832 248
203 3300005841 Ga0068863_100385756 Ga0068863_1003857562 248
204 3300005842 Ga0068858_100577313 Ga0068858_1005773131 248
205 3300005843 Ga0068860_100011841 Ga0068860_1000118414 248
206 3300005843 Ga0068860_100125921 Ga0068860_1001259212 248
207 3300006237 Ga0097621_100037576 Ga0097621_1000375766 248
208 3300006358 Ga0068871_100260384 Ga0068871_1002603842 248
209 3300006881 Ga0068865_100041015 Ga0068865_1000410152 248
210 3300006931 Ga0097620_100056245 Ga0097620_1000562452 248
211 3300009093 Ga0105240_10003120 Ga0105240_100031207 248
212 3300009093 Ga0105240_10004144 Ga0105240_100041446 248
213 3300009093 Ga0105240_10021623 Ga0105240_100216236 248
214 3300009093 Ga0105240_10082857 Ga0105240_100828575 248
215 3300009093 Ga0105240_10268428 Ga0105240_102684282 248
216 3300009098 Ga0105245_10162716 Ga0105245_101627162 248
217 3300009098 Ga0105245_10326348 Ga0105245_103263482 248
218 3300009545 Ga0105237_10000036 Ga0105237_1000003632 248
219 3300009551 Ga0105238_10017198 Ga0105238_100171988 248
220 3300009551 Ga0105238_10021100 Ga0105238_100211005 248
221 3300009551 Ga0105238_10026616 Ga0105238_100266163 248
222 3300009551 Ga0105238_10058108 Ga0105238_100581082 248
223 3300009551 Ga0105238_10209813 Ga0105238_102098132 248
224 3300009551 Ga0105238_10566677 Ga0105238_105666772 248
225 3300009553 Ga0105249_10078210 Ga0105249_100782103 248
226 3300010375 Ga0105239_10000480 Ga0105239_1000048021 248
227 3300010375 Ga0105239_10018925 Ga0105239_100189252 248
228 3300010375 Ga0105239_10163076 Ga0105239_101630762 248
229 3300010375 Ga0105239_10224846 Ga0105239_102248462 248
230 3300011119 Ga0105246_10012639 Ga0105246_100126393 248
231 3300012500 Ga0157314_1000030 Ga0157314_100003011 248
232 3300013100 Ga0157373_10023309 Ga0157373_100233095 248
233 3300013100 Ga0157373_10034475 Ga0157373_100344754 248
234 3300013100 Ga0157373_10050254 Ga0157373_100502542 248
235 3300013102 Ga0157371_10008217 Ga0157371_100082173 248
236 3300013102 Ga0157371_10365529 Ga0157371_103655291 248
237 3300013104 Ga0157370_10002180 Ga0157370_1000218016 248
238 3300013104 Ga0157370_10093126 Ga0157370_100931263 248
239 3300013104 Ga0157370_10104839 Ga0157370_101048392 248
240 3300013105 Ga0157369_10004089 Ga0157369_100040896 248
241 3300013105 Ga0157369_10162008 Ga0157369_101620082 248
242 3300013105 Ga0157369_10166672 Ga0157369_101666723 248
243 3300013297 Ga0157378_10000215 Ga0157378_1000021521 248
244 3300013306 Ga0163162_10178019 Ga0163162_101780191 248
245 3300013306 Ga0163162_10506712 Ga0163162_105067122 248
246 3300013307 Ga0157372_10027601 Ga0157372_100276016 248
247 3300014497 Ga0182008_10036947 Ga0182008_100369473 248
248 3300014497 Ga0182008_10080605 Ga0182008_100806052 248
249 3300014968 Ga0157379_10004627 Ga0157379_100046273 248
250 3300015262 Ga0182007_10003520 Ga0182007_100035204 248
251 3300015262 Ga0182007_10033807 Ga0182007_100338072 248
252 3300015685 Ga0183369_1004 Ga0183369_1004250 248
253 3300015687 Ga0183368_1002 Ga0183368_10021064 248
254 3300016635 Ga0183361_12171 Ga0183361_121711 248
255 3300020070 Ga0206356_10173653 Ga0206356_101736532 248
256 3300020082 Ga0206353_11202800 Ga0206353_112028003 248
257 3300025206 Ga0209435_103044 Ga0209435_1030442 248
258 3300025206 Ga0209435_103569 Ga0209435_1035692 248
259 3300025207 Ga0209760_100687 Ga0209760_1006873 248
260 3300025224 Ga0209784_100131 Ga0209784_10013119 248
261 3300025226 Ga0209674_100014 Ga0209674_100014395 248
262 3300025226 Ga0209674_100058 Ga0209674_100058158 248
263 3300025226 Ga0209674_100657 Ga0209674_1006578 248
264 3300025226 Ga0209674_101021 Ga0209674_1010215 248
265 3300025228 Ga0209672_100043 Ga0209672_10004377 248
266 3300025228 Ga0209672_100061 Ga0209672_100061158 248
267 3300025228 Ga0209672_100250 Ga0209672_10025019 248
268 3300025228 Ga0209672_101112 Ga0209672_1011123 248
269 3300025228 Ga0209672_104065 Ga0209672_1040652 248
270 3300025230 Ga0209563_100062 Ga0209563_10006268 248
271 3300025231 Ga0207427_100161 Ga0207427_10016119 248
272 3300025231 Ga0207427_100194 Ga0207427_10019414 248
273 3300025231 Ga0207427_100226 Ga0207427_10022621 248
274 3300025233 Ga0209437_100116 Ga0209437_100116173 248
275 3300025233 Ga0209437_100121 Ga0209437_100121153 248
276 3300025233 Ga0209437_100257 Ga0209437_10025746 248
277 3300025233 Ga0209437_100464 Ga0209437_10046420 248
278 3300025242 Ga0209258_100054 Ga0209258_100054158 248
279 3300025242 Ga0209258_100076 Ga0209258_10007677 248
280 3300025242 Ga0209258_100092 Ga0209258_10009252 248
281 3300025242 Ga0209258_100104 Ga0209258_10010431 248
282 3300025242 Ga0209258_100715 Ga0209258_10071510 248
283 3300025246 Ga0209646_1000254 Ga0209646_100025418 248
284 3300025246 Ga0209646_1012888 Ga0209646_10128882 248
285 3300025250 Ga0209026_1000143 Ga0209026_1000143105 248
286 3300025250 Ga0209026_1000230 Ga0209026_100023020 248
287 3300025250 Ga0209026_1000277 Ga0209026_100027728 248
288 3300025250 Ga0209026_1003690 Ga0209026_10036903 248
289 3300025253 Ga0209677_103617 Ga0209677_1036174 248
290 3300025253 Ga0209677_106391 Ga0209677_1063914 248
291 3300025254 Ga0209148_1000002 Ga0209148_1000002579 248
292 3300025254 Ga0209148_1000047 Ga0209148_1000047249 248
293 3300025254 Ga0209148_1000066 Ga0209148_1000066158 248
294 3300025254 Ga0209148_1000082 Ga0209148_100008277 248
295 3300025254 Ga0209148_1000106 Ga0209148_100010632 248
296 3300025256 Ga0209759_1000308 Ga0209759_100030850 248
297 3300025256 Ga0209759_1001242 Ga0209759_10012426 248
298 3300025256 Ga0209759_1009720 Ga0209759_10097204 248
299 3300025256 Ga0209759_1015953 Ga0209759_10159533 248
300 3300025258 Ga0209129_1005400 Ga0209129_10054002 248
301 3300025261 Ga0209233_1000100 Ga0209233_100010021 248
302 3300025261 Ga0209233_1000112 Ga0209233_1000112157 248
303 3300025261 Ga0209233_1000114 Ga0209233_100011411 248
304 3300025261 Ga0209233_1001902 Ga0209233_10019024 248
305 3300025261 Ga0209233_1018495 Ga0209233_10184952 248
306 3300025272 Ga0209455_1000056 Ga0209455_1000056173 248
307 3300025272 Ga0209455_1000078 Ga0209455_100007877 248
308 3300025272 Ga0209455_1000101 Ga0209455_1000101158 248
309 3300025272 Ga0209455_1000789 Ga0209455_10007896 248
310 3300025272 Ga0209455_1005056 Ga0209455_10050565 248
311 3300025297 Ga0209758_1000491 Ga0209758_100049141 248
312 3300025904 Ga0207647_10001129 Ga0207647_100011299 248
313 3300025904 Ga0207647_10011422 Ga0207647_100114222 248
314 3300025907 Ga0207645_10230947 Ga0207645_102309471 248
315 3300025908 Ga0207643_10066663 Ga0207643_100666632 248
316 3300025911 Ga0207654_10373621 Ga0207654_103736211 248
317 3300025912 Ga0207707_10019591 Ga0207707_100195915 248
318 3300025912 Ga0207707_10022271 Ga0207707_100222713 248
319 3300025913 Ga0207695_10001444 Ga0207695_100014445 248
320 3300025913 Ga0207695_10001553 Ga0207695_1000155321 248
321 3300025913 Ga0207695_10002198 Ga0207695_1000219814 248
322 3300025913 Ga0207695_10002664 Ga0207695_100026646 248
323 3300025913 Ga0207695_10010679 Ga0207695_100106795 248
324 3300025914 Ga0207671_10000009 Ga0207671_10000009585 248
325 3300025914 Ga0207671_10000135 Ga0207671_1000013523 248
326 3300025914 Ga0207671_10054425 Ga0207671_100544254 248
327 3300025917 Ga0207660_10218865 Ga0207660_102188652 248
328 3300025919 Ga0207657_10104289 Ga0207657_101042892 248
329 3300025919 Ga0207657_10582194 Ga0207657_105821941 248
330 3300025920 Ga0207649_10101837 Ga0207649_101018372 248
331 3300025920 Ga0207649_10430847 Ga0207649_104308472 248
332 3300025921 Ga0207652_10052676 Ga0207652_100526762 248
333 3300025923 Ga0207681_10015700 Ga0207681_100157002 248
334 3300025924 Ga0207694_10024283 Ga0207694_100242833 248
335 3300025924 Ga0207694_10045581 Ga0207694_100455812 248
336 3300025924 Ga0207694_10090581 Ga0207694_100905812 248
337 3300025924 Ga0207694_10091757 Ga0207694_100917572 248
338 3300025926 Ga0207659_10009867 Ga0207659_100098674 248
339 3300025927 Ga0207687_10102928 Ga0207687_101029282 248
340 3300025928 Ga0207700_10001377 Ga0207700_100013779 248
341 3300025929 Ga0207664_10009261 Ga0207664_100092613 248
342 3300025932 Ga0207690_10014652 Ga0207690_100146522 248
343 3300025932 Ga0207690_10017061 Ga0207690_100170613 248
344 3300025932 Ga0207690_10040916 Ga0207690_100409162 248
345 3300025932 Ga0207690_10482901 Ga0207690_104829011 248
346 3300025932 Ga0207690_10540643 Ga0207690_105406432 248
347 3300025933 Ga0207706_10014779 Ga0207706_100147792 248
348 3300025936 Ga0207670_10005876 Ga0207670_100058762 248
349 3300025938 Ga0207704_10023577 Ga0207704_100235772 248
350 3300025940 Ga0207691_10017492 Ga0207691_100174926 248
351 3300025942 Ga0207689_10017888 Ga0207689_100178886 248
352 3300025949 Ga0207667_10000193 Ga0207667_1000019332 248
353 3300025949 Ga0207667_10000244 Ga0207667_1000024438 248
354 3300025949 Ga0207667_10067422 Ga0207667_100674223 248
355 3300025949 Ga0207667_10098492 Ga0207667_100984924 248
356 3300025960 Ga0207651_10253855 Ga0207651_102538552 248
357 3300025961 Ga0207712_10046150 Ga0207712_100461503 248
358 3300025972 Ga0207668_10021092 Ga0207668_100210924 248
359 3300025981 Ga0207640_10000169 Ga0207640_1000016936 248
360 3300025981 Ga0207640_10000189 Ga0207640_1000018934 248
361 3300025981 Ga0207640_10047902 Ga0207640_100479022 248
362 3300025981 Ga0207640_10078339 Ga0207640_100783393 248
363 3300025986 Ga0207658_10216591 Ga0207658_102165912 248
364 3300025986 Ga0207658_10258818 Ga0207658_102588182 248
365 3300025986 Ga0207658_10505003 Ga0207658_105050032 248
366 3300026023 Ga0207677_10052268 Ga0207677_100522682 248
367 3300026035 Ga0207703_10406250 Ga0207703_104062502 248
368 3300026041 Ga0207639_10032144 Ga0207639_100321444 248
369 3300026041 Ga0207639_10275805 Ga0207639_102758052 248
370 3300026067 Ga0207678_10025885 Ga0207678_100258856 248
371 3300026067 Ga0207678_10158690 Ga0207678_101586902 248
372 3300026067 Ga0207678_10227963 Ga0207678_102279632 248
373 3300026078 Ga0207702_10000037 Ga0207702_1000003721 248
374 3300026078 Ga0207702_10000230 Ga0207702_1000023024 248
375 3300026078 Ga0207702_10011445 Ga0207702_100114453 248
376 3300026078 Ga0207702_10331537 Ga0207702_103315372 248
377 3300026088 Ga0207641_10591455 Ga0207641_105914551 248
378 3300026089 Ga0207648_10019556 Ga0207648_100195564 248
379 3300026095 Ga0207676_10033753 Ga0207676_100337532 248
380 3300026116 Ga0207674_10000401 Ga0207674_1000040118 248
381 3300026116 Ga0207674_10072075 Ga0207674_100720753 248
382 3300026116 Ga0207674_10158108 Ga0207674_101581082 248
383 3300026118 Ga0207675_100133265 Ga0207675_1001332652 248
384 3300026142 Ga0207698_10271956 Ga0207698_102719561 248
385 3300028379 Ga0268266_10417202 Ga0268266_104172022 248
386 3300028380 Ga0268265_10181486 Ga0268265_101814862 248
387 3300028380 Ga0268265_10415500 Ga0268265_104155001 248
388 3300028381 Ga0268264_10018660 Ga0268264_100186602 248
389 3300028381 Ga0268264_10095513 Ga0268264_100955133 248
390 3300031507 Ga0307509_10336154 Ga0307509_103361542 248
391 3300037312 Ga0395899_0000215 Ga0395899_0000215_60844_61656 248
392 3300037312 Ga0395899_0001471 Ga0395899_0001471_12108_12857 248
393 3300037312 Ga0395899_0018330 Ga0395899_0018330_3425_4171 248
394 3300037418 Ga0395900_0001714 Ga0395900_0001714_15080_15826 248
395 3300037418 Ga0395900_0003030 Ga0395900_0003030_12485_13231 248
396 3300037466 Ga0395898_0000120 Ga0395898_0000120_21248_22060 248
397 3300037466 Ga0395898_0000411 Ga0395898_0000411_65325_66074 248
398 3300037466 Ga0395898_0013222 Ga0395898_0013222_236_982 248
399 3300037466 Ga0395898_0078346 Ga0395898_0078346_1060_1806 248
400 3300037466 Ga0395898_0080786 Ga0395898_0080786_43_789 248
401 3300037471 Ga0395905_0196425 Ga0395905_0196425_713_1459 248
402 3300037471 Ga0395905_0366372 Ga0395905_0366372_437_1183 248
403 3300038443 Ga0395901_0000413 Ga0395901_0000413_41801_42547 248
404 3300038443 Ga0395901_0022980 Ga0395901_0022980_822_1568 248
405 3300038443 Ga0395901_0088231 Ga0395901_0088231_1361_2107 248
406 3300038443 Ga0395901_0152233 Ga0395901_0152233_574_1320 248
407 3300038443 Ga0395901_0155772 Ga0395901_0155772_182_928 248
408 3300041452 Ga0451793_0489457 Ga0451793_0489457_897_1643 248
409 3300042005 Ga0439448_0139168 Ga0439448_0139168_75_821 248
410 3300042438 Ga0439459_0006821 Ga0439459_0006821_530_1276 248
411 3300044656 Ga0466969_0021366 Ga0466969_0021366_505_1251 248
412 3300044656 Ga0466969_0101529 Ga0466969_0101529_103_864 248
413 3300044658 Ga0466972_0122583 Ga0466972_0122583_328_1074 248
414 3300044661 Ga0466975_0029559 Ga0466975_0029559_2124_2870 248
415 3300044672 Ga0466982_0000001 Ga0466982_0000001_241996_242742 248
416 3300044683 Ga0466965_0361261 Ga0466965_0361261_39_785 248
417 3300044684 Ga0466966_0012350 Ga0466966_0012350_3960_4706 248
418 3300044684 Ga0466966_0225300 Ga0466966_0225300_356_1102 248
419 3300044684 Ga0466966_0225301 Ga0466966_0225301_356_1102 248
420 3300044693 Ga0466961_0000719 Ga0466961_0000719_8817_9578 248
421 3300044693 Ga0466961_0005754 Ga0466961_0005754_282_1031 248
422 3300044693 Ga0466961_0019639 Ga0466961_0019639_2969_3715 248
423 3300044706 Ga0466964_0020308 Ga0466964_0020308_65_811 248
424 3300044719 Ga0466971_0101572 Ga0466971_0101572_396_1142 248
425 3300044735 Ga0466968_0004523 Ga0466968_0004523_1207_1953 248
426 3300044765 Ga0466970_0013509 Ga0466970_0013509_1618_2379 248
427 3300044842 Ga0466957_0001903 Ga0466957_0001903_2360_3121 248
428 3300044842 Ga0466957_0068963 Ga0466957_0068963_1035_1781 248
429 3300045049 Ga0466959_0016259 Ga0466959_0016259_4072_4833 248
430 3300045836 Ga0466958_0038587 Ga0466958_0038587_904_1653 248
431 3300045836 Ga0466958_0042424 Ga0466958_0042424_1190_1936 248
432 3300045976 Ga0466967_0107834 Ga0466967_0107834_1007_1753 248
433 3300045976 Ga0466967_0123024 Ga0466967_0123024_756_1505 248
434 3300046460 Ga0495638_0000339 Ga0495638_0000339_17533_18279 248
435 3300046460 Ga0495638_0001037 Ga0495638_0001037_25926_26702 248
436 3300046460 Ga0495638_0011413 Ga0495638_0011413_1679_2425 248
437 3300046471 Ga0495650_0000064 Ga0495650_0000064_258248_258994 248
438 3300046507 Ga0495606_0000368 Ga0495606_0000368_61119_61865 248
439 3300046557 Ga0495622_0007604 Ga0495622_0007604_2167_2913 248
440 3300046660 Ga0495625_0022965 Ga0495625_0022965_1091_1837 248
441 3300046660 Ga0495625_0207015 Ga0495625_0207015_177_923 248
442 3300046694 Ga0495649_0037392 Ga0495649_0037392_631_1377 248
443 3300048903 Ga0496100_0043702 Ga0496100_0043702_1946_2692 248
444 3300048904 Ga0496101_0037544 Ga0496101_0037544_308_1054 248
445 3300048907 Ga0496104_0076731 Ga0496104_0076731_1952_2698 248
446 3300048908 Ga0496105_0001219 Ga0496105_0001219_4697_5443 248
447 3300048910 Ga0496107_0065801 Ga0496107_0065801_269_1015 248
448 3300048916 Ga0496113_0022662 Ga0496113_0022662_3231_3977 248
449 3300048916 Ga0496113_0187457 Ga0496113_0187457_405_1151 248
450 3300048917 Ga0496114_0104236 Ga0496114_0104236_914_1660 248
451 3300048918 Ga0496115_0000283 Ga0496115_0000283_13236_13982 248
452 3300048918 Ga0496115_0001095 Ga0496115_0001095_15360_16106 248
453 3300048918 Ga0496115_0004542 Ga0496115_0004542_7563_8309 248
454 3300048918 Ga0496115_0178381 Ga0496115_0178381_433_1179 248
455 3300048919 Ga0496116_0087751 Ga0496116_0087751_137_883 248
456 3300048920 Ga0496117_0026162 Ga0496117_0026162_2651_3397 248
457 3300048920 Ga0496117_0082787 Ga0496117_0082787_1182_1928 248
458 3300048921 Ga0496118_0000182 Ga0496118_0000182_34143_34889 248
459 3300048921 Ga0496118_0002818 Ga0496118_0002818_3545_4291 248
460 3300048921 Ga0496118_0005399 Ga0496118_0005399_10186_10932 248
461 3300048922 Ga0496119_0000748 Ga0496119_0000748_30208_30954 248
462 3300048922 Ga0496119_0009539 Ga0496119_0009539_4488_5234 248
463 3300048923 Ga0496120_0000013 Ga0496120_0000013_12547_13293 248
464 3300048923 Ga0496120_0001574 Ga0496120_0001574_4523_5269 248
465 3300048924 Ga0496121_0000531 Ga0496121_0000531_49350_50096 248
466 3300048924 Ga0496121_0024261 Ga0496121_0024261_205_951 248
467 3300048924 Ga0496121_0035584 Ga0496121_0035584_2264_3010 248
468 3300048924 Ga0496121_0088996 Ga0496121_0088996_884_1630 248
469 3300048924 Ga0496121_0114221 Ga0496121_0114221_1193_1939 248
470 3300048928 Ga0496125_0000647 Ga0496125_0000647_50376_51122 248
471 3300048929 Ga0496126_0001015 Ga0496126_0001015_18464_19210 248
472 3300048929 Ga0496126_0016981 Ga0496126_0016981_3058_3804 248
473 3300048929 Ga0496126_0042076 Ga0496126_0042076_918_1664 248
474 3300048929 Ga0496126_0122427 Ga0496126_0122427_483_1229 248
475 3300049459 Ga0495678_021921 Ga0495678_021921_1234_1980 248
476 3300049459 Ga0495678_063227 Ga0495678_063227_494_1240 248
477 3300049569 Ga0501032_0083636 Ga0501032_0083636_65_811 248
478 3300049569 Ga0501032_0292113 Ga0501032_0292113_28_774 248
479 3300049570 Ga0501033_0000339 Ga0501033_0000339_172_918 248
480 3300049572 Ga0501036_0498481 Ga0501036_0498481_139_885 248
481 3300049574 Ga0501038_0384349 Ga0501038_0384349_257_1003 248
482 3300049575 Ga0501039_0040266 Ga0501039_0040266_2641_3387 248
483 3300049579 Ga0501043_0094814 Ga0501043_0094814_1316_2062 248
484 3300049579 Ga0501043_0135211 Ga0501043_0135211_64_810 248
485 3300049579 Ga0501043_0189186 Ga0501043_0189186_433_1179 248
486 3300049580 Ga0501046_0040210 Ga0501046_0040210_32_778 248
487 3300049580 Ga0501046_0527608 Ga0501046_0527608_70_816 248
488 3300049581 Ga0501047_0096823 Ga0501047_0096823_1620_2366 248
489 3300049581 Ga0501047_0449414 Ga0501047_0449414_100_846 248
490 3300049582 Ga0501048_0027958 Ga0501048_0027958_57_803 248
491 3300049582 Ga0501048_0034083 Ga0501048_0034083_2722_3468 248
492 3300049822 Ga0501035_0017076 Ga0501035_0017076_1300_2046 248
493 3300049822 Ga0501035_0238240 Ga0501035_0238240_335_1081 248
494 3300049822 Ga0501035_0258256 Ga0501035_0258256_682_1428 248
495 3300049822 Ga0501035_0396171 Ga0501035_0396171_369_1115 248
496 3300049823 Ga0501044_0366541 Ga0501044_0366541_98_904 248
497 3300054114 Ga0501084_0520096 Ga0501084_0520096_16_762 248
498 3300061719 Ga0466962_0004244 Ga0466962_0004244_2229_2975 248
499 iso_pu_bacteria 2537561836 2538833384 248
500 iso_pu_bacteria 2643221562 2643831885 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

1

184

0.96

PF08659

KR

KR domain

1

119

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

5

229

0.91

PF23441

100

231

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hs9-assembly3.cif.gz_C brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant:i258m/k262t 0.9433 8 242
3edm-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9384 8 241
3osu-assembly1.cif.gz_A crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.938 8 242
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9369 8 241
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9367 7 242
ID Description Score Start End Superfamily
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9375 8 189 3.40.50.720
3dijB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9358 10 247 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9331 7 238 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9286 8 163 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9276 8 242 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A849MK26-F1-model_v4 Pteridine reductase (EC 1.5.1.33) 0.9714 8 245 GO:0016491
AF-A0A3D5DFU2-F1-model_v4 Pteridine reductase 0.9642 7 247 GO:0016491
AF-A0A847I682-F1-model_v4 SDR family oxidoreductase 0.9585 6 245
AF-A0A3D5DFU2-F1-model_v4 Pteridine reductase 0.9564 7 247 GO:0016491
AF-A0A161XI10-F1-model_v4 deleted 0.9556 7 186

Feature Viewer

pLDDT pTM Quality
89.86 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map