F455608

General Info

Members Datasets Scaffolds Average Seq Length
500 255 1000 159

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0021073|Ga0501032_0021073_210_719
Length 159
Sequence VLTPPPDFSPSAAPKRPGDSYTEMVQVVLPNDANPLGFILGGTVMHLIDIAGAIAAHRHARRPLVTAAVDGLQFLHPIRVGDLIILRARVTATVLSEGTLTGARQRTSVAYLTFVAVEAEGGRGAVPPLLLETDEDRRRAHDAGVRRAARLKNRAKLDE

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
145 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
146 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0
Rhizoplane 2
Rhizosphere 92.4
Stem 0
Stem Tuber 0
Unclassified 17.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0021073 3300049569 Bacteria 4533
2 JGI24751J29686_10017664 3300002459 Bacteria 1474
3 Ga0065712_10070951 3300005290 Bacteria 5583
4 Ga0065712_10074255 3300005290 Bacteria 4143
5 Ga0065715_10050660 3300005293 Bacteria 1129
6 Ga0065715_10172540 3300005293 Bacteria 1536
7 Ga0065715_10195922 3300005293 Bacteria 1388
8 Ga0065715_10244763 3300005293 Bacteria 1187
9 Ga0065715_10262176 3300005293 Bacteria 1135
10 Ga0065707_10112882 3300005295 Bacteria 2346
11 Ga0070683_100822024 3300005329 Bacteria 891
12 Ga0070670_100029360 3300005331 Bacteria 4734
13 Ga0070670_100241331 3300005331 Bacteria 1573
14 Ga0070670_100442373 3300005331 Bacteria 1151
15 Ga0068868_100098751 3300005338 Bacteria 2361
16 Ga0068868_100391986 3300005338 Unclassified 1197
17 Ga0070660_101446348 3300005339 Unclassified 584
18 Ga0070689_100388721 3300005340 Bacteria 1177
19 Ga0070675_100505033 3300005354 Bacteria 1090
20 Ga0070671_100008806 3300005355 Bacteria 8093
21 Ga0070674_100114245 3300005356 Bacteria 1988
22 Ga0070674_100575801 3300005356 Bacteria 948
23 Ga0070673_100377824 3300005364 Bacteria 1263
24 Ga0070688_100006396 3300005365 Bacteria 6298
25 Ga0070688_100058459 3300005365 Bacteria 2428
26 Ga0070688_100463274 3300005365 Bacteria 950
27 Ga0070667_100260629 3300005367 Bacteria 1552
28 Ga0070703_10525829 3300005406 Unclassified 536
29 Ga0070711_100309367 3300005439 Unclassified 1259
30 Ga0070705_100433664 3300005440 Bacteria 982
31 Ga0070705_100941594 3300005440 Unclassified 697
32 Ga0070700_100177832 3300005441 Bacteria 1478
33 Ga0070708_100000569 3300005445 Bacteria 27643
34 Ga0070678_100082506 3300005456 Unclassified 2441
35 Ga0070678_100139148 3300005456 Bacteria 1940
36 Ga0070678_101121884 3300005456 Bacteria 727
37 Ga0070678_101332815 3300005456 Bacteria 669
38 Ga0070662_100188914 3300005457 Bacteria 1628
39 Ga0070681_10679584 3300005458 Bacteria 945
40 Ga0070685_10344849 3300005466 Bacteria 1017
41 Ga0070706_100694340 3300005467 Bacteria 944
42 Ga0070698_100017887 3300005471 Bacteria 7467
43 Ga0070698_100883456 3300005471 Unclassified 839
44 Ga0070699_100059651 3300005518 Bacteria 3305
45 Ga0070699_100099610 3300005518 Bacteria 2547
46 Ga0070699_100178289 3300005518 Unclassified 1885
47 Ga0070697_100003114 3300005536 Bacteria 12743
48 Ga0070697_100325985 3300005536 Unclassified 1323
49 Ga0070672_100181532 3300005543 Unclassified 1754
50 Ga0070686_100143311 3300005544 Bacteria 1665
51 Ga0070696_100543711 3300005546 Bacteria 930
52 Ga0070696_100697903 3300005546 Unclassified 827
53 Ga0070693_100285541 3300005547 Bacteria 1107
54 Ga0070704_100584391 3300005549 Bacteria 980
55 Ga0068855_100085330 3300005563 Unclassified 3653
56 Ga0070664_100515732 3300005564 Bacteria 1103
57 Ga0070664_100731143 3300005564 Bacteria 923
58 Ga0068856_100321383 3300005614 Bacteria 1565
59 Ga0070702_100239408 3300005615 Bacteria 1224
60 Ga0068859_100178427 3300005617 Bacteria 2206
61 Ga0068859_100459576 3300005617 Bacteria 1369
62 Ga0068859_101447505 3300005617 Bacteria 758
63 Ga0068859_101834114 3300005617 Bacteria 670
64 Ga0068861_100064273 3300005719 Unclassified 2823
65 Ga0068861_100203307 3300005719 Bacteria 1664
66 Ga0068863_100584875 3300005841 Bacteria 1104
67 Ga0068858_100005557 3300005842 Bacteria 12335
68 Ga0068858_100158446 3300005842 Bacteria 2131
69 Ga0068858_101543263 3300005842 Bacteria 655
70 Ga0068860_100928991 3300005843 Unclassified 887
71 Ga0068860_101002643 3300005843 Unclassified 853
72 Ga0068862_100028680 3300005844 Bacteria 4688
73 Ga0070717_10145236 3300006028 Unclassified 2049
74 Ga0075365_10325266 3300006038 Bacteria 1083
75 Ga0075368_10014620 3300006042 Bacteria 2902
76 Ga0075364_10000947 3300006051 Bacteria 15319
77 Ga0075364_10001809 3300006051 Bacteria 11848
78 Ga0075364_10006974 3300006051 Bacteria 6675
79 Ga0070716_100684138 3300006173 Unclassified 782
80 Ga0070716_100756872 3300006173 Bacteria 748
81 Ga0075362_10000638 3300006177 Bacteria 10295
82 Ga0075367_10165340 3300006178 Bacteria 1377
83 Ga0075366_10063655 3300006195 Bacteria 2192
84 Ga0075366_10065562 3300006195 Bacteria 2160
85 Ga0075366_10219466 3300006195 Bacteria 1158
86 Ga0097621_100030379 3300006237 Bacteria 4276
87 Ga0097621_100164011 3300006237 Bacteria 1912
88 Ga0097621_100793345 3300006237 Unclassified 877
89 Ga0097621_102183190 3300006237 Bacteria 530
90 Ga0075370_10004108 3300006353 Bacteria 7014
91 Ga0068871_100062386 3300006358 Bacteria 3046
92 Ga0068871_100062387 3300006358 Bacteria 3046
93 Ga0068871_100237597 3300006358 Unclassified 1583
94 Ga0075428_100090898 3300006844 Bacteria 3330
95 Ga0075428_100138432 3300006844 Bacteria 2646
96 Ga0075428_100148373 3300006844 Bacteria 2548
97 Ga0075428_100664628 3300006844 Bacteria 1111
98 Ga0075430_100530983 3300006846 Bacteria 971
99 Ga0075431_100079680 3300006847 Bacteria 3381
100 Ga0075431_100186198 3300006847 Bacteria 2129
101 Ga0075431_100398559 3300006847 Bacteria 1377
102 Ga0075431_100882384 3300006847 Bacteria 865
103 Ga0075433_10007939 3300006852 Bacteria 8446
104 Ga0075433_10095882 3300006852 Unclassified 2625
105 Ga0075434_100012247 3300006871 Bacteria 8127
106 Ga0075434_100060875 3300006871 Bacteria 3756
107 Ga0075434_100499076 3300006871 Bacteria 1238
108 Ga0075434_100540073 3300006871 Bacteria 1186
109 Ga0075434_101221408 3300006871 Bacteria 763
110 Ga0075429_100441149 3300006880 Bacteria 1141
111 Ga0075429_100584877 3300006880 Unclassified 978
112 Ga0068865_100002136 3300006881 Bacteria 11682
113 Ga0068865_100150112 3300006881 Bacteria 1767
114 Ga0075436_100001401 3300006914 Bacteria 16388
115 Ga0075436_100269443 3300006914 Bacteria 1216
116 Ga0075436_100944866 3300006914 Unclassified 646
117 Ga0097620_100178426 3300006931 Bacteria 2206
118 Ga0097620_100459543 3300006931 Bacteria 1369
119 Ga0097620_101447285 3300006931 Bacteria 758
120 Ga0097620_101834019 3300006931 Bacteria 670
121 Ga0075435_100004017 3300007076 Bacteria 10057
122 Ga0075435_100015236 3300007076 Bacteria 5775
123 Ga0075435_100019560 3300007076 Bacteria 5175
124 Ga0075435_100111014 3300007076 Bacteria 2281
125 Ga0075435_100666328 3300007076 Bacteria 903
126 Ga0099794_10016308 3300007265 Bacteria 3291
127 Ga0099794_10026363 3300007265 Unclassified 2686
128 Ga0105240_10019459 3300009093 Bacteria 9069
129 Ga0105240_10083583 3300009093 Bacteria 3917
130 Ga0105240_10526314 3300009093 Bacteria 1311
131 Ga0105240_11591320 3300009093 Unclassified 684
132 Ga0111539_10038442 3300009094 Bacteria 5772
133 Ga0111539_10184367 3300009094 Bacteria 2438
134 Ga0111539_10207001 3300009094 Unclassified 2287
135 Ga0111539_10246195 3300009094 Bacteria 2081
136 Ga0111539_10297366 3300009094 Bacteria 1879
137 Ga0111539_10322177 3300009094 Bacteria 1799
138 Ga0111539_10665049 3300009094 Bacteria 1213
139 Ga0111539_10803879 3300009094 Bacteria 1094
140 Ga0111539_11014080 3300009094 Unclassified 965
141 Ga0111539_11343551 3300009094 Bacteria 829
142 Ga0105245_10123224 3300009098 Bacteria 2424
143 Ga0105245_10367368 3300009098 Unclassified 1430
144 Ga0105245_11641346 3300009098 Bacteria 695
145 Ga0105245_12050688 3300009098 Bacteria 626
146 Ga0105247_10024185 3300009101 Bacteria 3659
147 Ga0105247_10079262 3300009101 Bacteria 2067
148 Ga0105247_10344501 3300009101 Unclassified 1046
149 Ga0114129_10000183 3300009147 Bacteria 69906
150 Ga0114129_10004771 3300009147 Bacteria 19163
151 Ga0114129_10009377 3300009147 Bacteria 13951
152 Ga0114129_10021392 3300009147 Bacteria 9182
153 Ga0114129_10027828 3300009147 Bacteria 8006
154 Ga0114129_10083444 3300009147 Bacteria 4439
155 Ga0114129_10237541 3300009147 Bacteria 2451
156 Ga0114129_11049507 3300009147 Bacteria 1023
157 Ga0114129_11365169 3300009147 Bacteria 876
158 Ga0114129_12055120 3300009147 Bacteria 690
159 Ga0105243_10414272 3300009148 Bacteria 1255
160 Ga0105242_10211417 3300009176 Bacteria 1729
161 Ga0105242_10430089 3300009176 Unclassified 1239
162 Ga0105242_11146637 3300009176 Unclassified 794
163 Ga0105248_10031390 3300009177 Bacteria 5939
164 Ga0105248_10066445 3300009177 Bacteria 4049
165 Ga0105248_10070531 3300009177 Bacteria 3924
166 Ga0105248_10141683 3300009177 Bacteria 2712
167 Ga0105248_12140738 3300009177 Bacteria 636
168 Ga0105238_10413935 3300009551 Bacteria 1342
169 Ga0105249_10155638 3300009553 Bacteria 2204
170 Ga0105249_10725147 3300009553 Bacteria 1055
171 Ga0105246_10371288 3300011119 Bacteria 1179
172 Ga0105246_10743996 3300011119 Bacteria 864
173 Ga0157369_10165075 3300013105 Bacteria 2336
174 Ga0157369_10957292 3300013105 Bacteria 877
175 Ga0157378_10885292 3300013297 Bacteria 923
176 Ga0163162_10097931 3300013306 Bacteria 3022
177 Ga0163162_10353535 3300013306 Unclassified 1602
178 Ga0157372_10532924 3300013307 Unclassified 1369
179 Ga0157375_10108129 3300013308 Unclassified 2875
180 Ga0157375_11322533 3300013308 Unclassified 848
181 Ga0157375_11598837 3300013308 Unclassified 771
182 Ga0157375_12354577 3300013308 Bacteria 635
183 Ga0163163_10000034 3300014325 Bacteria 161820
184 Ga0163163_10770806 3300014325 Bacteria 1025
185 Ga0163163_10966977 3300014325 Unclassified 915
186 Ga0157380_10152169 3300014326 Bacteria 2001
187 Ga0157380_10385237 3300014326 Bacteria 1325
188 Ga0157380_10458247 3300014326 Bacteria 1227
189 Ga0157379_10039097 3300014968 Bacteria 4233
190 Ga0157379_10269758 3300014968 Bacteria 1547
191 Ga0157376_10040516 3300014969 Bacteria 3808
192 Ga0157376_10201879 3300014969 Bacteria 1830
193 Ga0157376_10953494 3300014969 Bacteria 878
194 Ga0157376_12719656 3300014969 Unclassified 535
195 Ga0163161_10186213 3300017792 Unclassified 1594
196 Ga0163161_10205214 3300017792 Bacteria 1520
197 Ga0207680_10056785 3300025903 Unclassified 2366
198 Ga0207680_10210192 3300025903 Unclassified 1330
199 Ga0207680_10391949 3300025903 Bacteria 980
200 Ga0207699_10077871 3300025906 Unclassified 2047
201 Ga0207684_11163188 3300025910 Bacteria 640
202 Ga0207695_10031162 3300025913 Bacteria 5855
203 Ga0207695_10156255 3300025913 Bacteria 2215
204 Ga0207663_10659479 3300025916 Unclassified 826
205 Ga0207663_10787019 3300025916 Unclassified 757
206 Ga0207662_10514171 3300025918 Bacteria 826
207 Ga0207657_10852774 3300025919 Bacteria 703
208 Ga0207646_10589593 3300025922 Bacteria 998
209 Ga0207646_11813357 3300025922 Unclassified 521
210 Ga0207681_10221195 3300025923 Bacteria 1465
211 Ga0207681_10318793 3300025923 Bacteria 1235
212 Ga0207650_10055293 3300025925 Bacteria 2946
213 Ga0207659_10785998 3300025926 Bacteria 817
214 Ga0207687_10730896 3300025927 Bacteria 841
215 Ga0207700_10586926 3300025928 Bacteria 991
216 Ga0207664_10129643 3300025929 Unclassified 2122
217 Ga0207644_10170589 3300025931 Bacteria 1698
218 Ga0207706_10375498 3300025933 Bacteria 1234
219 Ga0207686_10013561 3300025934 Bacteria 4512
220 Ga0207670_10945160 3300025936 Bacteria 723
221 Ga0207669_10032080 3300025937 Bacteria 2945
222 Ga0207669_10089501 3300025937 Bacteria 1999
223 Ga0207704_10112222 3300025938 Bacteria 1846
224 Ga0207704_10149450 3300025938 Bacteria 1646
225 Ga0207665_10848486 3300025939 Unclassified 723
226 Ga0207691_10055727 3300025940 Bacteria 3602
227 Ga0207711_10057614 3300025941 Bacteria 3340
228 Ga0207711_10080835 3300025941 Bacteria 2839
229 Ga0207711_10113548 3300025941 Bacteria 2412
230 Ga0207711_10172110 3300025941 Unclassified 1965
231 Ga0207711_10304518 3300025941 Bacteria 1470
232 Ga0207689_11194710 3300025942 Bacteria 640
233 Ga0207661_10015620 3300025944 Bacteria 5592
234 Ga0207679_10054850 3300025945 Bacteria 2936
235 Ga0207679_10222209 3300025945 Bacteria 1590
236 Ga0207667_10110078 3300025949 Bacteria 2841
237 Ga0207712_10874909 3300025961 Bacteria 793
238 Ga0207640_10059673 3300025981 Bacteria 2518
239 Ga0207677_10166448 3300026023 Bacteria 1719
240 Ga0207677_10425477 3300026023 Unclassified 1132
241 Ga0207677_10470348 3300026023 Bacteria 1081
242 Ga0207703_10003907 3300026035 Bacteria 12375
243 Ga0207703_10220965 3300026035 Bacteria 1694
244 Ga0207708_10844742 3300026075 Bacteria 790
245 Ga0207708_11812587 3300026075 Unclassified 535
246 Ga0207702_10027115 3300026078 Bacteria 4757
247 Ga0207702_10509340 3300026078 Bacteria 1174
248 Ga0207641_11456823 3300026088 Bacteria 686
249 Ga0207648_10879773 3300026089 Bacteria 836
250 Ga0207676_10651252 3300026095 Bacteria 1017
251 Ga0207676_11093310 3300026095 Unclassified 788
252 Ga0207674_10907129 3300026116 Bacteria 849
253 Ga0207674_11282793 3300026116 Bacteria 702
254 Ga0207675_101347961 3300026118 Bacteria 734
255 Ga0207698_10095579 3300026142 Bacteria 2446
256 Ga0209588_1016844 3300027671 Unclassified 2260
257 Ga0207428_10084199 3300027907 Bacteria 2479
258 Ga0207428_10134744 3300027907 Bacteria 1889
259 Ga0207428_10168264 3300027907 Bacteria 1661
260 Ga0268265_10167228 3300028380 Bacteria 1875
261 Ga0268265_10425938 3300028380 Unclassified 1233
262 Ga0268264_11284096 3300028381 Unclassified 742
263 Ga0265330_10283472 3300031235 Bacteria 698
264 Ga0307408_100034856 3300031548 Bacteria 3528
265 Ga0307408_100046100 3300031548 Bacteria 3117
266 Ga0307408_100175926 3300031548 Bacteria 1712
267 Ga0265314_10121467 3300031711 Bacteria 1644
268 Ga0307405_10129552 3300031731 Bacteria 1741
269 Ga0307405_10394657 3300031731 Bacteria 1081
270 Ga0316577_10110227 3300031733 Bacteria 1544
271 Ga0307413_10461912 3300031824 Bacteria 1010
272 Ga0307410_10147392 3300031852 Bacteria 1748
273 Ga0307406_10395990 3300031901 Bacteria 1093
274 Ga0307412_10255458 3300031911 Bacteria 1363
275 Ga0307412_10455571 3300031911 Unclassified 1055
276 Ga0307412_10602834 3300031911 Bacteria 930
277 Ga0307412_11387142 3300031911 Bacteria 635
278 Ga0307416_100024035 3300032002 Bacteria 4438
279 Ga0307416_100025544 3300032002 Bacteria 4332
280 Ga0307416_100067455 3300032002 Bacteria 2951
281 Ga0307416_100137756 3300032002 Bacteria 2212
282 Ga0307416_102748720 3300032002 Bacteria 588
283 Ga0307415_100328191 3300032126 Bacteria 1279
284 Ga0307415_100449659 3300032126 Bacteria 1113
285 Ga0307415_100572546 3300032126 Bacteria 1000
286 Ga0373930_0009968 3300034816 Bacteria 1688
287 Ga0373948_0056107 3300034817 Bacteria 856
288 Ga0373958_0085557 3300034819 Bacteria 720
289 Ga0373959_0005596 3300034820 Bacteria 2063
290 Ga0373938_0023529 3300034957 Bacteria 1267
291 Ga0373929_0011110 3300035085 Bacteria 1692
292 Ga0373940_0151321 3300035088 Bacteria 739
293 Ga0373949_0117932 3300035090 Bacteria 742
294 Ga0373951_0066991 3300035091 Bacteria 908
295 Ga0373952_0006475 3300035092 Unclassified 2163
296 Ga0373923_0161510 3300035111 Unclassified 1022
297 Ga0373932_0001784 3300035112 Bacteria 5796
298 Ga0373939_0000547 3300035114 Bacteria 9395
299 Ga0373941_0001415 3300035115 Bacteria 5061
300 Ga0373957_0150640 3300035120 Bacteria 955
301 Ga0373960_0000292 3300035121 Bacteria 9527
302 Ga0373960_0041536 3300035121 Unclassified 1332
303 Ga0373943_0386953 3300035170 Bacteria 806
304 Ga0373942_0001224 3300035207 Bacteria 6757
305 Ga0373942_0113923 3300035207 Bacteria 839
306 Ga0373961_0004839 3300035241 Bacteria 3237
307 Ga0373961_0300293 3300035241 Bacteria 594
308 Ga0373924_0261594 3300035410 Bacteria 767
309 Ga0373924_0264693 3300035410 Bacteria 762
310 Ga0373924_0517258 3300035410 Bacteria 537
311 Ga0373931_0007748 3300035691 Bacteria 5070
312 Ga0373935_0295169 3300035692 Unclassified 1144
313 Ga0373933_0432483 3300035724 Bacteria 860
314 Ga0373937_0014151 3300036401 Bacteria 7036
315 Ga0316582_1269396 3300036647 Unclassified 501
316 Ga0316584_0089176 3300036712 Bacteria 2309
317 Ga0395901_0844242 3300038443 Bacteria 902
318 Ga0439436_0186066 3300041404 Unclassified 592
319 Ga0439431_0101770 3300041997 Bacteria 790
320 Ga0439431_0183718 3300041997 Unclassified 605
321 Ga0439431_0201768 3300041997 Unclassified 580
322 Ga0439445_0002173 3300042004 Bacteria 4349
323 Ga0439449_0272132 3300042007 Bacteria 638
324 Ga0439462_0080471 3300042015 Bacteria 890
325 Ga0439462_0183383 3300042015 Bacteria 594
326 Ga0450910_036451 3300042147 Bacteria 786
327 Ga0439434_0137209 3300042435 Bacteria 805
328 Ga0439444_0010273 3300042437 Unclassified 1494
329 Ga0453684_2207624 3300044712 Bacteria 550
330 Ga0451576_0011476 3300045051 Bacteria 10060
331 Ga0451576_0052760 3300045051 Bacteria 4261
332 Ga0451576_0103215 3300045051 Bacteria 2966
333 Ga0451576_2658684 3300045051 Bacteria 510
334 Ga0495592_0095163 3300046454 Bacteria 2131
335 Ga0495592_0108634 3300046454 Bacteria 1966
336 Ga0495638_0035907 3300046460 Bacteria 3158
337 Ga0495651_0532614 3300046462 Unclassified 748
338 Ga0495580_0266124 3300046472 Unclassified 1172
339 Ga0495628_0144061 3300046516 Unclassified 1817
340 Ga0495628_0169530 3300046516 Unclassified 1656
341 Ga0495640_0135721 3300046533 Unclassified 1589
342 Ga0495586_0146704 3300046535 Unclassified 1326
343 Ga0495667_0051795 3300046559 Bacteria 2707
344 Ga0495656_0684154 3300046615 Bacteria 552
345 Ga0495599_0155348 3300046678 Bacteria 1416
346 Ga0495658_0058846 3300046683 Unclassified 2199
347 Ga0495658_0159337 3300046683 Bacteria 1391
348 Ga0495674_0233641 3300047319 Unclassified 1517
349 Ga0495680_0263817 3300047322 Bacteria 1218
350 Ga0495680_0484238 3300047322 Unclassified 842
351 Ga0496100_0620077 3300048903 Unclassified 841
352 Ga0496101_0759587 3300048904 Unclassified 765
353 Ga0496106_0312434 3300048909 Bacteria 1261
354 Ga0496109_0844912 3300048912 Unclassified 853
355 Ga0496109_1453689 3300048912 Bacteria 621
356 Ga0496109_1603213 3300048912 Unclassified 585
357 Ga0496110_0196787 3300048913 Bacteria 1831
358 Ga0496112_0119281 3300048915 Bacteria 2608
359 Ga0496112_1215928 3300048915 Bacteria 670
360 Ga0496113_0400639 3300048916 Bacteria 1102
361 Ga0501299_056822 3300049522 Bacteria 821
362 Ga0501031_0571987 3300049568 Bacteria 727
363 Ga0501032_0034404 3300049569 Bacteria 3469
364 Ga0501033_0003610 3300049570 Bacteria 12628
365 Ga0501033_0174788 3300049570 Bacteria 1541
366 Ga0501034_0110565 3300049571 Bacteria 2739
367 Ga0501034_0161481 3300049571 Bacteria 2211
368 Ga0501034_0257459 3300049571 Bacteria 1688
369 Ga0501036_0046897 3300049572 Bacteria 3659
370 Ga0501036_0078590 3300049572 Bacteria 2790
371 Ga0501037_0271008 3300049573 Bacteria 1184
372 Ga0501038_0018716 3300049574 Bacteria 6254
373 Ga0501038_0036721 3300049574 Bacteria 4300
374 Ga0501038_0086126 3300049574 Bacteria 2640
375 Ga0501039_0018584 3300049575 Bacteria 5336
376 Ga0501039_0488420 3300049575 Bacteria 967
377 Ga0501040_0002880 3300049576 Bacteria 11120
378 Ga0501040_0390968 3300049576 Bacteria 998
379 Ga0501041_0002227 3300049577 Bacteria 10969
380 Ga0501042_1106055 3300049578 Bacteria 578
381 Ga0501043_0007204 3300049579 Bacteria 8839
382 Ga0501043_0034162 3300049579 Bacteria 4000
383 Ga0501043_0720853 3300049579 Bacteria 727
384 Ga0501046_0003265 3300049580 Bacteria 14888
385 Ga0501046_0018490 3300049580 Bacteria 5797
386 Ga0501047_0004385 3300049581 Bacteria 13280
387 Ga0501047_0019000 3300049581 Bacteria 6593
388 Ga0501047_0034720 3300049581 Bacteria 4868
389 Ga0501047_0674975 3300049581 Bacteria 851
390 Ga0501047_0955159 3300049581 Bacteria 670
391 Ga0501048_0026973 3300049582 Bacteria 4179
392 Ga0501048_0038255 3300049582 Bacteria 3443
393 Ga0501048_0835060 3300049582 Bacteria 662
394 Ga0501067_0017184 3300049583 Bacteria 3998
395 Ga0501067_0488525 3300049583 Bacteria 688
396 Ga0501068_0035346 3300049584 Bacteria 2982
397 Ga0501068_0245996 3300049584 Unclassified 1139
398 Ga0501069_0035364 3300049585 Bacteria 2752
399 Ga0501069_0115418 3300049585 Bacteria 1531
400 Ga0501070_0006378 3300049586 Bacteria 10037
401 Ga0501071_0058593 3300049587 Bacteria 2785
402 Ga0501072_0043519 3300049588 Bacteria 3529
403 Ga0501072_0282244 3300049588 Unclassified 1321
404 Ga0501072_0566972 3300049588 Bacteria 896
405 Ga0501073_0042431 3300049589 Bacteria 3211
406 Ga0501073_0128889 3300049589 Bacteria 1753
407 Ga0501074_0000820 3300049590 Bacteria 19699
408 Ga0501074_0092447 3300049590 Bacteria 2166
409 Ga0501074_0209282 3300049590 Bacteria 1390
410 Ga0501075_0001443 3300049591 Bacteria 15462
411 Ga0501075_0730346 3300049591 Bacteria 754
412 Ga0501076_0005111 3300049592 Bacteria 9393
413 Ga0501076_1540186 3300049592 Unclassified 546
414 Ga0501079_0009270 3300049741 Bacteria 7457
415 Ga0501079_0013924 3300049741 Bacteria 6134
416 Ga0501079_0330988 3300049741 Bacteria 1193
417 Ga0501080_0015730 3300049742 Bacteria 6977
418 Ga0501080_0027207 3300049742 Bacteria 5319
419 Ga0501080_0092515 3300049742 Bacteria 2808
420 Ga0501080_0189411 3300049742 Bacteria 1891
421 Ga0501081_0018661 3300049743 Bacteria 4609
422 Ga0501081_1378995 3300049743 Bacteria 535
423 Ga0501083_0009156 3300049744 Bacteria 6994
424 Ga0501083_0193461 3300049744 Bacteria 1327
425 Ga0501035_0005090 3300049822 Bacteria 12453
426 Ga0501035_0027186 3300049822 Bacteria 5229
427 Ga0501035_0199353 3300049822 Bacteria 1717
428 Ga0501035_0218034 3300049822 Unclassified 1630
429 Ga0501044_0012542 3300049823 Bacteria 9180
430 Ga0501044_0170867 3300049823 Bacteria 2145
431 Ga0501044_0558267 3300049823 Bacteria 1041
432 Ga0501045_0005835 3300049824 Bacteria 8528
433 Ga0501045_0053755 3300049824 Bacteria 2943
434 Ga0501045_0601236 3300049824 Bacteria 814
435 nmdc:mga03683_1670_c1 3300050489 Bacteria 6681
436 nmdc:mga03n38_184448_c1 3300050490 Bacteria 1071
437 nmdc:mga00v17_292527_c1 3300050491 Bacteria 1058
438 nmdc:mga00v17_837933_c1 3300050491 Unclassified 585
439 nmdc:mga0yw44_953571_c1 3300050492 Unclassified 581
440 nmdc:mga0k408_206837_c1 3300050493 Bacteria 1172
441 nmdc:mga0k408_60802_c1 3300050493 Bacteria 2195
442 nmdc:mga0k408_8072_c1 3300050493 Bacteria 5643
443 nmdc:mga06z11_15660_c2 3300050494 Bacteria 3022
444 nmdc:mga06z11_211618_c1 3300050494 Bacteria 1130
445 nmdc:mga06z11_2638_c1 3300050494 Bacteria 6871
446 nmdc:mga04h51_316756_c1 3300050495 Unclassified 639
447 nmdc:mga05p37_190_c1 3300050507 Bacteria 61128
448 nmdc:mga05p37_23121_c1 3300050507 Bacteria 7542
449 nmdc:mga05p37_2567_c1 3300050507 Bacteria 21108
450 nmdc:mga05p37_29919_c1 3300050507 Bacteria 6646
451 nmdc:mga05p37_47324_c1 3300050507 Bacteria 5289
452 nmdc:mga05p37_51259_c1 3300050507 Bacteria 5076
453 nmdc:mga05p37_63675_c1 3300050507 Bacteria 4538
454 nmdc:mga05p37_719085_c1 3300050507 Unclassified 1106
455 nmdc:mga05p37_947866_c1 3300050507 Bacteria 921
456 nmdc:mga09592_185840_c1 3300050508 Bacteria 1798
457 nmdc:mga09592_357986_c1 3300050508 Bacteria 1263
458 nmdc:mga0qj67_63879_c1 3300050509 Bacteria 2927
459 nmdc:mga08y16_160350_c1 3300050511 Bacteria 2337
460 nmdc:mga08y16_183629_c1 3300050511 Bacteria 2171
461 nmdc:mga08y16_20909_c1 3300050511 Bacteria 6910
462 nmdc:mga08y16_253281_c1 3300050511 Bacteria 1819
463 nmdc:mga08y16_463117_c1 3300050511 Bacteria 1292
464 nmdc:mga0n895_118_c1 3300050512 Bacteria 46962
465 nmdc:mga0n895_1191725_c1 3300050512 Bacteria 736
466 nmdc:mga0n895_3788_c1 3300050512 Bacteria 12245
467 nmdc:mga0n895_488862_c1 3300050512 Bacteria 1241
468 nmdc:mga0n895_58631_c1 3300050512 Bacteria 3796
469 nmdc:mga0rr50_11003_c1 3300050513 Bacteria 5769
470 nmdc:mga0rr50_112622_c1 3300050513 Bacteria 2155
471 nmdc:mga0rr50_13_c1 3300050513 Bacteria 213605
472 nmdc:mga0rr50_427744_c1 3300050513 Bacteria 1121
473 nmdc:mga0rr50_586614_c1 3300050513 Bacteria 950
474 nmdc:mga08x19_26656_c1 3300050514 Unclassified 3607
475 nmdc:mga08x19_97_c1 3300050514 Bacteria 77512
476 nmdc:mga0a205_1056405_c1 3300050515 Bacteria 659
477 nmdc:mga0a205_119799_c1 3300050515 Unclassified 2531
478 nmdc:mga0a205_1220404_c1 3300050515 Bacteria 600
479 nmdc:mga0a205_127581_c1 3300050515 Bacteria 2444
480 nmdc:mga0a205_149606_c1 3300050515 Bacteria 2235
481 nmdc:mga0a205_225149_c1 3300050515 Bacteria 1760
482 nmdc:mga0a205_270266_c1 3300050515 Bacteria 1577
483 nmdc:mga0a205_618348_c1 3300050515 Bacteria 936
484 nmdc:mga0a205_951839_c1 3300050515 Bacteria 705
485 Ga0495601_0184471 3300053077 Unclassified 1364
486 Ga0495619_0106141 3300053085 Bacteria 1915
487 Ga0495619_0486921 3300053085 Bacteria 849
488 Ga0500641_0000203 3300053096 Bacteria 22400
489 Ga0500555_000541 3300053103 Bacteria 15113
490 Ga0500568_0000902 3300053139 Bacteria 20583
491 Ga0500616_0000638 3300053153 Bacteria 42325
492 Ga0500645_000305 3300053730 Bacteria 35044
493 Ga0501084_0010878 3300054114 Bacteria 7536
494 Ga0501084_0021394 3300054114 Bacteria 5390
495 Ga0501084_1178179 3300054114 Bacteria 643
496 Ga0501082_0013506 3300060353 Bacteria 7016
497 Ga0501082_0159809 3300060353 Unclassified 1958
498 Ga0501082_0352647 3300060353 Unclassified 1283
499 Ga0501082_1354931 3300060353 Bacteria 621
500 Ga0530510_0004900 3300061734 Bacteria 9247
501 Ga0501032_0021073
502 JGI24751J29686_10017664
503 Ga0065712_10070951
504 Ga0065712_10074255
505 Ga0065715_10050660
506 Ga0065715_10172540
507 Ga0065715_10195922
508 Ga0065715_10244763
509 Ga0065715_10262176
510 Ga0065707_10112882
511 Ga0070683_100822024
512 Ga0070670_100029360
513 Ga0070670_100241331
514 Ga0070670_100442373
515 Ga0068868_100098751
516 Ga0068868_100391986
517 Ga0070660_101446348
518 Ga0070689_100388721
519 Ga0070675_100505033
520 Ga0070671_100008806
521 Ga0070674_100114245
522 Ga0070674_100575801
523 Ga0070673_100377824
524 Ga0070688_100006396
525 Ga0070688_100058459
526 Ga0070688_100463274
527 Ga0070667_100260629
528 Ga0070703_10525829
529 Ga0070711_100309367
530 Ga0070705_100433664
531 Ga0070705_100941594
532 Ga0070700_100177832
533 Ga0070708_100000569
534 Ga0070678_100082506
535 Ga0070678_100139148
536 Ga0070678_101121884
537 Ga0070678_101332815
538 Ga0070662_100188914
539 Ga0070681_10679584
540 Ga0070685_10344849
541 Ga0070706_100694340
542 Ga0070698_100017887
543 Ga0070698_100883456
544 Ga0070699_100059651
545 Ga0070699_100099610
546 Ga0070699_100178289
547 Ga0070697_100003114
548 Ga0070697_100325985
549 Ga0070672_100181532
550 Ga0070686_100143311
551 Ga0070696_100543711
552 Ga0070696_100697903
553 Ga0070693_100285541
554 Ga0070704_100584391
555 Ga0068855_100085330
556 Ga0070664_100515732
557 Ga0070664_100731143
558 Ga0068856_100321383
559 Ga0070702_100239408
560 Ga0068859_100178427
561 Ga0068859_100459576
562 Ga0068859_101447505
563 Ga0068859_101834114
564 Ga0068861_100064273
565 Ga0068861_100203307
566 Ga0068863_100584875
567 Ga0068858_100005557
568 Ga0068858_100158446
569 Ga0068858_101543263
570 Ga0068860_100928991
571 Ga0068860_101002643
572 Ga0068862_100028680
573 Ga0070717_10145236
574 Ga0075365_10325266
575 Ga0075368_10014620
576 Ga0075364_10000947
577 Ga0075364_10001809
578 Ga0075364_10006974
579 Ga0070716_100684138
580 Ga0070716_100756872
581 Ga0075362_10000638
582 Ga0075367_10165340
583 Ga0075366_10063655
584 Ga0075366_10065562
585 Ga0075366_10219466
586 Ga0097621_100030379
587 Ga0097621_100164011
588 Ga0097621_100793345
589 Ga0097621_102183190
590 Ga0075370_10004108
591 Ga0068871_100062386
592 Ga0068871_100062387
593 Ga0068871_100237597
594 Ga0075428_100090898
595 Ga0075428_100138432
596 Ga0075428_100148373
597 Ga0075428_100664628
598 Ga0075430_100530983
599 Ga0075431_100079680
600 Ga0075431_100186198
601 Ga0075431_100398559
602 Ga0075431_100882384
603 Ga0075433_10007939
604 Ga0075433_10095882
605 Ga0075434_100012247
606 Ga0075434_100060875
607 Ga0075434_100499076
608 Ga0075434_100540073
609 Ga0075434_101221408
610 Ga0075429_100441149
611 Ga0075429_100584877
612 Ga0068865_100002136
613 Ga0068865_100150112
614 Ga0075436_100001401
615 Ga0075436_100269443
616 Ga0075436_100944866
617 Ga0097620_100178426
618 Ga0097620_100459543
619 Ga0097620_101447285
620 Ga0097620_101834019
621 Ga0075435_100004017
622 Ga0075435_100015236
623 Ga0075435_100019560
624 Ga0075435_100111014
625 Ga0075435_100666328
626 Ga0099794_10016308
627 Ga0099794_10026363
628 Ga0105240_10019459
629 Ga0105240_10083583
630 Ga0105240_10526314
631 Ga0105240_11591320
632 Ga0111539_10038442
633 Ga0111539_10184367
634 Ga0111539_10207001
635 Ga0111539_10246195
636 Ga0111539_10297366
637 Ga0111539_10322177
638 Ga0111539_10665049
639 Ga0111539_10803879
640 Ga0111539_11014080
641 Ga0111539_11343551
642 Ga0105245_10123224
643 Ga0105245_10367368
644 Ga0105245_11641346
645 Ga0105245_12050688
646 Ga0105247_10024185
647 Ga0105247_10079262
648 Ga0105247_10344501
649 Ga0114129_10000183
650 Ga0114129_10004771
651 Ga0114129_10009377
652 Ga0114129_10021392
653 Ga0114129_10027828
654 Ga0114129_10083444
655 Ga0114129_10237541
656 Ga0114129_11049507
657 Ga0114129_11365169
658 Ga0114129_12055120
659 Ga0105243_10414272
660 Ga0105242_10211417
661 Ga0105242_10430089
662 Ga0105242_11146637
663 Ga0105248_10031390
664 Ga0105248_10066445
665 Ga0105248_10070531
666 Ga0105248_10141683
667 Ga0105248_12140738
668 Ga0105238_10413935
669 Ga0105249_10155638
670 Ga0105249_10725147
671 Ga0105246_10371288
672 Ga0105246_10743996
673 Ga0157369_10165075
674 Ga0157369_10957292
675 Ga0157378_10885292
676 Ga0163162_10097931
677 Ga0163162_10353535
678 Ga0157372_10532924
679 Ga0157375_10108129
680 Ga0157375_11322533
681 Ga0157375_11598837
682 Ga0157375_12354577
683 Ga0163163_10000034
684 Ga0163163_10770806
685 Ga0163163_10966977
686 Ga0157380_10152169
687 Ga0157380_10385237
688 Ga0157380_10458247
689 Ga0157379_10039097
690 Ga0157379_10269758
691 Ga0157376_10040516
692 Ga0157376_10201879
693 Ga0157376_10953494
694 Ga0157376_12719656
695 Ga0163161_10186213
696 Ga0163161_10205214
697 Ga0207680_10056785
698 Ga0207680_10210192
699 Ga0207680_10391949
700 Ga0207699_10077871
701 Ga0207684_11163188
702 Ga0207695_10031162
703 Ga0207695_10156255
704 Ga0207663_10659479
705 Ga0207663_10787019
706 Ga0207662_10514171
707 Ga0207657_10852774
708 Ga0207646_10589593
709 Ga0207646_11813357
710 Ga0207681_10221195
711 Ga0207681_10318793
712 Ga0207650_10055293
713 Ga0207659_10785998
714 Ga0207687_10730896
715 Ga0207700_10586926
716 Ga0207664_10129643
717 Ga0207644_10170589
718 Ga0207706_10375498
719 Ga0207686_10013561
720 Ga0207670_10945160
721 Ga0207669_10032080
722 Ga0207669_10089501
723 Ga0207704_10112222
724 Ga0207704_10149450
725 Ga0207665_10848486
726 Ga0207691_10055727
727 Ga0207711_10057614
728 Ga0207711_10080835
729 Ga0207711_10113548
730 Ga0207711_10172110
731 Ga0207711_10304518
732 Ga0207689_11194710
733 Ga0207661_10015620
734 Ga0207679_10054850
735 Ga0207679_10222209
736 Ga0207667_10110078
737 Ga0207712_10874909
738 Ga0207640_10059673
739 Ga0207677_10166448
740 Ga0207677_10425477
741 Ga0207677_10470348
742 Ga0207703_10003907
743 Ga0207703_10220965
744 Ga0207708_10844742
745 Ga0207708_11812587
746 Ga0207702_10027115
747 Ga0207702_10509340
748 Ga0207641_11456823
749 Ga0207648_10879773
750 Ga0207676_10651252
751 Ga0207676_11093310
752 Ga0207674_10907129
753 Ga0207674_11282793
754 Ga0207675_101347961
755 Ga0207698_10095579
756 Ga0209588_1016844
757 Ga0207428_10084199
758 Ga0207428_10134744
759 Ga0207428_10168264
760 Ga0268265_10167228
761 Ga0268265_10425938
762 Ga0268264_11284096
763 Ga0265330_10283472
764 Ga0307408_100034856
765 Ga0307408_100046100
766 Ga0307408_100175926
767 Ga0265314_10121467
768 Ga0307405_10129552
769 Ga0307405_10394657
770 Ga0316577_10110227
771 Ga0307413_10461912
772 Ga0307410_10147392
773 Ga0307406_10395990
774 Ga0307412_10255458
775 Ga0307412_10455571
776 Ga0307412_10602834
777 Ga0307412_11387142
778 Ga0307416_100024035
779 Ga0307416_100025544
780 Ga0307416_100067455
781 Ga0307416_100137756
782 Ga0307416_102748720
783 Ga0307415_100328191
784 Ga0307415_100449659
785 Ga0307415_100572546
786 Ga0373930_0009968
787 Ga0373948_0056107
788 Ga0373958_0085557
789 Ga0373959_0005596
790 Ga0373938_0023529
791 Ga0373929_0011110
792 Ga0373940_0151321
793 Ga0373949_0117932
794 Ga0373951_0066991
795 Ga0373952_0006475
796 Ga0373923_0161510
797 Ga0373932_0001784
798 Ga0373939_0000547
799 Ga0373941_0001415
800 Ga0373957_0150640
801 Ga0373960_0000292
802 Ga0373960_0041536
803 Ga0373943_0386953
804 Ga0373942_0001224
805 Ga0373942_0113923
806 Ga0373961_0004839
807 Ga0373961_0300293
808 Ga0373924_0261594
809 Ga0373924_0264693
810 Ga0373924_0517258
811 Ga0373931_0007748
812 Ga0373935_0295169
813 Ga0373933_0432483
814 Ga0373937_0014151
815 Ga0316582_1269396
816 Ga0316584_0089176
817 Ga0395901_0844242
818 Ga0439436_0186066
819 Ga0439431_0101770
820 Ga0439431_0183718
821 Ga0439431_0201768
822 Ga0439445_0002173
823 Ga0439449_0272132
824 Ga0439462_0080471
825 Ga0439462_0183383
826 Ga0450910_036451
827 Ga0439434_0137209
828 Ga0439444_0010273
829 Ga0453684_2207624
830 Ga0451576_0011476
831 Ga0451576_0052760
832 Ga0451576_0103215
833 Ga0451576_2658684
834 Ga0495592_0095163
835 Ga0495592_0108634
836 Ga0495638_0035907
837 Ga0495651_0532614
838 Ga0495580_0266124
839 Ga0495628_0144061
840 Ga0495628_0169530
841 Ga0495640_0135721
842 Ga0495586_0146704
843 Ga0495667_0051795
844 Ga0495656_0684154
845 Ga0495599_0155348
846 Ga0495658_0058846
847 Ga0495658_0159337
848 Ga0495674_0233641
849 Ga0495680_0263817
850 Ga0495680_0484238
851 Ga0496100_0620077
852 Ga0496101_0759587
853 Ga0496106_0312434
854 Ga0496109_0844912
855 Ga0496109_1453689
856 Ga0496109_1603213
857 Ga0496110_0196787
858 Ga0496112_0119281
859 Ga0496112_1215928
860 Ga0496113_0400639
861 Ga0501299_056822
862 Ga0501031_0571987
863 Ga0501032_0034404
864 Ga0501033_0003610
865 Ga0501033_0174788
866 Ga0501034_0110565
867 Ga0501034_0161481
868 Ga0501034_0257459
869 Ga0501036_0046897
870 Ga0501036_0078590
871 Ga0501037_0271008
872 Ga0501038_0018716
873 Ga0501038_0036721
874 Ga0501038_0086126
875 Ga0501039_0018584
876 Ga0501039_0488420
877 Ga0501040_0002880
878 Ga0501040_0390968
879 Ga0501041_0002227
880 Ga0501042_1106055
881 Ga0501043_0007204
882 Ga0501043_0034162
883 Ga0501043_0720853
884 Ga0501046_0003265
885 Ga0501046_0018490
886 Ga0501047_0004385
887 Ga0501047_0019000
888 Ga0501047_0034720
889 Ga0501047_0674975
890 Ga0501047_0955159
891 Ga0501048_0026973
892 Ga0501048_0038255
893 Ga0501048_0835060
894 Ga0501067_0017184
895 Ga0501067_0488525
896 Ga0501068_0035346
897 Ga0501068_0245996
898 Ga0501069_0035364
899 Ga0501069_0115418
900 Ga0501070_0006378
901 Ga0501071_0058593
902 Ga0501072_0043519
903 Ga0501072_0282244
904 Ga0501072_0566972
905 Ga0501073_0042431
906 Ga0501073_0128889
907 Ga0501074_0000820
908 Ga0501074_0092447
909 Ga0501074_0209282
910 Ga0501075_0001443
911 Ga0501075_0730346
912 Ga0501076_0005111
913 Ga0501076_1540186
914 Ga0501079_0009270
915 Ga0501079_0013924
916 Ga0501079_0330988
917 Ga0501080_0015730
918 Ga0501080_0027207
919 Ga0501080_0092515
920 Ga0501080_0189411
921 Ga0501081_0018661
922 Ga0501081_1378995
923 Ga0501083_0009156
924 Ga0501083_0193461
925 Ga0501035_0005090
926 Ga0501035_0027186
927 Ga0501035_0199353
928 Ga0501035_0218034
929 Ga0501044_0012542
930 Ga0501044_0170867
931 Ga0501044_0558267
932 Ga0501045_0005835
933 Ga0501045_0053755
934 Ga0501045_0601236
935 nmdc:mga03683_1670_c1
936 nmdc:mga03n38_184448_c1
937 nmdc:mga00v17_292527_c1
938 nmdc:mga00v17_837933_c1
939 nmdc:mga0yw44_953571_c1
940 nmdc:mga0k408_206837_c1
941 nmdc:mga0k408_60802_c1
942 nmdc:mga0k408_8072_c1
943 nmdc:mga06z11_15660_c2
944 nmdc:mga06z11_211618_c1
945 nmdc:mga06z11_2638_c1
946 nmdc:mga04h51_316756_c1
947 nmdc:mga05p37_190_c1
948 nmdc:mga05p37_23121_c1
949 nmdc:mga05p37_2567_c1
950 nmdc:mga05p37_29919_c1
951 nmdc:mga05p37_47324_c1
952 nmdc:mga05p37_51259_c1
953 nmdc:mga05p37_63675_c1
954 nmdc:mga05p37_719085_c1
955 nmdc:mga05p37_947866_c1
956 nmdc:mga09592_185840_c1
957 nmdc:mga09592_357986_c1
958 nmdc:mga0qj67_63879_c1
959 nmdc:mga08y16_160350_c1
960 nmdc:mga08y16_183629_c1
961 nmdc:mga08y16_20909_c1
962 nmdc:mga08y16_253281_c1
963 nmdc:mga08y16_463117_c1
964 nmdc:mga0n895_118_c1
965 nmdc:mga0n895_1191725_c1
966 nmdc:mga0n895_3788_c1
967 nmdc:mga0n895_488862_c1
968 nmdc:mga0n895_58631_c1
969 nmdc:mga0rr50_11003_c1
970 nmdc:mga0rr50_112622_c1
971 nmdc:mga0rr50_13_c1
972 nmdc:mga0rr50_427744_c1
973 nmdc:mga0rr50_586614_c1
974 nmdc:mga08x19_26656_c1
975 nmdc:mga08x19_97_c1
976 nmdc:mga0a205_1056405_c1
977 nmdc:mga0a205_119799_c1
978 nmdc:mga0a205_1220404_c1
979 nmdc:mga0a205_127581_c1
980 nmdc:mga0a205_149606_c1
981 nmdc:mga0a205_225149_c1
982 nmdc:mga0a205_270266_c1
983 nmdc:mga0a205_618348_c1
984 nmdc:mga0a205_951839_c1
985 Ga0495601_0184471
986 Ga0495619_0106141
987 Ga0495619_0486921
988 Ga0500641_0000203
989 Ga0500555_000541
990 Ga0500568_0000902
991 Ga0500616_0000638
992 Ga0500645_000305
993 Ga0501084_0010878
994 Ga0501084_0021394
995 Ga0501084_1178179
996 Ga0501082_0013506
997 Ga0501082_0159809
998 Ga0501082_0352647
999 Ga0501082_1354931
1000 Ga0530510_0004900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

36

94

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qq2-assembly2.cif.gz_J crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.973 18 162
5t02-assembly1.cif.gz_F structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis 0.9677 22 162
2gvh-assembly1.cif.gz_B crystal structure of acyl-coa hydrolase (15159470) from agrobacterium tumefaciens at 2.65 a resolution 0.9673 21 137
6vfy-assembly1.cif.gz_E crystal structure of mouse acyl-coa thioesterase 7 with coa 0.9667 15 159
2qq2-assembly1.cif.gz_E crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9666 14 162
ID Description Score Start End Superfamily
2q2bB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9664 15 160 3.10.129.10
1vpmB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9618 17 163 3.10.129.10
3b7kC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9592 22 127 3.10.129.10
af_E9QJN3_178_320_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9586 14 138 3.10.129.10
2eisB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9568 23 141 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2E9NLF1-F1-model_v4 Acyl-CoA thioesterase 0.9946 11 168 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A381YAU2-F1-model_v4 HotDog ACOT-type domain-containing protein 0.9923 14 172 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A7V8WGY9-F1-model_v4 Acyl-CoA thioesterase 0.992 25 170 GO:0005737
GO:0006637
GO:0052816
AF-A0A536A5M6-F1-model_v4 Acyl-CoA thioesterase 0.9917 14 138 GO:0005829
GO:0006637
GO:0052816
AF-A0A2W5TK81-F1-model_v4 Acyl-CoA thioesterase 0.9908 12 162 GO:0005829
GO:0006637
GO:0009062
GO:0052816

Map