F455613
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 500 | 240 | 491 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0799683|Ga0501047_0799683_26_745 |
| Length | 232 |
| Sequence | VLVTGAARRIGAEVARTLHGAGYDLALHCRHSRAELDALLAELEQARAGSTLALQADLAEVAQLPVLVDATLARFGRLDGLVNNASVFQPTPIGGITAAQWDSLFAANARAPLFHLARQRGAIVNLVDIYAERPLPGHAVYCMAKAALVMATRALAQELAPDVRVNGVAPGAVLWPEHGEGAADRAALLARTPLARSGTPGEVAGAVLWLLRDARYTTGEIVRVDGGRSLAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 3 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 4 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 5 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 6 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 7 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 8 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 9 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 10 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 15 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 16 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 17 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 26 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 104 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 105 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 181 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 182 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 186 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 187 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 214 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 215 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 216 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 217 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 218 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.2 |
| Metatranscriptomes | 0.8 |
| Isolates | 2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19 |
| Nodule | 0 |
| Rhizoplane | 2.6 |
| Rhizosphere | 65.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10032961 | 3300001989 | Bacteria | 1777 |
| 2 | JGI24737J22298_10002961 | 3300001990 | Bacteria | 6016 |
| 3 | JGI24735J21928_10007207 | 3300002067 | Bacteria | 3627 |
| 4 | JGI25156J39149_1001002 | 3300002705 | Bacteria | 13286 |
| 5 | JGI25156J39149_1018491 | 3300002705 | Bacteria | 1285 |
| 6 | JGI25162J39368_1000168 | 3300002737 | Bacteria | 72115 |
| 7 | JGI25162J39368_1000538 | 3300002737 | Bacteria | 28189 |
| 8 | JGI25162J39368_1000924 | 3300002737 | Bacteria | 18847 |
| 9 | JGI25162J39368_1001519 | 3300002737 | Bacteria | 12020 |
| 10 | JGI25162J39368_1001920 | 3300002737 | Bacteria | 9516 |
| 11 | JGI25157J39369_1000196 | 3300002741 | Bacteria | 51212 |
| 12 | JGI25157J39369_1000989 | 3300002741 | Bacteria | 13286 |
| 13 | JGI25157J39369_1001449 | 3300002741 | Bacteria | 8885 |
| 14 | JGI25157J39369_1001486 | 3300002741 | Bacteria | 8634 |
| 15 | JGI25163J39215_1000537 | 3300002771 | Bacteria | 11106 |
| 16 | JGI25164J39214_1000004 | 3300002772 | Bacteria | 350814 |
| 17 | JGI25164J39214_1000132 | 3300002772 | Bacteria | 72064 |
| 18 | JGI25164J39214_1000265 | 3300002772 | Bacteria | 38924 |
| 19 | JGI25164J39214_1000665 | 3300002772 | Bacteria | 14025 |
| 20 | JGI25165J46597_1000242 | 3300003214 | Bacteria | 74940 |
| 21 | JGI25165J46597_1000271 | 3300003214 | Bacteria | 66785 |
| 22 | JGI25165J46597_1000828 | 3300003214 | Bacteria | 23057 |
| 23 | JGI25165J46597_1002100 | 3300003214 | Bacteria | 7287 |
| 24 | JGI25153J46596_10012497 | 3300003215 | Bacteria | 3659 |
| 25 | rootH1_10128341 | 3300003316 | Bacteria | 2835 |
| 26 | rootH1_10128341 | 3300003323 | Bacteria | 1626 |
| 27 | rootH2_10000507 | 3300003320 | Bacteria | 26810 |
| 28 | rootH2_10086143 | 3300003320 | Bacteria | 2201 |
| 29 | rootH2_10142418 | 3300003320 | Bacteria | 1206 |
| 30 | rootL2_10137420 | 3300003322 | Bacteria | 3224 |
| 31 | rootH1_10247911 | 3300003323 | Bacteria | 1901 |
| 32 | Ga0006562J51391_1074911 | 3300003578 | Bacteria | 9320 |
| 33 | Ga0006562J51391_1074912 | 3300003578 | Bacteria | 9492 |
| 34 | Ga0055538_1004343 | 3300003751 | Bacteria | 1622 |
| 35 | Ga0055539_1002899 | 3300003752 | Bacteria | 2497 |
| 36 | Ga0055539_1010088 | 3300003752 | Bacteria | 1170 |
| 37 | Ga0055533_1001034 | 3300003756 | Bacteria | 8054 |
| 38 | Ga0055533_1002026 | 3300003756 | Bacteria | 4921 |
| 39 | Ga0055533_1011226 | 3300003756 | Bacteria | 981 |
| 40 | Ga0055525_1000152 | 3300003759 | Bacteria | 93935 |
| 41 | Ga0055527_1000059 | 3300003760 | Bacteria | 93123 |
| 42 | Ga0055527_1000452 | 3300003760 | Bacteria | 16214 |
| 43 | Ga0055535_1000207 | 3300003761 | Bacteria | 62292 |
| 44 | Ga0055535_1000232 | 3300003761 | Bacteria | 58526 |
| 45 | Ga0055535_1000511 | 3300003761 | Bacteria | 34261 |
| 46 | Ga0055535_1000726 | 3300003761 | Bacteria | 24973 |
| 47 | Ga0055535_1001120 | 3300003761 | Bacteria | 16214 |
| 48 | Ga0055535_1001270 | 3300003761 | Bacteria | 13884 |
| 49 | Ga0055535_1012508 | 3300003761 | Bacteria | 1293 |
| 50 | Ga0055542_1000137 | 3300003762 | Bacteria | 93123 |
| 51 | Ga0055542_1000207 | 3300003762 | Bacteria | 72115 |
| 52 | Ga0055542_1000239 | 3300003762 | Bacteria | 63224 |
| 53 | Ga0055542_1000417 | 3300003762 | Bacteria | 41501 |
| 54 | Ga0055542_1000438 | 3300003762 | Bacteria | 39848 |
| 55 | Ga0055542_1001106 | 3300003762 | Bacteria | 16214 |
| 56 | Ga0055529_1000092 | 3300003763 | Bacteria | 137763 |
| 57 | Ga0055529_1000225 | 3300003763 | Bacteria | 72635 |
| 58 | Ga0055529_1000909 | 3300003763 | Bacteria | 16214 |
| 59 | Ga0055529_1001010 | 3300003763 | Bacteria | 13545 |
| 60 | Ga0055529_1014227 | 3300003763 | Bacteria | 1009 |
| 61 | Ga0065165_1001811 | 3300005262 | Bacteria | 20957 |
| 62 | Ga0068869_100007763 | 3300005334 | Bacteria | 6881 |
| 63 | Ga0070680_100326419 | 3300005336 | Bacteria | 1303 |
| 64 | Ga0070682_100005615 | 3300005337 | Bacteria | 6991 |
| 65 | Ga0070682_100042169 | 3300005337 | Bacteria | 2815 |
| 66 | Ga0070682_100068361 | 3300005337 | Bacteria | 2266 |
| 67 | Ga0068868_100108528 | 3300005338 | Bacteria | 2253 |
| 68 | Ga0070660_100077922 | 3300005339 | Bacteria | 2598 |
| 69 | Ga0070660_100177521 | 3300005339 | Bacteria | 1723 |
| 70 | Ga0070689_100011511 | 3300005340 | Bacteria | 6341 |
| 71 | Ga0070661_100070421 | 3300005344 | Bacteria | 2572 |
| 72 | Ga0070661_100259887 | 3300005344 | Bacteria | 1342 |
| 73 | Ga0070661_100265384 | 3300005344 | Bacteria | 1328 |
| 74 | Ga0070692_10020881 | 3300005345 | Bacteria | 3180 |
| 75 | Ga0070668_100013123 | 3300005347 | Bacteria | 6175 |
| 76 | Ga0070675_100019450 | 3300005354 | Bacteria | 5412 |
| 77 | Ga0070673_100107236 | 3300005364 | Bacteria | 2310 |
| 78 | Ga0070688_100014451 | 3300005365 | Bacteria | 4474 |
| 79 | Ga0070688_100116090 | 3300005365 | Bacteria | 1787 |
| 80 | Ga0070659_100009262 | 3300005366 | Bacteria | 7228 |
| 81 | Ga0070659_100014534 | 3300005366 | Bacteria | 5883 |
| 82 | Ga0070659_100071500 | 3300005366 | Bacteria | 2758 |
| 83 | Ga0070667_100032514 | 3300005367 | Bacteria | 4352 |
| 84 | Ga0070667_100278592 | 3300005367 | Bacteria | 1501 |
| 85 | Ga0070714_100030666 | 3300005435 | Bacteria | 4478 |
| 86 | Ga0070713_100003472 | 3300005436 | Bacteria | 10404 |
| 87 | Ga0070694_100115566 | 3300005444 | Bacteria | 1918 |
| 88 | Ga0070663_100044233 | 3300005455 | Bacteria | 3138 |
| 89 | Ga0070663_100068897 | 3300005455 | Bacteria | 2569 |
| 90 | Ga0070663_100107391 | 3300005455 | Bacteria | 2092 |
| 91 | Ga0070663_100219202 | 3300005455 | Bacteria | 1493 |
| 92 | Ga0070678_100008384 | 3300005456 | Bacteria | 6188 |
| 93 | Ga0070662_100054768 | 3300005457 | Bacteria | 2891 |
| 94 | Ga0070681_10003497 | 3300005458 | Bacteria | 14707 |
| 95 | Ga0070681_10116968 | 3300005458 | Bacteria | 2603 |
| 96 | Ga0070681_10917353 | 3300005458 | Bacteria | 795 |
| 97 | Ga0068867_100010992 | 3300005459 | Bacteria | 6381 |
| 98 | Ga0070685_10001702 | 3300005466 | Bacteria | 11560 |
| 99 | Ga0070685_10009310 | 3300005466 | Bacteria | 5069 |
| 100 | Ga0070679_100071824 | 3300005530 | Bacteria | 3453 |
| 101 | Ga0068853_100019439 | 3300005539 | Bacteria | 5631 |
| 102 | Ga0068853_100255467 | 3300005539 | Bacteria | 1609 |
| 103 | Ga0070672_100018395 | 3300005543 | Bacteria | 5052 |
| 104 | Ga0070696_100009794 | 3300005546 | Bacteria | 6412 |
| 105 | Ga0070696_100060683 | 3300005546 | Bacteria | 2645 |
| 106 | Ga0070696_100318545 | 3300005546 | Bacteria | 1196 |
| 107 | Ga0070693_100009002 | 3300005547 | Bacteria | 4953 |
| 108 | Ga0070665_100279080 | 3300005548 | Bacteria | 1672 |
| 109 | Ga0068855_100003107 | 3300005563 | Bacteria | 20323 |
| 110 | Ga0068855_100027990 | 3300005563 | Bacteria | 6742 |
| 111 | Ga0068855_100061053 | 3300005563 | Bacteria | 4405 |
| 112 | Ga0068857_100000582 | 3300005577 | Bacteria | 26722 |
| 113 | Ga0068857_100072494 | 3300005577 | Bacteria | 3069 |
| 114 | Ga0068857_100077446 | 3300005577 | Bacteria | 2967 |
| 115 | Ga0068857_100080611 | 3300005577 | Bacteria | 2906 |
| 116 | Ga0068857_100154037 | 3300005577 | Bacteria | 2084 |
| 117 | Ga0068857_100308452 | 3300005577 | Bacteria | 1460 |
| 118 | Ga0068854_100000823 | 3300005578 | Bacteria | 18509 |
| 119 | Ga0068854_100015025 | 3300005578 | Bacteria | 5117 |
| 120 | Ga0068854_100060365 | 3300005578 | Bacteria | 2743 |
| 121 | Ga0068856_100001041 | 3300005614 | Bacteria | 29447 |
| 122 | Ga0068856_100004908 | 3300005614 | Bacteria | 13238 |
| 123 | Ga0068856_100045402 | 3300005614 | Bacteria | 4326 |
| 124 | Ga0068856_100767128 | 3300005614 | Bacteria | 984 |
| 125 | Ga0068852_100492115 | 3300005616 | Bacteria | 1220 |
| 126 | Ga0068852_100733441 | 3300005616 | Bacteria | 999 |
| 127 | Ga0068859_100056245 | 3300005617 | Bacteria | 3958 |
| 128 | Ga0068861_100037616 | 3300005719 | Bacteria | 3598 |
| 129 | Ga0068870_10058983 | 3300005840 | Bacteria | 2056 |
| 130 | Ga0068863_100385756 | 3300005841 | Bacteria | 1368 |
| 131 | Ga0068858_100577313 | 3300005842 | Bacteria | 1089 |
| 132 | Ga0068860_100011841 | 3300005843 | Bacteria | 8597 |
| 133 | Ga0068860_100125921 | 3300005843 | Bacteria | 2455 |
| 134 | Ga0075366_10257400 | 3300006195 | Bacteria | 1065 |
| 135 | Ga0097621_100037576 | 3300006237 | Bacteria | 3882 |
| 136 | Ga0068871_100260384 | 3300006358 | Bacteria | 1513 |
| 137 | Ga0075428_100083984 | 3300006844 | Bacteria | 3474 |
| 138 | Ga0075430_100018223 | 3300006846 | Bacteria | 5975 |
| 139 | Ga0068865_100041015 | 3300006881 | Bacteria | 3148 |
| 140 | Ga0075436_100000939 | 3300006914 | Bacteria | 19466 |
| 141 | Ga0097620_100056245 | 3300006931 | Bacteria | 3958 |
| 142 | Ga0105240_10001890 | 3300009093 | Bacteria | 34813 |
| 143 | Ga0105240_10003120 | 3300009093 | Bacteria | 26093 |
| 144 | Ga0105240_10004144 | 3300009093 | Bacteria | 22213 |
| 145 | Ga0105240_10021623 | 3300009093 | Bacteria | 8556 |
| 146 | Ga0105240_10082857 | 3300009093 | Bacteria | 3938 |
| 147 | Ga0105240_10268428 | 3300009093 | Bacteria | 1966 |
| 148 | Ga0105245_10162716 | 3300009098 | Bacteria | 2119 |
| 149 | Ga0105245_10326348 | 3300009098 | Bacteria | 1513 |
| 150 | Ga0114129_10014152 | 3300009147 | Bacteria | 11367 |
| 151 | Ga0105237_10000036 | 3300009545 | Bacteria | 191142 |
| 152 | Ga0105237_10137205 | 3300009545 | Bacteria | 2440 |
| 153 | Ga0105238_10000775 | 3300009551 | Bacteria | 33222 |
| 154 | Ga0105238_10017198 | 3300009551 | Bacteria | 7345 |
| 155 | Ga0105238_10021100 | 3300009551 | Bacteria | 6637 |
| 156 | Ga0105238_10026616 | 3300009551 | Bacteria | 5897 |
| 157 | Ga0105238_10058108 | 3300009551 | Bacteria | 3878 |
| 158 | Ga0105238_10209813 | 3300009551 | Bacteria | 1924 |
| 159 | Ga0105238_10566677 | 3300009551 | Bacteria | 1141 |
| 160 | Ga0105249_10078210 | 3300009553 | Bacteria | 3069 |
| 161 | Ga0105147_102258 | 3300009982 | Bacteria | 1594 |
| 162 | Ga0105239_10000480 | 3300010375 | Bacteria | 58268 |
| 163 | Ga0105239_10018925 | 3300010375 | Bacteria | 7610 |
| 164 | Ga0105239_10163076 | 3300010375 | Bacteria | 2491 |
| 165 | Ga0105239_10224846 | 3300010375 | Bacteria | 2105 |
| 166 | Ga0105239_10427371 | 3300010375 | Bacteria | 1501 |
| 167 | Ga0105246_10012639 | 3300011119 | Bacteria | 5273 |
| 168 | Ga0157314_1000030 | 3300012500 | Bacteria | 14246 |
| 169 | Ga0157373_10023309 | 3300013100 | Bacteria | 4488 |
| 170 | Ga0157373_10034475 | 3300013100 | Bacteria | 3635 |
| 171 | Ga0157373_10050254 | 3300013100 | Bacteria | 2969 |
| 172 | Ga0157371_10008217 | 3300013102 | Bacteria | 8342 |
| 173 | Ga0157371_10365529 | 3300013102 | Bacteria | 1052 |
| 174 | Ga0157370_10002180 | 3300013104 | Bacteria | 23888 |
| 175 | Ga0157370_10093126 | 3300013104 | Bacteria | 2828 |
| 176 | Ga0157370_10104839 | 3300013104 | Bacteria | 2647 |
| 177 | Ga0157369_10004089 | 3300013105 | Bacteria | 17276 |
| 178 | Ga0157369_10162008 | 3300013105 | Bacteria | 2361 |
| 179 | Ga0157369_10166672 | 3300013105 | Bacteria | 2323 |
| 180 | Ga0157378_10000215 | 3300013297 | Bacteria | 55895 |
| 181 | Ga0163162_10178019 | 3300013306 | Bacteria | 2252 |
| 182 | Ga0163162_10506712 | 3300013306 | Bacteria | 1337 |
| 183 | Ga0157372_10027601 | 3300013307 | Bacteria | 6186 |
| 184 | Ga0157372_10259459 | 3300013307 | Bacteria | 2018 |
| 185 | Ga0157372_10309981 | 3300013307 | Bacteria | 1837 |
| 186 | Ga0182008_10036947 | 3300014497 | Bacteria | 2443 |
| 187 | Ga0182008_10080605 | 3300014497 | Bacteria | 1602 |
| 188 | Ga0157379_10004627 | 3300014968 | Bacteria | 11808 |
| 189 | Ga0182007_10003520 | 3300015262 | Bacteria | 7371 |
| 190 | Ga0182007_10033807 | 3300015262 | Bacteria | 1731 |
| 191 | Ga0183369_1004 | 3300015685 | Bacteria | 539301 |
| 192 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 193 | Ga0183361_12171 | 3300016635 | Bacteria | 1053 |
| 194 | Ga0206356_10173653 | 3300020070 | Bacteria | 1699 |
| 195 | Ga0206353_11202800 | 3300020082 | Bacteria | 3011 |
| 196 | Ga0209435_103044 | 3300025206 | Bacteria | 1927 |
| 197 | Ga0209435_103569 | 3300025206 | Bacteria | 1772 |
| 198 | Ga0209760_100687 | 3300025207 | Bacteria | 5285 |
| 199 | Ga0209784_100131 | 3300025224 | Bacteria | 75418 |
| 200 | Ga0209674_100014 | 3300025226 | Bacteria | 704989 |
| 201 | Ga0209674_100058 | 3300025226 | Bacteria | 286902 |
| 202 | Ga0209674_100657 | 3300025226 | Bacteria | 12395 |
| 203 | Ga0209674_101021 | 3300025226 | Bacteria | 8548 |
| 204 | Ga0209672_100043 | 3300025228 | Bacteria | 270302 |
| 205 | Ga0209672_100061 | 3300025228 | Bacteria | 206098 |
| 206 | Ga0209672_100070 | 3300025228 | Bacteria | 174481 |
| 207 | Ga0209672_100250 | 3300025228 | Bacteria | 40232 |
| 208 | Ga0209672_101112 | 3300025228 | Bacteria | 11315 |
| 209 | Ga0209672_104065 | 3300025228 | Bacteria | 2820 |
| 210 | Ga0209563_100062 | 3300025230 | Bacteria | 264769 |
| 211 | Ga0207427_100031 | 3300025231 | Bacteria | 350866 |
| 212 | Ga0207427_100161 | 3300025231 | Bacteria | 75712 |
| 213 | Ga0207427_100194 | 3300025231 | Bacteria | 58375 |
| 214 | Ga0207427_100226 | 3300025231 | Bacteria | 48141 |
| 215 | Ga0209437_100061 | 3300025233 | Bacteria | 350866 |
| 216 | Ga0209437_100116 | 3300025233 | Bacteria | 209449 |
| 217 | Ga0209437_100121 | 3300025233 | Bacteria | 202531 |
| 218 | Ga0209437_100257 | 3300025233 | Bacteria | 82683 |
| 219 | Ga0209437_100464 | 3300025233 | Bacteria | 32024 |
| 220 | Ga0209258_100054 | 3300025242 | Bacteria | 339063 |
| 221 | Ga0209258_100076 | 3300025242 | Bacteria | 270302 |
| 222 | Ga0209258_100092 | 3300025242 | Bacteria | 226544 |
| 223 | Ga0209258_100097 | 3300025242 | Bacteria | 216963 |
| 224 | Ga0209258_100104 | 3300025242 | Bacteria | 208582 |
| 225 | Ga0209258_100715 | 3300025242 | Bacteria | 22208 |
| 226 | Ga0209646_1000254 | 3300025246 | Bacteria | 53440 |
| 227 | Ga0209646_1006130 | 3300025246 | Bacteria | 2037 |
| 228 | Ga0209646_1012888 | 3300025246 | Bacteria | 1277 |
| 229 | Ga0209026_1000143 | 3300025250 | Bacteria | 113602 |
| 230 | Ga0209026_1000230 | 3300025250 | Bacteria | 75852 |
| 231 | Ga0209026_1000277 | 3300025250 | Bacteria | 59750 |
| 232 | Ga0209026_1000661 | 3300025250 | Bacteria | 21064 |
| 233 | Ga0209026_1003690 | 3300025250 | Bacteria | 4899 |
| 234 | Ga0209677_103617 | 3300025253 | Bacteria | 4889 |
| 235 | Ga0209677_106391 | 3300025253 | Bacteria | 2795 |
| 236 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 237 | Ga0209148_1000047 | 3300025254 | Bacteria | 434369 |
| 238 | Ga0209148_1000063 | 3300025254 | Bacteria | 346881 |
| 239 | Ga0209148_1000066 | 3300025254 | Bacteria | 339063 |
| 240 | Ga0209148_1000082 | 3300025254 | Bacteria | 270302 |
| 241 | Ga0209148_1000106 | 3300025254 | Bacteria | 208597 |
| 242 | Ga0209759_1000308 | 3300025256 | Bacteria | 66182 |
| 243 | Ga0209759_1000361 | 3300025256 | Bacteria | 58219 |
| 244 | Ga0209759_1001242 | 3300025256 | Bacteria | 15474 |
| 245 | Ga0209759_1009720 | 3300025256 | Bacteria | 2883 |
| 246 | Ga0209759_1015953 | 3300025256 | Bacteria | 1917 |
| 247 | Ga0209129_1005400 | 3300025258 | Bacteria | 4544 |
| 248 | Ga0209233_1000076 | 3300025261 | Bacteria | 350866 |
| 249 | Ga0209233_1000100 | 3300025261 | Bacteria | 293905 |
| 250 | Ga0209233_1000112 | 3300025261 | Bacteria | 258251 |
| 251 | Ga0209233_1000114 | 3300025261 | Bacteria | 246083 |
| 252 | Ga0209233_1001902 | 3300025261 | Bacteria | 8009 |
| 253 | Ga0209233_1018495 | 3300025261 | Bacteria | 1874 |
| 254 | Ga0209233_1019881 | 3300025261 | Bacteria | 1774 |
| 255 | Ga0209455_1000056 | 3300025272 | Bacteria | 349821 |
| 256 | Ga0209455_1000078 | 3300025272 | Bacteria | 270237 |
| 257 | Ga0209455_1000096 | 3300025272 | Bacteria | 217006 |
| 258 | Ga0209455_1000101 | 3300025272 | Bacteria | 206098 |
| 259 | Ga0209455_1000789 | 3300025272 | Bacteria | 17594 |
| 260 | Ga0209455_1005056 | 3300025272 | Bacteria | 4172 |
| 261 | Ga0209758_1000491 | 3300025297 | Bacteria | 64678 |
| 262 | Ga0207680_10279727 | 3300025903 | Bacteria | 1159 |
| 263 | Ga0207647_10001129 | 3300025904 | Bacteria | 20554 |
| 264 | Ga0207647_10011422 | 3300025904 | Bacteria | 6230 |
| 265 | Ga0207645_10230947 | 3300025907 | Bacteria | 1221 |
| 266 | Ga0207643_10066663 | 3300025908 | Bacteria | 2065 |
| 267 | Ga0207654_10373621 | 3300025911 | Bacteria | 986 |
| 268 | Ga0207707_10019591 | 3300025912 | Bacteria | 5904 |
| 269 | Ga0207707_10022271 | 3300025912 | Bacteria | 5540 |
| 270 | Ga0207695_10000219 | 3300025913 | Bacteria | 153492 |
| 271 | Ga0207695_10001444 | 3300025913 | Bacteria | 39750 |
| 272 | Ga0207695_10001553 | 3300025913 | Bacteria | 37757 |
| 273 | Ga0207695_10002198 | 3300025913 | Bacteria | 29376 |
| 274 | Ga0207695_10002664 | 3300025913 | Bacteria | 26087 |
| 275 | Ga0207695_10010679 | 3300025913 | Bacteria | 11216 |
| 276 | Ga0207671_10000009 | 3300025914 | Bacteria | 724862 |
| 277 | Ga0207671_10000135 | 3300025914 | Bacteria | 112401 |
| 278 | Ga0207671_10018454 | 3300025914 | Bacteria | 5352 |
| 279 | Ga0207671_10054425 | 3300025914 | Bacteria | 2965 |
| 280 | Ga0207660_10218865 | 3300025917 | Bacteria | 1494 |
| 281 | Ga0207657_10104289 | 3300025919 | Bacteria | 2349 |
| 282 | Ga0207657_10582194 | 3300025919 | Bacteria | 874 |
| 283 | Ga0207649_10101837 | 3300025920 | Bacteria | 1902 |
| 284 | Ga0207649_10430847 | 3300025920 | Bacteria | 992 |
| 285 | Ga0207652_10052676 | 3300025921 | Bacteria | 3494 |
| 286 | Ga0207681_10015700 | 3300025923 | Bacteria | 4727 |
| 287 | Ga0207694_10002806 | 3300025924 | Bacteria | 14067 |
| 288 | Ga0207694_10024283 | 3300025924 | Bacteria | 4603 |
| 289 | Ga0207694_10045581 | 3300025924 | Bacteria | 3387 |
| 290 | Ga0207694_10090581 | 3300025924 | Bacteria | 2413 |
| 291 | Ga0207694_10091757 | 3300025924 | Bacteria | 2397 |
| 292 | Ga0207659_10009867 | 3300025926 | Bacteria | 5977 |
| 293 | Ga0207687_10102928 | 3300025927 | Bacteria | 2105 |
| 294 | Ga0207700_10001377 | 3300025928 | Bacteria | 13794 |
| 295 | Ga0207664_10009261 | 3300025929 | Bacteria | 6902 |
| 296 | Ga0207690_10014652 | 3300025932 | Bacteria | 4739 |
| 297 | Ga0207690_10017061 | 3300025932 | Bacteria | 4428 |
| 298 | Ga0207690_10040916 | 3300025932 | Bacteria | 3033 |
| 299 | Ga0207690_10482901 | 3300025932 | Bacteria | 1000 |
| 300 | Ga0207690_10540643 | 3300025932 | Bacteria | 946 |
| 301 | Ga0207706_10014779 | 3300025933 | Bacteria | 7067 |
| 302 | Ga0207670_10005876 | 3300025936 | Bacteria | 6772 |
| 303 | Ga0207704_10023577 | 3300025938 | Bacteria | 3320 |
| 304 | Ga0207691_10017492 | 3300025940 | Bacteria | 6797 |
| 305 | Ga0207689_10017888 | 3300025942 | Bacteria | 5987 |
| 306 | Ga0207667_10000193 | 3300025949 | Bacteria | 88949 |
| 307 | Ga0207667_10000244 | 3300025949 | Bacteria | 76441 |
| 308 | Ga0207667_10067422 | 3300025949 | Bacteria | 3728 |
| 309 | Ga0207667_10098492 | 3300025949 | Bacteria | 3017 |
| 310 | Ga0207651_10253855 | 3300025960 | Bacteria | 1440 |
| 311 | Ga0207712_10046150 | 3300025961 | Bacteria | 3019 |
| 312 | Ga0207668_10021092 | 3300025972 | Bacteria | 4151 |
| 313 | Ga0207640_10000169 | 3300025981 | Bacteria | 47286 |
| 314 | Ga0207640_10000189 | 3300025981 | Bacteria | 43839 |
| 315 | Ga0207640_10047902 | 3300025981 | Bacteria | 2760 |
| 316 | Ga0207640_10078339 | 3300025981 | Bacteria | 2249 |
| 317 | Ga0207658_10216591 | 3300025986 | Bacteria | 1608 |
| 318 | Ga0207658_10258818 | 3300025986 | Bacteria | 1482 |
| 319 | Ga0207658_10505003 | 3300025986 | Bacteria | 1077 |
| 320 | Ga0207677_10052268 | 3300026023 | Bacteria | 2775 |
| 321 | Ga0207703_10406250 | 3300026035 | Bacteria | 1264 |
| 322 | Ga0207639_10032144 | 3300026041 | Bacteria | 3862 |
| 323 | Ga0207639_10275805 | 3300026041 | Bacteria | 1477 |
| 324 | Ga0207678_10025885 | 3300026067 | Bacteria | 5121 |
| 325 | Ga0207678_10030661 | 3300026067 | Bacteria | 4695 |
| 326 | Ga0207678_10158690 | 3300026067 | Bacteria | 1932 |
| 327 | Ga0207678_10227963 | 3300026067 | Bacteria | 1595 |
| 328 | Ga0207702_10000037 | 3300026078 | Bacteria | 153366 |
| 329 | Ga0207702_10000230 | 3300026078 | Bacteria | 64987 |
| 330 | Ga0207702_10011445 | 3300026078 | Bacteria | 7396 |
| 331 | Ga0207702_10331537 | 3300026078 | Bacteria | 1452 |
| 332 | Ga0207641_10591455 | 3300026088 | Bacteria | 1085 |
| 333 | Ga0207648_10019556 | 3300026089 | Bacteria | 6112 |
| 334 | Ga0207676_10033753 | 3300026095 | Bacteria | 3869 |
| 335 | Ga0207674_10000401 | 3300026116 | Bacteria | 56126 |
| 336 | Ga0207674_10072075 | 3300026116 | Bacteria | 3471 |
| 337 | Ga0207674_10158108 | 3300026116 | Bacteria | 2221 |
| 338 | Ga0207675_100133265 | 3300026118 | Bacteria | 2356 |
| 339 | Ga0207698_10271956 | 3300026142 | Bacteria | 1562 |
| 340 | Ga0268266_10417202 | 3300028379 | Bacteria | 1271 |
| 341 | Ga0268265_10181486 | 3300028380 | Bacteria | 1809 |
| 342 | Ga0268265_10415500 | 3300028380 | Bacteria | 1247 |
| 343 | Ga0268264_10018660 | 3300028381 | Bacteria | 5670 |
| 344 | Ga0268264_10095513 | 3300028381 | Bacteria | 2572 |
| 345 | Ga0307509_10336154 | 3300031507 | Bacteria | 1240 |
| 346 | Ga0307516_10056297 | 3300031730 | Bacteria | 3834 |
| 347 | Ga0307405_10169208 | 3300031731 | Bacteria | 1557 |
| 348 | Ga0307414_10024617 | 3300032004 | Bacteria | 3842 |
| 349 | Ga0307414_10817853 | 3300032004 | Bacteria | 850 |
| 350 | Ga0307415_100230242 | 3300032126 | Bacteria | 1492 |
| 351 | Ga0395899_0000215 | 3300037312 | Bacteria | 82905 |
| 352 | Ga0395899_0001471 | 3300037312 | Bacteria | 20047 |
| 353 | Ga0395899_0018330 | 3300037312 | Bacteria | 5321 |
| 354 | Ga0395899_0218581 | 3300037312 | Bacteria | 1321 |
| 355 | Ga0395900_0000117 | 3300037418 | Bacteria | 137733 |
| 356 | Ga0395900_0001714 | 3300037418 | Bacteria | 25336 |
| 357 | Ga0395900_0003030 | 3300037418 | Bacteria | 18287 |
| 358 | Ga0395898_0000120 | 3300037466 | Bacteria | 209091 |
| 359 | Ga0395898_0000411 | 3300037466 | Bacteria | 92170 |
| 360 | Ga0395898_0013222 | 3300037466 | Bacteria | 8502 |
| 361 | Ga0395898_0078346 | 3300037466 | Bacteria | 3188 |
| 362 | Ga0395898_0080786 | 3300037466 | Bacteria | 3135 |
| 363 | Ga0395905_0196425 | 3300037471 | Bacteria | 1892 |
| 364 | Ga0395905_0366372 | 3300037471 | Bacteria | 1334 |
| 365 | Ga0395901_0000413 | 3300038443 | Bacteria | 50350 |
| 366 | Ga0395901_0022980 | 3300038443 | Bacteria | 6391 |
| 367 | Ga0395901_0088231 | 3300038443 | Bacteria | 3244 |
| 368 | Ga0395901_0151868 | 3300038443 | Bacteria | 2433 |
| 369 | Ga0395901_0152233 | 3300038443 | Bacteria | 2430 |
| 370 | Ga0395901_0155772 | 3300038443 | Bacteria | 2399 |
| 371 | Ga0395901_0215481 | 3300038443 | Bacteria | 2008 |
| 372 | Ga0451793_0489457 | 3300041452 | Bacteria | 1920 |
| 373 | Ga0439448_0139168 | 3300042005 | Bacteria | 839 |
| 374 | Ga0439459_0006821 | 3300042438 | Bacteria | 1912 |
| 375 | Ga0466969_0006778 | 3300044656 | Bacteria | 6093 |
| 376 | Ga0466969_0021366 | 3300044656 | Bacteria | 3346 |
| 377 | Ga0466969_0101529 | 3300044656 | Bacteria | 1353 |
| 378 | Ga0466972_0122583 | 3300044658 | Bacteria | 1225 |
| 379 | Ga0466975_0029559 | 3300044661 | Bacteria | 3807 |
| 380 | Ga0466982_0000001 | 3300044672 | Bacteria | 514662 |
| 381 | Ga0466965_0361261 | 3300044683 | Bacteria | 797 |
| 382 | Ga0466966_0002318 | 3300044684 | Bacteria | 12404 |
| 383 | Ga0466966_0012350 | 3300044684 | Bacteria | 5659 |
| 384 | Ga0466966_0225300 | 3300044684 | Bacteria | 1131 |
| 385 | Ga0466966_0225301 | 3300044684 | Bacteria | 1131 |
| 386 | Ga0466961_0000719 | 3300044693 | Bacteria | 20839 |
| 387 | Ga0466961_0005754 | 3300044693 | Bacteria | 7846 |
| 388 | Ga0466961_0007591 | 3300044693 | Bacteria | 6907 |
| 389 | Ga0466961_0014899 | 3300044693 | Bacteria | 4994 |
| 390 | Ga0466961_0019639 | 3300044693 | Bacteria | 4347 |
| 391 | Ga0466964_0020308 | 3300044706 | Bacteria | 2558 |
| 392 | Ga0466971_0032864 | 3300044719 | Bacteria | 2324 |
| 393 | Ga0466971_0101572 | 3300044719 | Bacteria | 1322 |
| 394 | Ga0466968_0004523 | 3300044735 | Bacteria | 5201 |
| 395 | Ga0466970_0011662 | 3300044765 | Bacteria | 4484 |
| 396 | Ga0466970_0013509 | 3300044765 | Bacteria | 4187 |
| 397 | Ga0466957_0001903 | 3300044842 | Bacteria | 11068 |
| 398 | Ga0466957_0013572 | 3300044842 | Bacteria | 4728 |
| 399 | Ga0466957_0068963 | 3300044842 | Bacteria | 2184 |
| 400 | Ga0466959_0016259 | 3300045049 | Bacteria | 5433 |
| 401 | Ga0466959_0071612 | 3300045049 | Bacteria | 2510 |
| 402 | Ga0466959_0144950 | 3300045049 | Bacteria | 1676 |
| 403 | Ga0451576_0608679 | 3300045051 | Bacteria | 1148 |
| 404 | Ga0466958_0038587 | 3300045836 | Bacteria | 2866 |
| 405 | Ga0466958_0042424 | 3300045836 | Bacteria | 2739 |
| 406 | Ga0466967_0107834 | 3300045976 | Bacteria | 2555 |
| 407 | Ga0466967_0123024 | 3300045976 | Bacteria | 2400 |
| 408 | Ga0495638_0000339 | 3300046460 | Bacteria | 59031 |
| 409 | Ga0495638_0001037 | 3300046460 | Bacteria | 27481 |
| 410 | Ga0495638_0011413 | 3300046460 | Bacteria | 6122 |
| 411 | Ga0495650_0000064 | 3300046471 | Bacteria | 275412 |
| 412 | Ga0495606_0000368 | 3300046507 | Bacteria | 77266 |
| 413 | Ga0495622_0007604 | 3300046557 | Bacteria | 5031 |
| 414 | Ga0495625_0022965 | 3300046660 | Bacteria | 4772 |
| 415 | Ga0495625_0207015 | 3300046660 | Bacteria | 1291 |
| 416 | Ga0495649_0037392 | 3300046694 | Bacteria | 2664 |
| 417 | Ga0496100_0043702 | 3300048903 | Bacteria | 2867 |
| 418 | Ga0496101_0037544 | 3300048904 | Bacteria | 3437 |
| 419 | Ga0496104_0076731 | 3300048907 | Bacteria | 3183 |
| 420 | Ga0496105_0001219 | 3300048908 | Bacteria | 17945 |
| 421 | Ga0496107_0065801 | 3300048910 | Bacteria | 2628 |
| 422 | Ga0496113_0022662 | 3300048916 | Bacteria | 4446 |
| 423 | Ga0496113_0187457 | 3300048916 | Bacteria | 1641 |
| 424 | Ga0496114_0104236 | 3300048917 | Bacteria | 2425 |
| 425 | Ga0496115_0000283 | 3300048918 | Bacteria | 43828 |
| 426 | Ga0496115_0001095 | 3300048918 | Bacteria | 19601 |
| 427 | Ga0496115_0004542 | 3300048918 | Bacteria | 10043 |
| 428 | Ga0496115_0178381 | 3300048918 | Bacteria | 1756 |
| 429 | Ga0496116_0087751 | 3300048919 | Bacteria | 1903 |
| 430 | Ga0496117_0026162 | 3300048920 | Bacteria | 4570 |
| 431 | Ga0496117_0082787 | 3300048920 | Bacteria | 2100 |
| 432 | Ga0496118_0000182 | 3300048921 | Bacteria | 110967 |
| 433 | Ga0496118_0002818 | 3300048921 | Bacteria | 22746 |
| 434 | Ga0496118_0005399 | 3300048921 | Bacteria | 14542 |
| 435 | Ga0496118_0071172 | 3300048921 | Bacteria | 2505 |
| 436 | Ga0496119_0000748 | 3300048922 | Bacteria | 43680 |
| 437 | Ga0496119_0009539 | 3300048922 | Bacteria | 8311 |
| 438 | Ga0496120_0000013 | 3300048923 | Bacteria | 331109 |
| 439 | Ga0496120_0001574 | 3300048923 | Bacteria | 26674 |
| 440 | Ga0496121_0000531 | 3300048924 | Bacteria | 72444 |
| 441 | Ga0496121_0024261 | 3300048924 | Bacteria | 5809 |
| 442 | Ga0496121_0035584 | 3300048924 | Bacteria | 4459 |
| 443 | Ga0496121_0088996 | 3300048924 | Bacteria | 2418 |
| 444 | Ga0496121_0114221 | 3300048924 | Bacteria | 2053 |
| 445 | Ga0496125_0000647 | 3300048928 | Bacteria | 58140 |
| 446 | Ga0496126_0001015 | 3300048929 | Bacteria | 47751 |
| 447 | Ga0496126_0016981 | 3300048929 | Bacteria | 7261 |
| 448 | Ga0496126_0042076 | 3300048929 | Bacteria | 4222 |
| 449 | Ga0496126_0122427 | 3300048929 | Bacteria | 2254 |
| 450 | Ga0495678_021921 | 3300049459 | Bacteria | 2803 |
| 451 | Ga0495678_063227 | 3300049459 | Bacteria | 1383 |
| 452 | Ga0501032_0083636 | 3300049569 | Bacteria | 2122 |
| 453 | Ga0501032_0133273 | 3300049569 | Bacteria | 1638 |
| 454 | Ga0501032_0292113 | 3300049569 | Bacteria | 1054 |
| 455 | Ga0501033_0000339 | 3300049570 | Bacteria | 44797 |
| 456 | Ga0501033_0203841 | 3300049570 | Bacteria | 1412 |
| 457 | Ga0501034_0185491 | 3300049571 | Bacteria | 2044 |
| 458 | Ga0501034_0195340 | 3300049571 | Bacteria | 1984 |
| 459 | Ga0501036_0065670 | 3300049572 | Bacteria | 3070 |
| 460 | Ga0501036_0498481 | 3300049572 | Bacteria | 1013 |
| 461 | Ga0501037_0227202 | 3300049573 | Bacteria | 1311 |
| 462 | Ga0501038_0384349 | 3300049574 | Bacteria | 1088 |
| 463 | Ga0501039_0040266 | 3300049575 | Bacteria | 3607 |
| 464 | Ga0501042_0595491 | 3300049578 | Bacteria | 804 |
| 465 | Ga0501043_0049783 | 3300049579 | Bacteria | 3294 |
| 466 | Ga0501043_0094814 | 3300049579 | Bacteria | 2345 |
| 467 | Ga0501043_0135211 | 3300049579 | Bacteria | 1931 |
| 468 | Ga0501043_0189186 | 3300049579 | Bacteria | 1601 |
| 469 | Ga0501043_0425578 | 3300049579 | Bacteria | 1000 |
| 470 | Ga0501046_0040210 | 3300049580 | Bacteria | 3738 |
| 471 | Ga0501046_0527608 | 3300049580 | Bacteria | 843 |
| 472 | Ga0501047_0003952 | 3300049581 | Bacteria | 13937 |
| 473 | Ga0501047_0096823 | 3300049581 | Bacteria | 2829 |
| 474 | Ga0501047_0449414 | 3300049581 | Bacteria | 1118 |
| 475 | Ga0501047_0799683 | 3300049581 | Bacteria | 758 |
| 476 | Ga0501048_0027958 | 3300049582 | Bacteria | 4096 |
| 477 | Ga0501048_0034083 | 3300049582 | Bacteria | 3676 |
| 478 | Ga0501070_0060054 | 3300049586 | Bacteria | 3152 |
| 479 | Ga0501035_0017076 | 3300049822 | Bacteria | 6686 |
| 480 | Ga0501035_0030015 | 3300049822 | Bacteria | 4958 |
| 481 | Ga0501035_0036356 | 3300049822 | Bacteria | 4463 |
| 482 | Ga0501035_0238240 | 3300049822 | Bacteria | 1548 |
| 483 | Ga0501035_0258256 | 3300049822 | Bacteria | 1478 |
| 484 | Ga0501035_0396171 | 3300049822 | Bacteria | 1149 |
| 485 | Ga0501044_0008880 | 3300049823 | Bacteria | 10985 |
| 486 | Ga0501044_0366541 | 3300049823 | Bacteria | 1358 |
| 487 | Ga0501044_0670485 | 3300049823 | Bacteria | 924 |
| 488 | nmdc:mga0qj67_106075_c1 | 3300050509 | Bacteria | 2267 |
| 489 | nmdc:mga08x19_8611_c1 | 3300050514 | Bacteria | 6079 |
| 490 | Ga0501084_0520096 | 3300054114 | Bacteria | 1006 |
| 491 | Ga0466962_0004244 | 3300061719 | Bacteria | 6869 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045049 | Ga0466959_0071612 | Ga0466959_0071612_53_736 | 227 |
| 2 | 3300037418 | Ga0395900_0000117 | Ga0395900_0000117_51574_52386 | 228 |
| 3 | 3300038443 | Ga0395901_0151868 | Ga0395901_0151868_937_1749 | 228 |
| 4 | 3300002067 | JGI24735J21928_10007207 | JGI24735J21928_100072072 | 230 |
| 5 | 3300003316 | rootH1_10128341 | rootH1_101283411 | 230 |
| 6 | 3300049581 | Ga0501047_0799683 | Ga0501047_0799683_26_745 | 232 |
| 7 | 3300049579 | Ga0501043_0425578 | Ga0501043_0425578_35_781 | 234 |
| 8 | 3300049822 | Ga0501035_0030015 | Ga0501035_0030015_1277_2023 | 234 |
| 9 | 3300049823 | Ga0501044_0008880 | Ga0501044_0008880_5497_6243 | 234 |
| 10 | 3300003320 | rootH2_10000507 | rootH2_100005078 | 235 |
| 11 | 3300003323 | rootH1_10247911 | rootH1_102479112 | 236 |
| 12 | 3300025261 | Ga0209233_1019881 | Ga0209233_10198812 | 237 |
| 13 | 3300009093 | Ga0105240_10001890 | Ga0105240_1000189012 | 238 |
| 14 | 3300009545 | Ga0105237_10137205 | Ga0105237_101372052 | 238 |
| 15 | 3300009551 | Ga0105238_10000775 | Ga0105238_1000077529 | 238 |
| 16 | 3300010375 | Ga0105239_10427371 | Ga0105239_104273712 | 238 |
| 17 | 3300013307 | Ga0157372_10309981 | Ga0157372_103099811 | 238 |
| 18 | 3300048921 | Ga0496118_0071172 | Ga0496118_0071172_565_1281 | 238 |
| 19 | 3300037312 | Ga0395899_0218581 | Ga0395899_0218581_364_1110 | 240 |
| 20 | 3300038443 | Ga0395901_0215481 | Ga0395901_0215481_732_1478 | 240 |
| 21 | 3300002705 | JGI25156J39149_1001002 | JGI25156J39149_10010023 | 242 |
| 22 | 3300002737 | JGI25162J39368_1001519 | JGI25162J39368_10015198 | 242 |
| 23 | 3300002741 | JGI25157J39369_1000989 | JGI25157J39369_10009893 | 242 |
| 24 | 3300002772 | JGI25164J39214_1000004 | JGI25164J39214_1000004162 | 242 |
| 25 | 3300003214 | JGI25165J46597_1000271 | JGI25165J46597_100027140 | 242 |
| 26 | 3300003761 | Ga0055535_1000726 | Ga0055535_100072611 | 242 |
| 27 | 3300003762 | Ga0055542_1000438 | Ga0055542_10004388 | 242 |
| 28 | 3300003763 | Ga0055529_1000092 | Ga0055529_100009219 | 242 |
| 29 | 3300006844 | Ga0075428_100083984 | Ga0075428_1000839844 | 242 |
| 30 | 3300025228 | Ga0209672_100070 | Ga0209672_100070143 | 242 |
| 31 | 3300025231 | Ga0207427_100031 | Ga0207427_100031143 | 242 |
| 32 | 3300025233 | Ga0209437_100061 | Ga0209437_100061162 | 242 |
| 33 | 3300025242 | Ga0209258_100097 | Ga0209258_100097161 | 242 |
| 34 | 3300025246 | Ga0209646_1006130 | Ga0209646_10061302 | 242 |
| 35 | 3300025250 | Ga0209026_1000661 | Ga0209026_100066118 | 242 |
| 36 | 3300025254 | Ga0209148_1000063 | Ga0209148_1000063161 | 242 |
| 37 | 3300025256 | Ga0209759_1000361 | Ga0209759_100036125 | 242 |
| 38 | 3300025261 | Ga0209233_1000076 | Ga0209233_1000076143 | 242 |
| 39 | 3300025272 | Ga0209455_1000096 | Ga0209455_1000096161 | 242 |
| 40 | 3300031730 | Ga0307516_10056297 | Ga0307516_100562975 | 244 |
| 41 | 3300049571 | Ga0501034_0195340 | Ga0501034_0195340_1007_1744 | 244 |
| 42 | iso_pu_bacteria | 2643221577 | 2643896651 | 244 |
| 43 | iso_pu_bacteria | 2643221685 | 2644478599 | 244 |
| 44 | iso_pu_bacteria | 2687453130 | 2687584658 | 244 |
| 45 | iso_pu_bacteria | 2739367700 | 2739733389 | 244 |
| 46 | iso_pu_bacteria | 2884411467 | 2884412697 | 244 |
| 47 | iso_pu_bacteria | 2895395659 | 2895398189 | 244 |
| 48 | iso_pu_bacteria | 2928963466 | 2928965492 | 244 |
| 49 | iso_pu_bacteria | 2939611941 | 2939613902 | 244 |
| 50 | 3300032004 | Ga0307414_10024617 | Ga0307414_100246173 | 245 |
| 51 | 3300032004 | Ga0307414_10817853 | Ga0307414_108178531 | 245 |
| 52 | 3300006195 | Ga0075366_10257400 | Ga0075366_102574002 | 246 |
| 53 | 3300006914 | Ga0075436_100000939 | Ga0075436_1000009396 | 246 |
| 54 | 3300009147 | Ga0114129_10014152 | Ga0114129_100141528 | 246 |
| 55 | 3300031731 | Ga0307405_10169208 | Ga0307405_101692082 | 246 |
| 56 | 3300032126 | Ga0307415_100230242 | Ga0307415_1002302422 | 246 |
| 57 | 3300045051 | Ga0451576_0608679 | Ga0451576_0608679_330_1076 | 246 |
| 58 | 3300050514 | nmdc:mga08x19_8611_c1 | nmdc:mga08x19_8611_c1_1467_2213 | 246 |
| 59 | 3300005455 | Ga0070663_100068897 | Ga0070663_1000688971 | 247 |
| 60 | 3300005466 | Ga0070685_10001702 | Ga0070685_100017025 | 247 |
| 61 | 3300005616 | Ga0068852_100492115 | Ga0068852_1004921152 | 247 |
| 62 | 3300006846 | Ga0075430_100018223 | Ga0075430_1000182232 | 247 |
| 63 | 3300009982 | Ga0105147_102258 | Ga0105147_1022582 | 247 |
| 64 | 3300013307 | Ga0157372_10259459 | Ga0157372_102594592 | 247 |
| 65 | 3300025903 | Ga0207680_10279727 | Ga0207680_102797272 | 247 |
| 66 | 3300025913 | Ga0207695_10000219 | Ga0207695_1000021953 | 247 |
| 67 | 3300025914 | Ga0207671_10018454 | Ga0207671_100184544 | 247 |
| 68 | 3300025924 | Ga0207694_10002806 | Ga0207694_1000280611 | 247 |
| 69 | 3300026067 | Ga0207678_10030661 | Ga0207678_100306613 | 247 |
| 70 | 3300044656 | Ga0466969_0006778 | Ga0466969_0006778_4915_5658 | 247 |
| 71 | 3300044684 | Ga0466966_0002318 | Ga0466966_0002318_5916_6659 | 247 |
| 72 | 3300044693 | Ga0466961_0007591 | Ga0466961_0007591_5585_6328 | 247 |
| 73 | 3300044693 | Ga0466961_0014899 | Ga0466961_0014899_402_1145 | 247 |
| 74 | 3300044719 | Ga0466971_0032864 | Ga0466971_0032864_294_1037 | 247 |
| 75 | 3300044765 | Ga0466970_0011662 | Ga0466970_0011662_2618_3361 | 247 |
| 76 | 3300044842 | Ga0466957_0013572 | Ga0466957_0013572_1966_2709 | 247 |
| 77 | 3300045049 | Ga0466959_0144950 | Ga0466959_0144950_306_1049 | 247 |
| 78 | 3300049569 | Ga0501032_0133273 | Ga0501032_0133273_103_846 | 247 |
| 79 | 3300049570 | Ga0501033_0203841 | Ga0501033_0203841_157_900 | 247 |
| 80 | 3300049571 | Ga0501034_0185491 | Ga0501034_0185491_491_1234 | 247 |
| 81 | 3300049572 | Ga0501036_0065670 | Ga0501036_0065670_1855_2598 | 247 |
| 82 | 3300049573 | Ga0501037_0227202 | Ga0501037_0227202_314_1057 | 247 |
| 83 | 3300049578 | Ga0501042_0595491 | Ga0501042_0595491_37_780 | 247 |
| 84 | 3300049579 | Ga0501043_0049783 | Ga0501043_0049783_188_931 | 247 |
| 85 | 3300049581 | Ga0501047_0003952 | Ga0501047_0003952_4180_4923 | 247 |
| 86 | 3300049586 | Ga0501070_0060054 | Ga0501070_0060054_1778_2521 | 247 |
| 87 | 3300049822 | Ga0501035_0036356 | Ga0501035_0036356_932_1675 | 247 |
| 88 | 3300049823 | Ga0501044_0670485 | Ga0501044_0670485_86_829 | 247 |
| 89 | 3300050509 | nmdc:mga0qj67_106075_c1 | nmdc:mga0qj67_106075_c1_1460_2209 | 247 |
| 90 | 3300001989 | JGI24739J22299_10032961 | JGI24739J22299_100329612 | 248 |
| 91 | 3300001990 | JGI24737J22298_10002961 | JGI24737J22298_100029612 | 248 |
| 92 | 3300002705 | JGI25156J39149_1018491 | JGI25156J39149_10184912 | 248 |
| 93 | 3300002737 | JGI25162J39368_1000168 | JGI25162J39368_100016845 | 248 |
| 94 | 3300002737 | JGI25162J39368_1000538 | JGI25162J39368_100053811 | 248 |
| 95 | 3300002737 | JGI25162J39368_1000924 | JGI25162J39368_10009245 | 248 |
| 96 | 3300002737 | JGI25162J39368_1001920 | JGI25162J39368_10019207 | 248 |
| 97 | 3300002741 | JGI25157J39369_1000196 | JGI25157J39369_100019643 | 248 |
| 98 | 3300002741 | JGI25157J39369_1001449 | JGI25157J39369_10014496 | 248 |
| 99 | 3300002741 | JGI25157J39369_1001486 | JGI25157J39369_10014868 | 248 |
| 100 | 3300002771 | JGI25163J39215_1000537 | JGI25163J39215_10005377 | 248 |
| 101 | 3300002772 | JGI25164J39214_1000132 | JGI25164J39214_100013243 | 248 |
| 102 | 3300002772 | JGI25164J39214_1000265 | JGI25164J39214_100026518 | 248 |
| 103 | 3300002772 | JGI25164J39214_1000665 | JGI25164J39214_10006655 | 248 |
| 104 | 3300003214 | JGI25165J46597_1000242 | JGI25165J46597_100024245 | 248 |
| 105 | 3300003214 | JGI25165J46597_1000828 | JGI25165J46597_100082818 | 248 |
| 106 | 3300003214 | JGI25165J46597_1002100 | JGI25165J46597_10021007 | 248 |
| 107 | 3300003215 | JGI25153J46596_10012497 | JGI25153J46596_100124973 | 248 |
| 108 | 3300003320 | rootH2_10086143 | rootH2_100861432 | 248 |
| 109 | 3300003320 | rootH2_10142418 | rootH2_101424181 | 248 |
| 110 | 3300003322 | rootL2_10137420 | rootL2_101374203 | 248 |
| 111 | 3300003578 | Ga0006562J51391_1074911 | Ga0006562J51391_10749113 | 248 |
| 112 | 3300003578 | Ga0006562J51391_1074912 | Ga0006562J51391_107491211 | 248 |
| 113 | 3300003751 | Ga0055538_1004343 | Ga0055538_10043432 | 248 |
| 114 | 3300003752 | Ga0055539_1002899 | Ga0055539_10028993 | 248 |
| 115 | 3300003752 | Ga0055539_1010088 | Ga0055539_10100882 | 248 |
| 116 | 3300003756 | Ga0055533_1001034 | Ga0055533_10010346 | 248 |
| 117 | 3300003756 | Ga0055533_1002026 | Ga0055533_10020267 | 248 |
| 118 | 3300003756 | Ga0055533_1011226 | Ga0055533_10112261 | 248 |
| 119 | 3300003759 | Ga0055525_1000152 | Ga0055525_100015257 | 248 |
| 120 | 3300003760 | Ga0055527_1000059 | Ga0055527_100005956 | 248 |
| 121 | 3300003760 | Ga0055527_1000452 | Ga0055527_10004521 | 248 |
| 122 | 3300003761 | Ga0055535_1000207 | Ga0055535_100020718 | 248 |
| 123 | 3300003761 | Ga0055535_1000232 | Ga0055535_100023219 | 248 |
| 124 | 3300003761 | Ga0055535_1000511 | Ga0055535_100051118 | 248 |
| 125 | 3300003761 | Ga0055535_1001120 | Ga0055535_10011209 | 248 |
| 126 | 3300003761 | Ga0055535_1001270 | Ga0055535_10012705 | 248 |
| 127 | 3300003761 | Ga0055535_1012508 | Ga0055535_10125082 | 248 |
| 128 | 3300003762 | Ga0055542_1000137 | Ga0055542_100013756 | 248 |
| 129 | 3300003762 | Ga0055542_1000207 | Ga0055542_100020745 | 248 |
| 130 | 3300003762 | Ga0055542_1000239 | Ga0055542_100023931 | 248 |
| 131 | 3300003762 | Ga0055542_1000417 | Ga0055542_100041719 | 248 |
| 132 | 3300003762 | Ga0055542_1001106 | Ga0055542_10011061 | 248 |
| 133 | 3300003763 | Ga0055529_1000225 | Ga0055529_100022520 | 248 |
| 134 | 3300003763 | Ga0055529_1000909 | Ga0055529_10009091 | 248 |
| 135 | 3300003763 | Ga0055529_1001010 | Ga0055529_10010102 | 248 |
| 136 | 3300003763 | Ga0055529_1014227 | Ga0055529_10142271 | 248 |
| 137 | 3300005262 | Ga0065165_1001811 | Ga0065165_100181116 | 248 |
| 138 | 3300005334 | Ga0068869_100007763 | Ga0068869_1000077634 | 248 |
| 139 | 3300005336 | Ga0070680_100326419 | Ga0070680_1003264192 | 248 |
| 140 | 3300005337 | Ga0070682_100005615 | Ga0070682_1000056153 | 248 |
| 141 | 3300005337 | Ga0070682_100042169 | Ga0070682_1000421692 | 248 |
| 142 | 3300005337 | Ga0070682_100068361 | Ga0070682_1000683612 | 248 |
| 143 | 3300005338 | Ga0068868_100108528 | Ga0068868_1001085282 | 248 |
| 144 | 3300005339 | Ga0070660_100077922 | Ga0070660_1000779221 | 248 |
| 145 | 3300005339 | Ga0070660_100177521 | Ga0070660_1001775212 | 248 |
| 146 | 3300005340 | Ga0070689_100011511 | Ga0070689_1000115115 | 248 |
| 147 | 3300005344 | Ga0070661_100070421 | Ga0070661_1000704212 | 248 |
| 148 | 3300005344 | Ga0070661_100259887 | Ga0070661_1002598871 | 248 |
| 149 | 3300005344 | Ga0070661_100265384 | Ga0070661_1002653842 | 248 |
| 150 | 3300005345 | Ga0070692_10020881 | Ga0070692_100208814 | 248 |
| 151 | 3300005347 | Ga0070668_100013123 | Ga0070668_1000131235 | 248 |
| 152 | 3300005354 | Ga0070675_100019450 | Ga0070675_1000194506 | 248 |
| 153 | 3300005364 | Ga0070673_100107236 | Ga0070673_1001072362 | 248 |
| 154 | 3300005365 | Ga0070688_100014451 | Ga0070688_1000144511 | 248 |
| 155 | 3300005365 | Ga0070688_100116090 | Ga0070688_1001160902 | 248 |
| 156 | 3300005366 | Ga0070659_100009262 | Ga0070659_1000092626 | 248 |
| 157 | 3300005366 | Ga0070659_100014534 | Ga0070659_1000145346 | 248 |
| 158 | 3300005366 | Ga0070659_100071500 | Ga0070659_1000715002 | 248 |
| 159 | 3300005367 | Ga0070667_100032514 | Ga0070667_1000325145 | 248 |
| 160 | 3300005367 | Ga0070667_100278592 | Ga0070667_1002785921 | 248 |
| 161 | 3300005435 | Ga0070714_100030666 | Ga0070714_1000306663 | 248 |
| 162 | 3300005436 | Ga0070713_100003472 | Ga0070713_1000034723 | 248 |
| 163 | 3300005444 | Ga0070694_100115566 | Ga0070694_1001155662 | 248 |
| 164 | 3300005455 | Ga0070663_100044233 | Ga0070663_1000442332 | 248 |
| 165 | 3300005455 | Ga0070663_100107391 | Ga0070663_1001073912 | 248 |
| 166 | 3300005455 | Ga0070663_100219202 | Ga0070663_1002192022 | 248 |
| 167 | 3300005456 | Ga0070678_100008384 | Ga0070678_1000083848 | 248 |
| 168 | 3300005457 | Ga0070662_100054768 | Ga0070662_1000547682 | 248 |
| 169 | 3300005458 | Ga0070681_10003497 | Ga0070681_1000349710 | 248 |
| 170 | 3300005458 | Ga0070681_10116968 | Ga0070681_101169683 | 248 |
| 171 | 3300005458 | Ga0070681_10917353 | Ga0070681_109173531 | 248 |
| 172 | 3300005459 | Ga0068867_100010992 | Ga0068867_1000109924 | 248 |
| 173 | 3300005466 | Ga0070685_10009310 | Ga0070685_100093107 | 248 |
| 174 | 3300005530 | Ga0070679_100071824 | Ga0070679_1000718242 | 248 |
| 175 | 3300005539 | Ga0068853_100019439 | Ga0068853_1000194392 | 248 |
| 176 | 3300005539 | Ga0068853_100255467 | Ga0068853_1002554672 | 248 |
| 177 | 3300005543 | Ga0070672_100018395 | Ga0070672_1000183954 | 248 |
| 178 | 3300005546 | Ga0070696_100009794 | Ga0070696_1000097943 | 248 |
| 179 | 3300005546 | Ga0070696_100060683 | Ga0070696_1000606832 | 248 |
| 180 | 3300005546 | Ga0070696_100318545 | Ga0070696_1003185451 | 248 |
| 181 | 3300005547 | Ga0070693_100009002 | Ga0070693_1000090023 | 248 |
| 182 | 3300005548 | Ga0070665_100279080 | Ga0070665_1002790802 | 248 |
| 183 | 3300005563 | Ga0068855_100003107 | Ga0068855_10000310711 | 248 |
| 184 | 3300005563 | Ga0068855_100027990 | Ga0068855_1000279905 | 248 |
| 185 | 3300005563 | Ga0068855_100061053 | Ga0068855_1000610536 | 248 |
| 186 | 3300005577 | Ga0068857_100000582 | Ga0068857_10000058212 | 248 |
| 187 | 3300005577 | Ga0068857_100072494 | Ga0068857_1000724943 | 248 |
| 188 | 3300005577 | Ga0068857_100077446 | Ga0068857_1000774461 | 248 |
| 189 | 3300005577 | Ga0068857_100080611 | Ga0068857_1000806112 | 248 |
| 190 | 3300005577 | Ga0068857_100154037 | Ga0068857_1001540373 | 248 |
| 191 | 3300005577 | Ga0068857_100308452 | Ga0068857_1003084522 | 248 |
| 192 | 3300005578 | Ga0068854_100000823 | Ga0068854_1000008235 | 248 |
| 193 | 3300005578 | Ga0068854_100015025 | Ga0068854_1000150255 | 248 |
| 194 | 3300005578 | Ga0068854_100060365 | Ga0068854_1000603652 | 248 |
| 195 | 3300005614 | Ga0068856_100001041 | Ga0068856_10000104112 | 248 |
| 196 | 3300005614 | Ga0068856_100004908 | Ga0068856_1000049087 | 248 |
| 197 | 3300005614 | Ga0068856_100045402 | Ga0068856_1000454023 | 248 |
| 198 | 3300005614 | Ga0068856_100767128 | Ga0068856_1007671282 | 248 |
| 199 | 3300005616 | Ga0068852_100733441 | Ga0068852_1007334411 | 248 |
| 200 | 3300005617 | Ga0068859_100056245 | Ga0068859_1000562456 | 248 |
| 201 | 3300005719 | Ga0068861_100037616 | Ga0068861_1000376164 | 248 |
| 202 | 3300005840 | Ga0068870_10058983 | Ga0068870_100589832 | 248 |
| 203 | 3300005841 | Ga0068863_100385756 | Ga0068863_1003857562 | 248 |
| 204 | 3300005842 | Ga0068858_100577313 | Ga0068858_1005773131 | 248 |
| 205 | 3300005843 | Ga0068860_100011841 | Ga0068860_1000118414 | 248 |
| 206 | 3300005843 | Ga0068860_100125921 | Ga0068860_1001259212 | 248 |
| 207 | 3300006237 | Ga0097621_100037576 | Ga0097621_1000375766 | 248 |
| 208 | 3300006358 | Ga0068871_100260384 | Ga0068871_1002603842 | 248 |
| 209 | 3300006881 | Ga0068865_100041015 | Ga0068865_1000410152 | 248 |
| 210 | 3300006931 | Ga0097620_100056245 | Ga0097620_1000562452 | 248 |
| 211 | 3300009093 | Ga0105240_10003120 | Ga0105240_100031207 | 248 |
| 212 | 3300009093 | Ga0105240_10004144 | Ga0105240_100041446 | 248 |
| 213 | 3300009093 | Ga0105240_10021623 | Ga0105240_100216236 | 248 |
| 214 | 3300009093 | Ga0105240_10082857 | Ga0105240_100828575 | 248 |
| 215 | 3300009093 | Ga0105240_10268428 | Ga0105240_102684282 | 248 |
| 216 | 3300009098 | Ga0105245_10162716 | Ga0105245_101627162 | 248 |
| 217 | 3300009098 | Ga0105245_10326348 | Ga0105245_103263482 | 248 |
| 218 | 3300009545 | Ga0105237_10000036 | Ga0105237_1000003632 | 248 |
| 219 | 3300009551 | Ga0105238_10017198 | Ga0105238_100171988 | 248 |
| 220 | 3300009551 | Ga0105238_10021100 | Ga0105238_100211005 | 248 |
| 221 | 3300009551 | Ga0105238_10026616 | Ga0105238_100266163 | 248 |
| 222 | 3300009551 | Ga0105238_10058108 | Ga0105238_100581082 | 248 |
| 223 | 3300009551 | Ga0105238_10209813 | Ga0105238_102098132 | 248 |
| 224 | 3300009551 | Ga0105238_10566677 | Ga0105238_105666772 | 248 |
| 225 | 3300009553 | Ga0105249_10078210 | Ga0105249_100782103 | 248 |
| 226 | 3300010375 | Ga0105239_10000480 | Ga0105239_1000048021 | 248 |
| 227 | 3300010375 | Ga0105239_10018925 | Ga0105239_100189252 | 248 |
| 228 | 3300010375 | Ga0105239_10163076 | Ga0105239_101630762 | 248 |
| 229 | 3300010375 | Ga0105239_10224846 | Ga0105239_102248462 | 248 |
| 230 | 3300011119 | Ga0105246_10012639 | Ga0105246_100126393 | 248 |
| 231 | 3300012500 | Ga0157314_1000030 | Ga0157314_100003011 | 248 |
| 232 | 3300013100 | Ga0157373_10023309 | Ga0157373_100233095 | 248 |
| 233 | 3300013100 | Ga0157373_10034475 | Ga0157373_100344754 | 248 |
| 234 | 3300013100 | Ga0157373_10050254 | Ga0157373_100502542 | 248 |
| 235 | 3300013102 | Ga0157371_10008217 | Ga0157371_100082173 | 248 |
| 236 | 3300013102 | Ga0157371_10365529 | Ga0157371_103655291 | 248 |
| 237 | 3300013104 | Ga0157370_10002180 | Ga0157370_1000218016 | 248 |
| 238 | 3300013104 | Ga0157370_10093126 | Ga0157370_100931263 | 248 |
| 239 | 3300013104 | Ga0157370_10104839 | Ga0157370_101048392 | 248 |
| 240 | 3300013105 | Ga0157369_10004089 | Ga0157369_100040896 | 248 |
| 241 | 3300013105 | Ga0157369_10162008 | Ga0157369_101620082 | 248 |
| 242 | 3300013105 | Ga0157369_10166672 | Ga0157369_101666723 | 248 |
| 243 | 3300013297 | Ga0157378_10000215 | Ga0157378_1000021521 | 248 |
| 244 | 3300013306 | Ga0163162_10178019 | Ga0163162_101780191 | 248 |
| 245 | 3300013306 | Ga0163162_10506712 | Ga0163162_105067122 | 248 |
| 246 | 3300013307 | Ga0157372_10027601 | Ga0157372_100276016 | 248 |
| 247 | 3300014497 | Ga0182008_10036947 | Ga0182008_100369473 | 248 |
| 248 | 3300014497 | Ga0182008_10080605 | Ga0182008_100806052 | 248 |
| 249 | 3300014968 | Ga0157379_10004627 | Ga0157379_100046273 | 248 |
| 250 | 3300015262 | Ga0182007_10003520 | Ga0182007_100035204 | 248 |
| 251 | 3300015262 | Ga0182007_10033807 | Ga0182007_100338072 | 248 |
| 252 | 3300015685 | Ga0183369_1004 | Ga0183369_1004250 | 248 |
| 253 | 3300015687 | Ga0183368_1002 | Ga0183368_10021064 | 248 |
| 254 | 3300016635 | Ga0183361_12171 | Ga0183361_121711 | 248 |
| 255 | 3300020070 | Ga0206356_10173653 | Ga0206356_101736532 | 248 |
| 256 | 3300020082 | Ga0206353_11202800 | Ga0206353_112028003 | 248 |
| 257 | 3300025206 | Ga0209435_103044 | Ga0209435_1030442 | 248 |
| 258 | 3300025206 | Ga0209435_103569 | Ga0209435_1035692 | 248 |
| 259 | 3300025207 | Ga0209760_100687 | Ga0209760_1006873 | 248 |
| 260 | 3300025224 | Ga0209784_100131 | Ga0209784_10013119 | 248 |
| 261 | 3300025226 | Ga0209674_100014 | Ga0209674_100014395 | 248 |
| 262 | 3300025226 | Ga0209674_100058 | Ga0209674_100058158 | 248 |
| 263 | 3300025226 | Ga0209674_100657 | Ga0209674_1006578 | 248 |
| 264 | 3300025226 | Ga0209674_101021 | Ga0209674_1010215 | 248 |
| 265 | 3300025228 | Ga0209672_100043 | Ga0209672_10004377 | 248 |
| 266 | 3300025228 | Ga0209672_100061 | Ga0209672_100061158 | 248 |
| 267 | 3300025228 | Ga0209672_100250 | Ga0209672_10025019 | 248 |
| 268 | 3300025228 | Ga0209672_101112 | Ga0209672_1011123 | 248 |
| 269 | 3300025228 | Ga0209672_104065 | Ga0209672_1040652 | 248 |
| 270 | 3300025230 | Ga0209563_100062 | Ga0209563_10006268 | 248 |
| 271 | 3300025231 | Ga0207427_100161 | Ga0207427_10016119 | 248 |
| 272 | 3300025231 | Ga0207427_100194 | Ga0207427_10019414 | 248 |
| 273 | 3300025231 | Ga0207427_100226 | Ga0207427_10022621 | 248 |
| 274 | 3300025233 | Ga0209437_100116 | Ga0209437_100116173 | 248 |
| 275 | 3300025233 | Ga0209437_100121 | Ga0209437_100121153 | 248 |
| 276 | 3300025233 | Ga0209437_100257 | Ga0209437_10025746 | 248 |
| 277 | 3300025233 | Ga0209437_100464 | Ga0209437_10046420 | 248 |
| 278 | 3300025242 | Ga0209258_100054 | Ga0209258_100054158 | 248 |
| 279 | 3300025242 | Ga0209258_100076 | Ga0209258_10007677 | 248 |
| 280 | 3300025242 | Ga0209258_100092 | Ga0209258_10009252 | 248 |
| 281 | 3300025242 | Ga0209258_100104 | Ga0209258_10010431 | 248 |
| 282 | 3300025242 | Ga0209258_100715 | Ga0209258_10071510 | 248 |
| 283 | 3300025246 | Ga0209646_1000254 | Ga0209646_100025418 | 248 |
| 284 | 3300025246 | Ga0209646_1012888 | Ga0209646_10128882 | 248 |
| 285 | 3300025250 | Ga0209026_1000143 | Ga0209026_1000143105 | 248 |
| 286 | 3300025250 | Ga0209026_1000230 | Ga0209026_100023020 | 248 |
| 287 | 3300025250 | Ga0209026_1000277 | Ga0209026_100027728 | 248 |
| 288 | 3300025250 | Ga0209026_1003690 | Ga0209026_10036903 | 248 |
| 289 | 3300025253 | Ga0209677_103617 | Ga0209677_1036174 | 248 |
| 290 | 3300025253 | Ga0209677_106391 | Ga0209677_1063914 | 248 |
| 291 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002579 | 248 |
| 292 | 3300025254 | Ga0209148_1000047 | Ga0209148_1000047249 | 248 |
| 293 | 3300025254 | Ga0209148_1000066 | Ga0209148_1000066158 | 248 |
| 294 | 3300025254 | Ga0209148_1000082 | Ga0209148_100008277 | 248 |
| 295 | 3300025254 | Ga0209148_1000106 | Ga0209148_100010632 | 248 |
| 296 | 3300025256 | Ga0209759_1000308 | Ga0209759_100030850 | 248 |
| 297 | 3300025256 | Ga0209759_1001242 | Ga0209759_10012426 | 248 |
| 298 | 3300025256 | Ga0209759_1009720 | Ga0209759_10097204 | 248 |
| 299 | 3300025256 | Ga0209759_1015953 | Ga0209759_10159533 | 248 |
| 300 | 3300025258 | Ga0209129_1005400 | Ga0209129_10054002 | 248 |
| 301 | 3300025261 | Ga0209233_1000100 | Ga0209233_100010021 | 248 |
| 302 | 3300025261 | Ga0209233_1000112 | Ga0209233_1000112157 | 248 |
| 303 | 3300025261 | Ga0209233_1000114 | Ga0209233_100011411 | 248 |
| 304 | 3300025261 | Ga0209233_1001902 | Ga0209233_10019024 | 248 |
| 305 | 3300025261 | Ga0209233_1018495 | Ga0209233_10184952 | 248 |
| 306 | 3300025272 | Ga0209455_1000056 | Ga0209455_1000056173 | 248 |
| 307 | 3300025272 | Ga0209455_1000078 | Ga0209455_100007877 | 248 |
| 308 | 3300025272 | Ga0209455_1000101 | Ga0209455_1000101158 | 248 |
| 309 | 3300025272 | Ga0209455_1000789 | Ga0209455_10007896 | 248 |
| 310 | 3300025272 | Ga0209455_1005056 | Ga0209455_10050565 | 248 |
| 311 | 3300025297 | Ga0209758_1000491 | Ga0209758_100049141 | 248 |
| 312 | 3300025904 | Ga0207647_10001129 | Ga0207647_100011299 | 248 |
| 313 | 3300025904 | Ga0207647_10011422 | Ga0207647_100114222 | 248 |
| 314 | 3300025907 | Ga0207645_10230947 | Ga0207645_102309471 | 248 |
| 315 | 3300025908 | Ga0207643_10066663 | Ga0207643_100666632 | 248 |
| 316 | 3300025911 | Ga0207654_10373621 | Ga0207654_103736211 | 248 |
| 317 | 3300025912 | Ga0207707_10019591 | Ga0207707_100195915 | 248 |
| 318 | 3300025912 | Ga0207707_10022271 | Ga0207707_100222713 | 248 |
| 319 | 3300025913 | Ga0207695_10001444 | Ga0207695_100014445 | 248 |
| 320 | 3300025913 | Ga0207695_10001553 | Ga0207695_1000155321 | 248 |
| 321 | 3300025913 | Ga0207695_10002198 | Ga0207695_1000219814 | 248 |
| 322 | 3300025913 | Ga0207695_10002664 | Ga0207695_100026646 | 248 |
| 323 | 3300025913 | Ga0207695_10010679 | Ga0207695_100106795 | 248 |
| 324 | 3300025914 | Ga0207671_10000009 | Ga0207671_10000009585 | 248 |
| 325 | 3300025914 | Ga0207671_10000135 | Ga0207671_1000013523 | 248 |
| 326 | 3300025914 | Ga0207671_10054425 | Ga0207671_100544254 | 248 |
| 327 | 3300025917 | Ga0207660_10218865 | Ga0207660_102188652 | 248 |
| 328 | 3300025919 | Ga0207657_10104289 | Ga0207657_101042892 | 248 |
| 329 | 3300025919 | Ga0207657_10582194 | Ga0207657_105821941 | 248 |
| 330 | 3300025920 | Ga0207649_10101837 | Ga0207649_101018372 | 248 |
| 331 | 3300025920 | Ga0207649_10430847 | Ga0207649_104308472 | 248 |
| 332 | 3300025921 | Ga0207652_10052676 | Ga0207652_100526762 | 248 |
| 333 | 3300025923 | Ga0207681_10015700 | Ga0207681_100157002 | 248 |
| 334 | 3300025924 | Ga0207694_10024283 | Ga0207694_100242833 | 248 |
| 335 | 3300025924 | Ga0207694_10045581 | Ga0207694_100455812 | 248 |
| 336 | 3300025924 | Ga0207694_10090581 | Ga0207694_100905812 | 248 |
| 337 | 3300025924 | Ga0207694_10091757 | Ga0207694_100917572 | 248 |
| 338 | 3300025926 | Ga0207659_10009867 | Ga0207659_100098674 | 248 |
| 339 | 3300025927 | Ga0207687_10102928 | Ga0207687_101029282 | 248 |
| 340 | 3300025928 | Ga0207700_10001377 | Ga0207700_100013779 | 248 |
| 341 | 3300025929 | Ga0207664_10009261 | Ga0207664_100092613 | 248 |
| 342 | 3300025932 | Ga0207690_10014652 | Ga0207690_100146522 | 248 |
| 343 | 3300025932 | Ga0207690_10017061 | Ga0207690_100170613 | 248 |
| 344 | 3300025932 | Ga0207690_10040916 | Ga0207690_100409162 | 248 |
| 345 | 3300025932 | Ga0207690_10482901 | Ga0207690_104829011 | 248 |
| 346 | 3300025932 | Ga0207690_10540643 | Ga0207690_105406432 | 248 |
| 347 | 3300025933 | Ga0207706_10014779 | Ga0207706_100147792 | 248 |
| 348 | 3300025936 | Ga0207670_10005876 | Ga0207670_100058762 | 248 |
| 349 | 3300025938 | Ga0207704_10023577 | Ga0207704_100235772 | 248 |
| 350 | 3300025940 | Ga0207691_10017492 | Ga0207691_100174926 | 248 |
| 351 | 3300025942 | Ga0207689_10017888 | Ga0207689_100178886 | 248 |
| 352 | 3300025949 | Ga0207667_10000193 | Ga0207667_1000019332 | 248 |
| 353 | 3300025949 | Ga0207667_10000244 | Ga0207667_1000024438 | 248 |
| 354 | 3300025949 | Ga0207667_10067422 | Ga0207667_100674223 | 248 |
| 355 | 3300025949 | Ga0207667_10098492 | Ga0207667_100984924 | 248 |
| 356 | 3300025960 | Ga0207651_10253855 | Ga0207651_102538552 | 248 |
| 357 | 3300025961 | Ga0207712_10046150 | Ga0207712_100461503 | 248 |
| 358 | 3300025972 | Ga0207668_10021092 | Ga0207668_100210924 | 248 |
| 359 | 3300025981 | Ga0207640_10000169 | Ga0207640_1000016936 | 248 |
| 360 | 3300025981 | Ga0207640_10000189 | Ga0207640_1000018934 | 248 |
| 361 | 3300025981 | Ga0207640_10047902 | Ga0207640_100479022 | 248 |
| 362 | 3300025981 | Ga0207640_10078339 | Ga0207640_100783393 | 248 |
| 363 | 3300025986 | Ga0207658_10216591 | Ga0207658_102165912 | 248 |
| 364 | 3300025986 | Ga0207658_10258818 | Ga0207658_102588182 | 248 |
| 365 | 3300025986 | Ga0207658_10505003 | Ga0207658_105050032 | 248 |
| 366 | 3300026023 | Ga0207677_10052268 | Ga0207677_100522682 | 248 |
| 367 | 3300026035 | Ga0207703_10406250 | Ga0207703_104062502 | 248 |
| 368 | 3300026041 | Ga0207639_10032144 | Ga0207639_100321444 | 248 |
| 369 | 3300026041 | Ga0207639_10275805 | Ga0207639_102758052 | 248 |
| 370 | 3300026067 | Ga0207678_10025885 | Ga0207678_100258856 | 248 |
| 371 | 3300026067 | Ga0207678_10158690 | Ga0207678_101586902 | 248 |
| 372 | 3300026067 | Ga0207678_10227963 | Ga0207678_102279632 | 248 |
| 373 | 3300026078 | Ga0207702_10000037 | Ga0207702_1000003721 | 248 |
| 374 | 3300026078 | Ga0207702_10000230 | Ga0207702_1000023024 | 248 |
| 375 | 3300026078 | Ga0207702_10011445 | Ga0207702_100114453 | 248 |
| 376 | 3300026078 | Ga0207702_10331537 | Ga0207702_103315372 | 248 |
| 377 | 3300026088 | Ga0207641_10591455 | Ga0207641_105914551 | 248 |
| 378 | 3300026089 | Ga0207648_10019556 | Ga0207648_100195564 | 248 |
| 379 | 3300026095 | Ga0207676_10033753 | Ga0207676_100337532 | 248 |
| 380 | 3300026116 | Ga0207674_10000401 | Ga0207674_1000040118 | 248 |
| 381 | 3300026116 | Ga0207674_10072075 | Ga0207674_100720753 | 248 |
| 382 | 3300026116 | Ga0207674_10158108 | Ga0207674_101581082 | 248 |
| 383 | 3300026118 | Ga0207675_100133265 | Ga0207675_1001332652 | 248 |
| 384 | 3300026142 | Ga0207698_10271956 | Ga0207698_102719561 | 248 |
| 385 | 3300028379 | Ga0268266_10417202 | Ga0268266_104172022 | 248 |
| 386 | 3300028380 | Ga0268265_10181486 | Ga0268265_101814862 | 248 |
| 387 | 3300028380 | Ga0268265_10415500 | Ga0268265_104155001 | 248 |
| 388 | 3300028381 | Ga0268264_10018660 | Ga0268264_100186602 | 248 |
| 389 | 3300028381 | Ga0268264_10095513 | Ga0268264_100955133 | 248 |
| 390 | 3300031507 | Ga0307509_10336154 | Ga0307509_103361542 | 248 |
| 391 | 3300037312 | Ga0395899_0000215 | Ga0395899_0000215_60844_61656 | 248 |
| 392 | 3300037312 | Ga0395899_0001471 | Ga0395899_0001471_12108_12857 | 248 |
| 393 | 3300037312 | Ga0395899_0018330 | Ga0395899_0018330_3425_4171 | 248 |
| 394 | 3300037418 | Ga0395900_0001714 | Ga0395900_0001714_15080_15826 | 248 |
| 395 | 3300037418 | Ga0395900_0003030 | Ga0395900_0003030_12485_13231 | 248 |
| 396 | 3300037466 | Ga0395898_0000120 | Ga0395898_0000120_21248_22060 | 248 |
| 397 | 3300037466 | Ga0395898_0000411 | Ga0395898_0000411_65325_66074 | 248 |
| 398 | 3300037466 | Ga0395898_0013222 | Ga0395898_0013222_236_982 | 248 |
| 399 | 3300037466 | Ga0395898_0078346 | Ga0395898_0078346_1060_1806 | 248 |
| 400 | 3300037466 | Ga0395898_0080786 | Ga0395898_0080786_43_789 | 248 |
| 401 | 3300037471 | Ga0395905_0196425 | Ga0395905_0196425_713_1459 | 248 |
| 402 | 3300037471 | Ga0395905_0366372 | Ga0395905_0366372_437_1183 | 248 |
| 403 | 3300038443 | Ga0395901_0000413 | Ga0395901_0000413_41801_42547 | 248 |
| 404 | 3300038443 | Ga0395901_0022980 | Ga0395901_0022980_822_1568 | 248 |
| 405 | 3300038443 | Ga0395901_0088231 | Ga0395901_0088231_1361_2107 | 248 |
| 406 | 3300038443 | Ga0395901_0152233 | Ga0395901_0152233_574_1320 | 248 |
| 407 | 3300038443 | Ga0395901_0155772 | Ga0395901_0155772_182_928 | 248 |
| 408 | 3300041452 | Ga0451793_0489457 | Ga0451793_0489457_897_1643 | 248 |
| 409 | 3300042005 | Ga0439448_0139168 | Ga0439448_0139168_75_821 | 248 |
| 410 | 3300042438 | Ga0439459_0006821 | Ga0439459_0006821_530_1276 | 248 |
| 411 | 3300044656 | Ga0466969_0021366 | Ga0466969_0021366_505_1251 | 248 |
| 412 | 3300044656 | Ga0466969_0101529 | Ga0466969_0101529_103_864 | 248 |
| 413 | 3300044658 | Ga0466972_0122583 | Ga0466972_0122583_328_1074 | 248 |
| 414 | 3300044661 | Ga0466975_0029559 | Ga0466975_0029559_2124_2870 | 248 |
| 415 | 3300044672 | Ga0466982_0000001 | Ga0466982_0000001_241996_242742 | 248 |
| 416 | 3300044683 | Ga0466965_0361261 | Ga0466965_0361261_39_785 | 248 |
| 417 | 3300044684 | Ga0466966_0012350 | Ga0466966_0012350_3960_4706 | 248 |
| 418 | 3300044684 | Ga0466966_0225300 | Ga0466966_0225300_356_1102 | 248 |
| 419 | 3300044684 | Ga0466966_0225301 | Ga0466966_0225301_356_1102 | 248 |
| 420 | 3300044693 | Ga0466961_0000719 | Ga0466961_0000719_8817_9578 | 248 |
| 421 | 3300044693 | Ga0466961_0005754 | Ga0466961_0005754_282_1031 | 248 |
| 422 | 3300044693 | Ga0466961_0019639 | Ga0466961_0019639_2969_3715 | 248 |
| 423 | 3300044706 | Ga0466964_0020308 | Ga0466964_0020308_65_811 | 248 |
| 424 | 3300044719 | Ga0466971_0101572 | Ga0466971_0101572_396_1142 | 248 |
| 425 | 3300044735 | Ga0466968_0004523 | Ga0466968_0004523_1207_1953 | 248 |
| 426 | 3300044765 | Ga0466970_0013509 | Ga0466970_0013509_1618_2379 | 248 |
| 427 | 3300044842 | Ga0466957_0001903 | Ga0466957_0001903_2360_3121 | 248 |
| 428 | 3300044842 | Ga0466957_0068963 | Ga0466957_0068963_1035_1781 | 248 |
| 429 | 3300045049 | Ga0466959_0016259 | Ga0466959_0016259_4072_4833 | 248 |
| 430 | 3300045836 | Ga0466958_0038587 | Ga0466958_0038587_904_1653 | 248 |
| 431 | 3300045836 | Ga0466958_0042424 | Ga0466958_0042424_1190_1936 | 248 |
| 432 | 3300045976 | Ga0466967_0107834 | Ga0466967_0107834_1007_1753 | 248 |
| 433 | 3300045976 | Ga0466967_0123024 | Ga0466967_0123024_756_1505 | 248 |
| 434 | 3300046460 | Ga0495638_0000339 | Ga0495638_0000339_17533_18279 | 248 |
| 435 | 3300046460 | Ga0495638_0001037 | Ga0495638_0001037_25926_26702 | 248 |
| 436 | 3300046460 | Ga0495638_0011413 | Ga0495638_0011413_1679_2425 | 248 |
| 437 | 3300046471 | Ga0495650_0000064 | Ga0495650_0000064_258248_258994 | 248 |
| 438 | 3300046507 | Ga0495606_0000368 | Ga0495606_0000368_61119_61865 | 248 |
| 439 | 3300046557 | Ga0495622_0007604 | Ga0495622_0007604_2167_2913 | 248 |
| 440 | 3300046660 | Ga0495625_0022965 | Ga0495625_0022965_1091_1837 | 248 |
| 441 | 3300046660 | Ga0495625_0207015 | Ga0495625_0207015_177_923 | 248 |
| 442 | 3300046694 | Ga0495649_0037392 | Ga0495649_0037392_631_1377 | 248 |
| 443 | 3300048903 | Ga0496100_0043702 | Ga0496100_0043702_1946_2692 | 248 |
| 444 | 3300048904 | Ga0496101_0037544 | Ga0496101_0037544_308_1054 | 248 |
| 445 | 3300048907 | Ga0496104_0076731 | Ga0496104_0076731_1952_2698 | 248 |
| 446 | 3300048908 | Ga0496105_0001219 | Ga0496105_0001219_4697_5443 | 248 |
| 447 | 3300048910 | Ga0496107_0065801 | Ga0496107_0065801_269_1015 | 248 |
| 448 | 3300048916 | Ga0496113_0022662 | Ga0496113_0022662_3231_3977 | 248 |
| 449 | 3300048916 | Ga0496113_0187457 | Ga0496113_0187457_405_1151 | 248 |
| 450 | 3300048917 | Ga0496114_0104236 | Ga0496114_0104236_914_1660 | 248 |
| 451 | 3300048918 | Ga0496115_0000283 | Ga0496115_0000283_13236_13982 | 248 |
| 452 | 3300048918 | Ga0496115_0001095 | Ga0496115_0001095_15360_16106 | 248 |
| 453 | 3300048918 | Ga0496115_0004542 | Ga0496115_0004542_7563_8309 | 248 |
| 454 | 3300048918 | Ga0496115_0178381 | Ga0496115_0178381_433_1179 | 248 |
| 455 | 3300048919 | Ga0496116_0087751 | Ga0496116_0087751_137_883 | 248 |
| 456 | 3300048920 | Ga0496117_0026162 | Ga0496117_0026162_2651_3397 | 248 |
| 457 | 3300048920 | Ga0496117_0082787 | Ga0496117_0082787_1182_1928 | 248 |
| 458 | 3300048921 | Ga0496118_0000182 | Ga0496118_0000182_34143_34889 | 248 |
| 459 | 3300048921 | Ga0496118_0002818 | Ga0496118_0002818_3545_4291 | 248 |
| 460 | 3300048921 | Ga0496118_0005399 | Ga0496118_0005399_10186_10932 | 248 |
| 461 | 3300048922 | Ga0496119_0000748 | Ga0496119_0000748_30208_30954 | 248 |
| 462 | 3300048922 | Ga0496119_0009539 | Ga0496119_0009539_4488_5234 | 248 |
| 463 | 3300048923 | Ga0496120_0000013 | Ga0496120_0000013_12547_13293 | 248 |
| 464 | 3300048923 | Ga0496120_0001574 | Ga0496120_0001574_4523_5269 | 248 |
| 465 | 3300048924 | Ga0496121_0000531 | Ga0496121_0000531_49350_50096 | 248 |
| 466 | 3300048924 | Ga0496121_0024261 | Ga0496121_0024261_205_951 | 248 |
| 467 | 3300048924 | Ga0496121_0035584 | Ga0496121_0035584_2264_3010 | 248 |
| 468 | 3300048924 | Ga0496121_0088996 | Ga0496121_0088996_884_1630 | 248 |
| 469 | 3300048924 | Ga0496121_0114221 | Ga0496121_0114221_1193_1939 | 248 |
| 470 | 3300048928 | Ga0496125_0000647 | Ga0496125_0000647_50376_51122 | 248 |
| 471 | 3300048929 | Ga0496126_0001015 | Ga0496126_0001015_18464_19210 | 248 |
| 472 | 3300048929 | Ga0496126_0016981 | Ga0496126_0016981_3058_3804 | 248 |
| 473 | 3300048929 | Ga0496126_0042076 | Ga0496126_0042076_918_1664 | 248 |
| 474 | 3300048929 | Ga0496126_0122427 | Ga0496126_0122427_483_1229 | 248 |
| 475 | 3300049459 | Ga0495678_021921 | Ga0495678_021921_1234_1980 | 248 |
| 476 | 3300049459 | Ga0495678_063227 | Ga0495678_063227_494_1240 | 248 |
| 477 | 3300049569 | Ga0501032_0083636 | Ga0501032_0083636_65_811 | 248 |
| 478 | 3300049569 | Ga0501032_0292113 | Ga0501032_0292113_28_774 | 248 |
| 479 | 3300049570 | Ga0501033_0000339 | Ga0501033_0000339_172_918 | 248 |
| 480 | 3300049572 | Ga0501036_0498481 | Ga0501036_0498481_139_885 | 248 |
| 481 | 3300049574 | Ga0501038_0384349 | Ga0501038_0384349_257_1003 | 248 |
| 482 | 3300049575 | Ga0501039_0040266 | Ga0501039_0040266_2641_3387 | 248 |
| 483 | 3300049579 | Ga0501043_0094814 | Ga0501043_0094814_1316_2062 | 248 |
| 484 | 3300049579 | Ga0501043_0135211 | Ga0501043_0135211_64_810 | 248 |
| 485 | 3300049579 | Ga0501043_0189186 | Ga0501043_0189186_433_1179 | 248 |
| 486 | 3300049580 | Ga0501046_0040210 | Ga0501046_0040210_32_778 | 248 |
| 487 | 3300049580 | Ga0501046_0527608 | Ga0501046_0527608_70_816 | 248 |
| 488 | 3300049581 | Ga0501047_0096823 | Ga0501047_0096823_1620_2366 | 248 |
| 489 | 3300049581 | Ga0501047_0449414 | Ga0501047_0449414_100_846 | 248 |
| 490 | 3300049582 | Ga0501048_0027958 | Ga0501048_0027958_57_803 | 248 |
| 491 | 3300049582 | Ga0501048_0034083 | Ga0501048_0034083_2722_3468 | 248 |
| 492 | 3300049822 | Ga0501035_0017076 | Ga0501035_0017076_1300_2046 | 248 |
| 493 | 3300049822 | Ga0501035_0238240 | Ga0501035_0238240_335_1081 | 248 |
| 494 | 3300049822 | Ga0501035_0258256 | Ga0501035_0258256_682_1428 | 248 |
| 495 | 3300049822 | Ga0501035_0396171 | Ga0501035_0396171_369_1115 | 248 |
| 496 | 3300049823 | Ga0501044_0366541 | Ga0501044_0366541_98_904 | 248 |
| 497 | 3300054114 | Ga0501084_0520096 | Ga0501084_0520096_16_762 | 248 |
| 498 | 3300061719 | Ga0466962_0004244 | Ga0466962_0004244_2229_2975 | 248 |
| 499 | iso_pu_bacteria | 2537561836 | 2538833384 | 248 |
| 500 | iso_pu_bacteria | 2643221562 | 2643831885 | 248 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hs9-assembly3.cif.gz_C | brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant:i258m/k262t | 0.9433 | 8 | 242 |
| 3edm-assembly1.cif.gz_C | crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens | 0.9384 | 8 | 241 |
| 3osu-assembly1.cif.gz_A | crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus | 0.938 | 8 | 242 |
| 3edm-assembly1.cif.gz_D | crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens | 0.9369 | 8 | 241 |
| 3sj7-assembly1.cif.gz_B-2 | structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph | 0.9367 | 7 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9375 | 8 | 189 | 3.40.50.720 |
| 3dijB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9358 | 10 | 247 | 3.40.50.720 |
| 3tfoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9331 | 7 | 238 | 3.40.50.720 |
| af_A0A0N7KIR0_69_250_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9286 | 8 | 163 | 3.40.50.720 |
| 4hsyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9276 | 8 | 242 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849MK26-F1-model_v4 | Pteridine reductase (EC 1.5.1.33) | 0.9714 | 8 | 245 |
GO:0016491
|
| AF-A0A3D5DFU2-F1-model_v4 | Pteridine reductase | 0.9642 | 7 | 247 |
GO:0016491
|
| AF-A0A847I682-F1-model_v4 | SDR family oxidoreductase | 0.9585 | 6 | 245 |
|
| AF-A0A3D5DFU2-F1-model_v4 | Pteridine reductase | 0.9564 | 7 | 247 |
GO:0016491
|
| AF-A0A161XI10-F1-model_v4 | deleted | 0.9556 | 7 | 186 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar