F455543

General Info

Members Datasets Scaffolds Average Seq Length
500 288 499 115

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10992543|Ga0207684_109925432
Length 132
Sequence MCETVAHDLINRGAMAQDELSPPRSHVFDGMRSMRGYRINALAQSMRHAQNREAFLADETGYMTKMALTPQEQELVRKRDWLGLQAAGGNQYALVKLGGALGINLVHQGAQMRGQSFEEFMLTRPIKGGAGK

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
183 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
184 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
185 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
188 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
241 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
242 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
243 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
244 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
264 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
265 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
266 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
267 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 0.4
Rhizosphere 98.4
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10137912 3300003322 Bacteria 1053
2 Ga0065707_10191332 3300005295 Bacteria 1359
3 Ga0070658_10203150 3300005327 Bacteria 1672
4 Ga0070683_100031612 3300005329 Bacteria 4815
5 Ga0070683_100051185 3300005329 Bacteria 3824
6 Ga0070690_100117755 3300005330 Bacteria 1780
7 Ga0070670_100041906 3300005331 Bacteria 3935
8 Ga0068869_100086077 3300005334 Bacteria 2355
9 Ga0070666_10700680 3300005335 Unclassified 743
10 Ga0070680_100058520 3300005336 Bacteria 3151
11 Ga0070680_100779317 3300005336 Bacteria 824
12 Ga0070680_100779376 3300005336 Bacteria 824
13 Ga0070682_100233164 3300005337 Unclassified 1317
14 Ga0068868_100328276 3300005338 Bacteria 1305
15 Ga0070689_100029666 3300005340 Bacteria 4143
16 Ga0070689_100087538 3300005340 Bacteria 2450
17 Ga0070689_100136219 3300005340 Bacteria 1972
18 Ga0070689_100341583 3300005340 Bacteria 1254
19 Ga0070691_10377201 3300005341 Bacteria 794
20 Ga0070691_10567005 3300005341 Bacteria 666
21 Ga0070687_100118586 3300005343 Bacteria 1510
22 Ga0070687_100151901 3300005343 Bacteria 1360
23 Ga0070687_100287497 3300005343 Bacteria 1038
24 Ga0070692_10134901 3300005345 Bacteria 1391
25 Ga0070669_100403612 3300005353 Bacteria 1119
26 Ga0070673_100112543 3300005364 Bacteria 2259
27 Ga0070673_100169292 3300005364 Bacteria 1864
28 Ga0070673_100368667 3300005364 Bacteria 1278
29 Ga0070673_100951106 3300005364 Unclassified 798
30 Ga0070667_100535788 3300005367 Bacteria 1075
31 Ga0070714_101265671 3300005435 Bacteria 720
32 Ga0070701_10526099 3300005438 Bacteria 772
33 Ga0070701_10637537 3300005438 Unclassified 710
34 Ga0070701_10764816 3300005438 Unclassified 656
35 Ga0070711_100485069 3300005439 Unclassified 1017
36 Ga0070705_100035134 3300005440 Bacteria 2807
37 Ga0070705_100284141 3300005440 Bacteria 1178
38 Ga0070705_100644597 3300005440 Bacteria 825
39 Ga0070700_100717083 3300005441 Bacteria 797
40 Ga0070694_100018713 3300005444 Bacteria 4399
41 Ga0070694_100223414 3300005444 Bacteria 1414
42 Ga0070694_100294931 3300005444 Bacteria 1241
43 Ga0070694_100481495 3300005444 Bacteria 985
44 Ga0070694_100949481 3300005444 Bacteria 712
45 Ga0070694_101524625 3300005444 Bacteria 566
46 Ga0070694_101717797 3300005444 Unclassified 534
47 Ga0070708_100054938 3300005445 Bacteria 3540
48 Ga0070708_101999136 3300005445 Bacteria 537
49 Ga0070678_100106708 3300005456 Bacteria 2183
50 Ga0070678_102210288 3300005456 Unclassified 522
51 Ga0070681_10000135 3300005458 Bacteria 56156
52 Ga0070681_11516317 3300005458 Unclassified 595
53 Ga0068867_100384507 3300005459 Bacteria 1180
54 Ga0070707_100984274 3300005468 Bacteria 809
55 Ga0070698_102131915 3300005471 Bacteria 514
56 Ga0070699_100016436 3300005518 Bacteria 6355
57 Ga0070699_100056007 3300005518 Bacteria 3414
58 Ga0070684_100032377 3300005535 Bacteria 4455
59 Ga0070697_100003905 3300005536 Bacteria 11451
60 Ga0070697_100011057 3300005536 Bacteria 7052
61 Ga0070686_100347225 3300005544 Bacteria 1114
62 Ga0070686_100574699 3300005544 Bacteria 885
63 Ga0070686_101206764 3300005544 Bacteria 629
64 Ga0070686_101312352 3300005544 Bacteria 605
65 Ga0070695_100004450 3300005545 Bacteria 8230
66 Ga0070695_100079059 3300005545 Bacteria 2170
67 Ga0070695_100349373 3300005545 Bacteria 1107
68 Ga0070695_100375390 3300005545 Bacteria 1072
69 Ga0070695_101214314 3300005545 Unclassified 620
70 Ga0070696_100002080 3300005546 Bacteria 13143
71 Ga0070696_100013690 3300005546 Bacteria 5447
72 Ga0070696_100158409 3300005546 Bacteria 1667
73 Ga0070696_100315095 3300005546 Bacteria 1202
74 Ga0070696_100322594 3300005546 Bacteria 1189
75 Ga0070696_101438877 3300005546 Unclassified 588
76 Ga0070693_100403145 3300005547 Bacteria 949
77 Ga0070693_100430581 3300005547 Unclassified 921
78 Ga0070693_100451774 3300005547 Bacteria 902
79 Ga0070693_101168837 3300005547 Unclassified 590
80 Ga0070665_100143976 3300005548 Bacteria 2387
81 Ga0070704_100033082 3300005549 Bacteria 3494
82 Ga0070704_100039661 3300005549 Bacteria 3235
83 Ga0070704_101780679 3300005549 Bacteria 570
84 Ga0070704_101884127 3300005549 Unclassified 554
85 Ga0068855_100645752 3300005563 Bacteria 1137
86 Ga0070664_100005230 3300005564 Bacteria 10411
87 Ga0068854_100041829 3300005578 Bacteria 3240
88 Ga0068854_102131125 3300005578 Unclassified 518
89 Ga0068856_102143725 3300005614 Unclassified 568
90 Ga0070702_100259710 3300005615 Bacteria 1182
91 Ga0070702_100802799 3300005615 Bacteria 728
92 Ga0070702_101706557 3300005615 Unclassified 524
93 Ga0068852_100103368 3300005616 Bacteria 2576
94 Ga0068852_100117789 3300005616 Bacteria 2426
95 Ga0068859_100778688 3300005617 Bacteria 1045
96 Ga0068864_100062790 3300005618 Bacteria 3219
97 Ga0068864_100703999 3300005618 Bacteria 987
98 Ga0068861_101066598 3300005719 Bacteria 775
99 Ga0068861_101401254 3300005719 Bacteria 683
100 Ga0068851_10032475 3300005834 Bacteria 2597
101 Ga0068870_10103306 3300005840 Bacteria 1615
102 Ga0068870_11159196 3300005840 Unclassified 558
103 Ga0068858_100299891 3300005842 Bacteria 1533
104 Ga0068860_100789073 3300005843 Bacteria 963
105 Ga0068862_102080388 3300005844 Unclassified 579
106 Ga0081539_10001863 3300005985 Bacteria 33168
107 Ga0070715_10580159 3300006163 Unclassified 654
108 Ga0075366_10380945 3300006195 Bacteria 867
109 Ga0075366_10713370 3300006195 Unclassified 623
110 Ga0097621_100061307 3300006237 Bacteria 3085
111 Ga0097621_101171277 3300006237 Bacteria 723
112 Ga0097621_101977056 3300006237 Unclassified 557
113 Ga0068871_100054820 3300006358 Bacteria 3235
114 Ga0068871_101435557 3300006358 Unclassified 651
115 Ga0068871_101557675 3300006358 Bacteria 625
116 Ga0075430_100000762 3300006846 Bacteria 24850
117 Ga0075430_100718616 3300006846 Bacteria 823
118 Ga0075431_100032295 3300006847 Bacteria 5395
119 Ga0075431_100329083 3300006847 Unclassified 1539
120 Ga0075433_10030372 3300006852 Bacteria 4610
121 Ga0075433_10163878 3300006852 Bacteria 1979
122 Ga0075434_100002625 3300006871 Bacteria 15852
123 Ga0075434_102091415 3300006871 Bacteria 571
124 Ga0075429_100052125 3300006880 Bacteria 3560
125 Ga0068865_100948889 3300006881 Bacteria 750
126 Ga0075436_100000603 3300006914 Bacteria 23562
127 Ga0075436_100002515 3300006914 Bacteria 12610
128 Ga0075436_100008101 3300006914 Bacteria 7194
129 Ga0075436_100053209 3300006914 Bacteria 2795
130 Ga0075436_100167425 3300006914 Bacteria 1551
131 Ga0097620_100778686 3300006931 Bacteria 1045
132 Ga0075435_100000089 3300007076 Bacteria 48555
133 Ga0075435_100015168 3300007076 Bacteria 5786
134 Ga0075435_100608160 3300007076 Bacteria 948
135 Ga0099794_10070459 3300007265 Bacteria 1712
136 Ga0099794_10418945 3300007265 Bacteria 700
137 Ga0111539_10023116 3300009094 Bacteria 7635
138 Ga0111539_10330593 3300009094 Bacteria 1774
139 Ga0105245_11453553 3300009098 Bacteria 736
140 Ga0114129_11117082 3300009147 Bacteria 986
141 Ga0114129_11490088 3300009147 Bacteria 832
142 Ga0114129_11868878 3300009147 Bacteria 729
143 Ga0105242_10478574 3300009176 Unclassified 1180
144 Ga0105242_12285643 3300009176 Unclassified 587
145 Ga0105248_10254312 3300009177 Bacteria 1977
146 Ga0105248_11250571 3300009177 Bacteria 839
147 Ga0105239_10948590 3300010375 Bacteria 988
148 Ga0157371_10335086 3300013102 Bacteria 1100
149 Ga0157369_10317641 3300013105 Bacteria 1619
150 Ga0157374_10136911 3300013296 Bacteria 2374
151 Ga0163162_13398014 3300013306 Unclassified 508
152 Ga0157372_10018330 3300013307 Bacteria 7524
153 Ga0157375_13740312 3300013308 Unclassified 506
154 Ga0157377_10060913 3300014745 Bacteria 2155
155 Ga0157377_11177841 3300014745 Unclassified 592
156 Ga0157379_11687667 3300014968 Bacteria 620
157 Ga0157376_10165650 3300014969 Bacteria 2008
158 Ga0157376_11613784 3300014969 Bacteria 683
159 Ga0207656_10023949 3300025321 Bacteria 2464
160 Ga0207692_10174052 3300025898 Bacteria 1249
161 Ga0207688_10064627 3300025901 Bacteria 2066
162 Ga0207680_10219215 3300025903 Bacteria 1304
163 Ga0207643_10109163 3300025908 Bacteria 1629
164 Ga0207643_10553049 3300025908 Bacteria 738
165 Ga0207705_10132578 3300025909 Bacteria 1855
166 Ga0207684_10650070 3300025910 Bacteria 898
167 Ga0207684_10992543 3300025910 Bacteria 703
168 Ga0207707_10003001 3300025912 Bacteria 15006
169 Ga0207663_10499580 3300025916 Bacteria 945
170 Ga0207663_10976294 3300025916 Unclassified 679
171 Ga0207663_11360281 3300025916 Bacteria 572
172 Ga0207660_10177903 3300025917 Bacteria 1651
173 Ga0207662_10094029 3300025918 Bacteria 1848
174 Ga0207662_10123321 3300025918 Bacteria 1626
175 Ga0207649_10079842 3300025920 Bacteria 2114
176 Ga0207646_10469099 3300025922 Bacteria 1135
177 Ga0207681_10600770 3300025923 Bacteria 909
178 Ga0207650_10199663 3300025925 Bacteria 1601
179 Ga0207650_10656204 3300025925 Bacteria 885
180 Ga0207659_10010425 3300025926 Bacteria 5841
181 Ga0207659_11364090 3300025926 Bacteria 608
182 Ga0207664_10585256 3300025929 Bacteria 1002
183 Ga0207644_10714049 3300025931 Unclassified 836
184 Ga0207706_11549746 3300025933 Unclassified 539
185 Ga0207686_11556648 3300025934 Bacteria 545
186 Ga0207709_11405234 3300025935 Bacteria 578
187 Ga0207670_10266961 3300025936 Bacteria 1329
188 Ga0207670_10399731 3300025936 Bacteria 1098
189 Ga0207670_10774281 3300025936 Bacteria 798
190 Ga0207704_10273349 3300025938 Bacteria 1280
191 Ga0207665_10086265 3300025939 Bacteria 2167
192 Ga0207689_10065652 3300025942 Bacteria 2985
193 Ga0207661_10019509 3300025944 Bacteria 5057
194 Ga0207679_11473809 3300025945 Unclassified 624
195 Ga0207667_10324629 3300025949 Bacteria 1572
196 Ga0207651_10111204 3300025960 Bacteria 2057
197 Ga0207651_10310267 3300025960 Unclassified 1315
198 Ga0207651_10557511 3300025960 Bacteria 997
199 Ga0207640_10256782 3300025981 Bacteria 1359
200 Ga0207640_11950851 3300025981 Unclassified 532
201 Ga0207677_10173046 3300026023 Bacteria 1691
202 Ga0207677_10250939 3300026023 Bacteria 1437
203 Ga0207677_10702671 3300026023 Bacteria 897
204 Ga0207703_10799019 3300026035 Bacteria 901
205 Ga0207708_10208080 3300026075 Bacteria 1563
206 Ga0207708_10825717 3300026075 Unclassified 799
207 Ga0207708_11292659 3300026075 Bacteria 639
208 Ga0207702_10044244 3300026078 Bacteria 3742
209 Ga0207702_12189634 3300026078 Bacteria 542
210 Ga0207641_11185171 3300026088 Bacteria 763
211 Ga0207648_10379370 3300026089 Bacteria 1278
212 Ga0207648_11104375 3300026089 Bacteria 744
213 Ga0207676_10580268 3300026095 Bacteria 1075
214 Ga0207676_12451083 3300026095 Unclassified 518
215 Ga0207675_100385734 3300026118 Bacteria 1378
216 Ga0207675_101311030 3300026118 Bacteria 744
217 Ga0207683_10102344 3300026121 Bacteria 2558
218 Ga0207683_10863090 3300026121 Unclassified 840
219 Ga0207698_11150826 3300026142 Bacteria 789
220 Ga0209969_1009241 3300027360 Bacteria 1403
221 Ga0209967_1016876 3300027364 Bacteria 1050
222 Ga0209967_1023295 3300027364 Bacteria 911
223 Ga0209981_1024830 3300027378 Bacteria 866
224 Ga0209996_1008695 3300027395 Bacteria 1333
225 Ga0210000_1000752 3300027462 Bacteria 4489
226 Ga0210000_1006730 3300027462 Bacteria 1676
227 Ga0209995_1001148 3300027471 Bacteria 4070
228 Ga0209968_1001709 3300027526 Bacteria 3317
229 Ga0209968_1009350 3300027526 Bacteria 1500
230 Ga0209999_1001859 3300027543 Bacteria 3674
231 Ga0209999_1004143 3300027543 Bacteria 2609
232 Ga0209999_1056457 3300027543 Bacteria 745
233 Ga0209970_1010653 3300027614 Unclassified 1505
234 Ga0209971_1003137 3300027682 Bacteria 3948
235 Ga0209971_1015242 3300027682 Bacteria 1822
236 Ga0209974_10039118 3300027876 Bacteria 1578
237 Ga0207428_10028825 3300027907 Bacteria 4608
238 Ga0268266_10578185 3300028379 Bacteria 1078
239 Ga0268264_10786590 3300028381 Bacteria 950
240 Ga0307408_100326289 3300031548 Bacteria 1295
241 Ga0307405_11889926 3300031731 Unclassified 532
242 Ga0307413_11211887 3300031824 Bacteria 657
243 Ga0307406_10330037 3300031901 Bacteria 1184
244 Ga0307406_10433790 3300031901 Bacteria 1050
245 Ga0307406_11781381 3300031901 Bacteria 547
246 Ga0307412_11113449 3300031911 Bacteria 703
247 Ga0307409_100186747 3300031995 Bacteria 1841
248 Ga0307409_101828801 3300031995 Bacteria 637
249 Ga0307416_100073180 3300032002 Bacteria 2856
250 Ga0307416_100712781 3300032002 Bacteria 1093
251 Ga0307411_10480438 3300032005 Bacteria 1046
252 Ga0307411_10579765 3300032005 Bacteria 961
253 Ga0307411_10823847 3300032005 Bacteria 819
254 Ga0307415_100116349 3300032126 Bacteria 1995
255 Ga0307415_101192528 3300032126 Bacteria 717
256 Ga0373930_0060391 3300034816 Unclassified 845
257 Ga0373926_0002727 3300035083 Bacteria 5631
258 Ga0373929_0119115 3300035085 Unclassified 682
259 Ga0373934_0018924 3300035086 Bacteria 2639
260 Ga0373940_0294884 3300035088 Unclassified 557
261 Ga0373944_0161837 3300035089 Bacteria 794
262 Ga0373951_0031159 3300035091 Bacteria 1257
263 Ga0373952_0006875 3300035092 Bacteria 2118
264 Ga0373952_0075597 3300035092 Unclassified 850
265 Ga0373923_0215844 3300035111 Bacteria 890
266 Ga0373936_0008202 3300035113 Bacteria 3925
267 Ga0373939_0108856 3300035114 Unclassified 962
268 Ga0373939_0343893 3300035114 Bacteria 605
269 Ga0373941_0075941 3300035115 Bacteria 1125
270 Ga0373941_0105279 3300035115 Unclassified 987
271 Ga0373941_0144268 3300035115 Unclassified 868
272 Ga0373953_0539275 3300035117 Unclassified 518
273 Ga0373954_0000052 3300035118 Bacteria 41421
274 Ga0373954_0091444 3300035118 Bacteria 1462
275 Ga0373957_0022860 3300035120 Bacteria 2231
276 Ga0373960_0032587 3300035121 Bacteria 1464
277 Ga0373960_0059849 3300035121 Bacteria 1153
278 Ga0373943_0024809 3300035170 Bacteria 2798
279 Ga0373946_0024068 3300035171 Bacteria 2383
280 Ga0373955_0033297 3300035172 Bacteria 2713
281 Ga0373955_0168029 3300035172 Bacteria 1297
282 Ga0373942_0040679 3300035207 Unclassified 1268
283 Ga0373961_0034864 3300035241 Bacteria 1425
284 Ga0373962_0039360 3300035242 Bacteria 1326
285 Ga0373962_0158433 3300035242 Unclassified 745
286 Ga0373924_0027660 3300035410 Bacteria 2256
287 Ga0373924_0038267 3300035410 Bacteria 1956
288 Ga0373924_0188984 3300035410 Bacteria 907
289 Ga0373931_0059839 3300035691 Bacteria 2049
290 Ga0373931_0096223 3300035691 Bacteria 1658
291 Ga0373931_0165167 3300035691 Bacteria 1300
292 Ga0373931_0345815 3300035691 Bacteria 930
293 Ga0373931_0365234 3300035691 Bacteria 906
294 Ga0373935_0053758 3300035692 Bacteria 2562
295 Ga0373935_0638765 3300035692 Bacteria 780
296 Ga0373935_0831663 3300035692 Bacteria 682
297 Ga0373927_0123990 3300035695 Bacteria 1686
298 Ga0373927_0804517 3300035695 Bacteria 621
299 Ga0373933_0002126 3300035724 Bacteria 11383
300 Ga0373933_0008680 3300035724 Bacteria 5542
301 Ga0373947_0057276 3300035725 Bacteria 2358
302 Ga0373937_0000645 3300036401 Bacteria 30604
303 Ga0373937_0017644 3300036401 Bacteria 6366
304 Ga0373937_0118958 3300036401 Bacteria 2461
305 Ga0373937_0614973 3300036401 Bacteria 1031
306 Ga0373925_0051431 3300037068 Bacteria 3075
307 Ga0436360_0354348 3300039438 Unclassified 585
308 Ga0439439_0029870 3300041406 Bacteria 1384
309 Ga0439453_0095103 3300041408 Bacteria 658
310 Ga0439453_0096831 3300041408 Unclassified 654
311 Ga0451807_1600787 3300041486 Bacteria 619
312 Ga0451807_1843495 3300041486 Bacteria 790
313 Ga0451839_0569028 3300041496 Unclassified 511
314 Ga0439441_004064 3300042001 Bacteria 2196
315 Ga0439441_008147 3300042001 Bacteria 1705
316 Ga0439443_003534 3300042003 Bacteria 1977
317 Ga0439456_042819 3300042013 Bacteria 983
318 Ga0439462_0087978 3300042015 Bacteria 851
319 Ga0450923_037104 3300042125 Bacteria 1013
320 Ga0450902_101715 3300042137 Unclassified 511
321 Ga0439446_0212777 3300042156 Unclassified 656
322 Ga0439435_0000198 3300042436 Bacteria 8497
323 Ga0439435_0036754 3300042436 Bacteria 1354
324 Ga0439444_0001686 3300042437 Bacteria 2914
325 Ga0439460_0000008 3300042461 Bacteria 30223
326 Ga0453683_0836485 3300044673 Bacteria 607
327 Ga0466960_0109761 3300044901 Bacteria 1432
328 Ga0466960_0782125 3300044901 Unclassified 577
329 Ga0451576_0652736 3300045051 Bacteria 1105
330 Ga0451576_0956901 3300045051 Unclassified 898
331 Ga0451576_1079350 3300045051 Bacteria 840
332 Ga0451576_1977939 3300045051 Unclassified 601
333 Ga0495592_0028813 3300046454 Bacteria 4202
334 Ga0495603_0001057 3300046455 Bacteria 15967
335 Ga0495641_0036759 3300046461 Bacteria 2299
336 Ga0495651_0342969 3300046462 Bacteria 989
337 Ga0495653_0095687 3300046463 Bacteria 2161
338 Ga0495580_0003042 3300046472 Bacteria 14357
339 Ga0495582_0014161 3300046473 Bacteria 4389
340 Ga0495664_0124999 3300046477 Bacteria 1556
341 Ga0495664_0413496 3300046477 Bacteria 809
342 Ga0495608_0001891 3300046511 Bacteria 14993
343 Ga0495608_0028404 3300046511 Bacteria 3802
344 Ga0495608_0191942 3300046511 Bacteria 1289
345 Ga0495608_0406613 3300046511 Bacteria 832
346 Ga0495618_0016060 3300046514 Bacteria 4573
347 Ga0495618_0282426 3300046514 Bacteria 1035
348 Ga0495628_0001953 3300046516 Bacteria 18701
349 Ga0495628_0405386 3300046516 Bacteria 995
350 Ga0495630_0013280 3300046517 Bacteria 5992
351 Ga0495630_0117452 3300046517 Bacteria 2017
352 Ga0495630_0140347 3300046517 Bacteria 1837
353 Ga0495630_0210280 3300046517 Bacteria 1485
354 Ga0495666_0015722 3300046526 Bacteria 3770
355 Ga0495642_0011770 3300046528 Bacteria 3370
356 Ga0495652_0040420 3300046529 Bacteria 4031
357 Ga0495652_0987367 3300046529 Bacteria 551
358 Ga0495640_0002780 3300046533 Bacteria 14073
359 Ga0495640_0033792 3300046533 Bacteria 3632
360 Ga0495586_0002472 3300046535 Bacteria 10024
361 Ga0495586_0038752 3300046535 Bacteria 2561
362 Ga0495586_0053946 3300046535 Bacteria 2178
363 Ga0495587_0053899 3300046536 Bacteria 2370
364 Ga0495598_0377400 3300046537 Bacteria 550
365 Ga0495621_0240235 3300046539 Bacteria 738
366 Ga0495645_0083994 3300046543 Bacteria 2281
367 Ga0495667_0000661 3300046559 Bacteria 22019
368 Ga0495667_0823530 3300046559 Unclassified 572
369 Ga0495656_0332878 3300046615 Bacteria 784
370 Ga0495634_0001760 3300046642 Bacteria 18738
371 Ga0495634_0121993 3300046642 Bacteria 1668
372 Ga0495635_0023374 3300046663 Bacteria 4308
373 Ga0495635_0134542 3300046663 Bacteria 1685
374 Ga0495657_0026094 3300046675 Bacteria 4142
375 Ga0495657_0404266 3300046675 Bacteria 803
376 Ga0495657_0561421 3300046675 Bacteria 662
377 Ga0495599_0016502 3300046678 Bacteria 4585
378 Ga0495623_0108790 3300046679 Bacteria 1682
379 Ga0495647_0007219 3300046681 Bacteria 3716
380 Ga0495647_0229094 3300046681 Unclassified 822
381 Ga0495658_0032953 3300046683 Bacteria 2833
382 Ga0495658_0200211 3300046683 Bacteria 1244
383 Ga0495658_0286066 3300046683 Bacteria 1041
384 Ga0495669_0020457 3300046684 Bacteria 2865
385 Ga0495613_0009924 3300046689 Bacteria 7078
386 Ga0495624_0087526 3300046690 Bacteria 1924
387 Ga0495600_0005970 3300046809 Bacteria 7371
388 Ga0495581_0016957 3300047315 Bacteria 4232
389 Ga0495581_0189395 3300047315 Bacteria 1203
390 Ga0495581_0239355 3300047315 Bacteria 1061
391 Ga0495604_0002542 3300047317 Bacteria 14570
392 Ga0495604_0589793 3300047317 Bacteria 713
393 Ga0495636_0501236 3300047318 Unclassified 587
394 Ga0495674_0182463 3300047319 Bacteria 1747
395 Ga0495674_0211922 3300047319 Bacteria 1604
396 Ga0495676_0665283 3300047321 Bacteria 675
397 Ga0495680_0002911 3300047322 Bacteria 17205
398 Ga0495675_0323058 3300047444 Bacteria 913
399 Ga0495675_0374947 3300047444 Bacteria 833
400 Ga0495684_0084720 3300047471 Bacteria 2404
401 Ga0495684_0272956 3300047471 Bacteria 1223
402 Ga0495593_0274739 3300047673 Bacteria 843
403 Ga0495602_0421494 3300048088 Bacteria 948
404 Ga0495615_0255349 3300048090 Unclassified 557
405 Ga0501291_009393 3300049514 Bacteria 1371
406 Ga0501291_028608 3300049514 Bacteria 928
407 Ga0501291_037943 3300049514 Bacteria 837
408 Ga0501297_010039 3300049520 Bacteria 1067
409 Ga0501299_148580 3300049522 Bacteria 589
410 Ga0501303_018346 3300049526 Bacteria 725
411 Ga0501303_022080 3300049526 Bacteria 686
412 Ga0501031_0416968 3300049568 Bacteria 868
413 Ga0501033_0069666 3300049570 Bacteria 2585
414 Ga0501036_0107244 3300049572 Bacteria 2362
415 Ga0501036_1005400 3300049572 Bacteria 682
416 Ga0501036_1169962 3300049572 Bacteria 627
417 Ga0501039_0068277 3300049575 Bacteria 2760
418 Ga0501040_0007394 3300049576 Bacteria 7112
419 Ga0501040_0015626 3300049576 Bacteria 5018
420 Ga0501040_0508332 3300049576 Bacteria 868
421 Ga0501041_0000908 3300049577 Bacteria 16021
422 Ga0501041_0082521 3300049577 Bacteria 1980
423 Ga0501042_0033113 3300049578 Bacteria 3663
424 Ga0501042_0260531 3300049578 Bacteria 1252
425 Ga0501042_0476503 3300049578 Unclassified 906
426 Ga0501043_0322636 3300049579 Bacteria 1177
427 Ga0501048_0157039 3300049582 Bacteria 1609
428 Ga0501067_0117974 3300049583 Bacteria 1476
429 Ga0501069_0055250 3300049585 Bacteria 2212
430 Ga0501069_0858001 3300049585 Bacteria 552
431 Ga0501070_1090489 3300049586 Bacteria 616
432 Ga0501071_0467830 3300049587 Bacteria 966
433 Ga0501071_0687620 3300049587 Bacteria 788
434 Ga0501071_0925164 3300049587 Bacteria 673
435 Ga0501072_0015294 3300049588 Bacteria 5884
436 Ga0501072_0078388 3300049588 Bacteria 2616
437 Ga0501072_0739262 3300049588 Bacteria 772
438 Ga0501074_0106739 3300049590 Bacteria 2005
439 Ga0501075_0050681 3300049591 Bacteria 3121
440 Ga0501075_0186259 3300049591 Bacteria 1583
441 Ga0501076_0651585 3300049592 Unclassified 869
442 Ga0501077_0069379 3300049593 Bacteria 2234
443 Ga0501077_0905828 3300049593 Unclassified 567
444 Ga0501217_061830 3300049661 Bacteria 1002
445 Ga0501233_213540 3300049668 Bacteria 567
446 Ga0501238_061156 3300049671 Bacteria 575
447 Ga0501249_106735 3300049679 Bacteria 674
448 Ga0501229_034932 3300049706 Bacteria 701
449 Ga0501229_073317 3300049706 Bacteria 539
450 Ga0501079_0025877 3300049741 Bacteria 4501
451 Ga0501079_0483758 3300049741 Bacteria 973
452 Ga0501079_0969635 3300049741 Unclassified 670
453 Ga0501080_0007436 3300049742 Bacteria 9889
454 Ga0501081_0612145 3300049743 Unclassified 816
455 Ga0501081_0618844 3300049743 Bacteria 811
456 Ga0501283_037426 3300049779 Bacteria 831
457 Ga0501283_079170 3300049779 Bacteria 616
458 Ga0501045_0052139 3300049824 Bacteria 2986
459 Ga0501045_0090703 3300049824 Bacteria 2258
460 Ga0501045_0267545 3300049824 Bacteria 1273
461 Ga0501200_04253 3300049849 Bacteria 650
462 nmdc:mga05p37_1349504_c1 3300050507 Bacteria 722
463 nmdc:mga05p37_1727927_c1 3300050507 Unclassified 608
464 nmdc:mga09592_1013400_c1 3300050508 Unclassified 694
465 nmdc:mga09592_189086_c1 3300050508 Bacteria 1782
466 nmdc:mga09592_379145_c1 3300050508 Bacteria 1223
467 nmdc:mga0qj67_13031_c1 3300050509 Bacteria 6277
468 nmdc:mga0qj67_252562_c1 3300050509 Bacteria 1431
469 nmdc:mga06r32_1190330_c1 3300050510 Unclassified 709
470 nmdc:mga06r32_204633_c1 3300050510 Bacteria 1962
471 nmdc:mga06r32_944444_c1 3300050510 Bacteria 817
472 nmdc:mga08y16_31837_c1 3300050511 Bacteria 5546
473 nmdc:mga0n895_1551_c1 3300050512 Bacteria 17250
474 nmdc:mga0n895_41094_c1 3300050512 Bacteria 4495
475 nmdc:mga0n895_539645_c1 3300050512 Bacteria 1173
476 nmdc:mga0n895_837272_c1 3300050512 Bacteria 908
477 nmdc:mga0rr50_128_c1 3300050513 Bacteria 41482
478 nmdc:mga0rr50_136899_c1 3300050513 Bacteria 1967
479 nmdc:mga0rr50_407622_c1 3300050513 Bacteria 1149
480 nmdc:mga0rr50_850442_c1 3300050513 Unclassified 778
481 nmdc:mga08x19_21130_c1 3300050514 Bacteria 4014
482 nmdc:mga08x19_32687_c1 3300050514 Bacteria 3281
483 nmdc:mga08x19_39521_c1 3300050514 Bacteria 2999
484 nmdc:mga08x19_44248_c1 3300050514 Bacteria 2842
485 nmdc:mga08x19_54389_c1 3300050514 Bacteria 2577
486 nmdc:mga08x19_762_c1 3300050514 Bacteria 20508
487 nmdc:mga08x19_9930_c1 3300050514 Bacteria 5704
488 nmdc:mga0a205_1116_c1 3300050515 Bacteria 22232
489 nmdc:mga0a205_181055_c1 3300050515 Bacteria 2002
490 Ga0495601_0004787 3300053077 Bacteria 7849
491 Ga0495601_0581767 3300053077 Unclassified 719
492 Ga0495619_0027542 3300053085 Bacteria 3661
493 Ga0495619_0092985 3300053085 Bacteria 2044
494 Ga0500566_0065186 3300053094 Bacteria 2055
495 Ga0590075_220950 3300059424 Bacteria 502
496 Ga0501082_0021131 3300060353 Bacteria 5613
497 Ga0501082_1821717 3300060353 Bacteria 531
498 Ga0530510_0005523 3300061734 Bacteria 8757
499 Ga0530510_0949820 3300061734 Bacteria 657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027876 Ga0209974_10039118 Ga0209974_100391182 104
2 3300005439 Ga0070711_100485069 Ga0070711_1004850692 109
3 3300005547 Ga0070693_100430581 Ga0070693_1004305812 109
4 3300025916 Ga0207663_10976294 Ga0207663_109762941 109
5 3300026089 Ga0207648_11104375 Ga0207648_111043751 110
6 3300005340 Ga0070689_100029666 Ga0070689_1000296663 112
7 3300005438 Ga0070701_10526099 Ga0070701_105260992 112
8 3300005544 Ga0070686_101312352 Ga0070686_1013123522 112
9 3300005547 Ga0070693_100403145 Ga0070693_1004031452 112
10 3300006846 Ga0075430_100718616 Ga0075430_1007186162 112
11 3300025910 Ga0207684_10650070 Ga0207684_106500702 112
12 3300025936 Ga0207670_10774281 Ga0207670_107742812 112
13 3300027364 Ga0209967_1016876 Ga0209967_10168761 112
14 3300027526 Ga0209968_1009350 Ga0209968_10093502 112
15 3300027543 Ga0209999_1004143 Ga0209999_10041432 112
16 3300031824 Ga0307413_11211887 Ga0307413_112118872 112
17 3300031901 Ga0307406_10330037 Ga0307406_103300372 112
18 3300032002 Ga0307416_100712781 Ga0307416_1007127812 112
19 3300032126 Ga0307415_100116349 Ga0307415_1001163492 112
20 3300035117 Ga0373953_0539275 Ga0373953_0539275_142_480 112
21 3300036401 Ga0373937_0118958 Ga0373937_0118958_1524_1862 112
22 3300039438 Ga0436360_0354348 Ga0436360_0354348_145_510 112
23 3300046454 Ga0495592_0028813 Ga0495592_0028813_483_821 112
24 3300046461 Ga0495641_0036759 Ga0495641_0036759_1643_1981 112
25 3300046463 Ga0495653_0095687 Ga0495653_0095687_1345_1683 112
26 3300046477 Ga0495664_0124999 Ga0495664_0124999_565_903 112
27 3300046511 Ga0495608_0001891 Ga0495608_0001891_7357_7695 112
28 3300046514 Ga0495618_0016060 Ga0495618_0016060_537_875 112
29 3300046516 Ga0495628_0001953 Ga0495628_0001953_11973_12311 112
30 3300046517 Ga0495630_0013280 Ga0495630_0013280_3466_3804 112
31 3300046526 Ga0495666_0015722 Ga0495666_0015722_2398_2736 112
32 3300046529 Ga0495652_0040420 Ga0495652_0040420_3466_3804 112
33 3300046533 Ga0495640_0002780 Ga0495640_0002780_4537_4875 112
34 3300046535 Ga0495586_0002472 Ga0495586_0002472_8375_8713 112
35 3300046536 Ga0495587_0053899 Ga0495587_0053899_1633_1971 112
36 3300046539 Ga0495621_0240235 Ga0495621_0240235_120_461 112
37 3300046543 Ga0495645_0083994 Ga0495645_0083994_1837_2175 112
38 3300046559 Ga0495667_0000661 Ga0495667_0000661_11777_12115 112
39 3300046642 Ga0495634_0001760 Ga0495634_0001760_11813_12151 112
40 3300046663 Ga0495635_0023374 Ga0495635_0023374_1575_1913 112
41 3300046675 Ga0495657_0561421 Ga0495657_0561421_253_591 112
42 3300046678 Ga0495599_0016502 Ga0495599_0016502_1544_1882 112
43 3300046681 Ga0495647_0229094 Ga0495647_0229094_388_726 112
44 3300046683 Ga0495658_0200211 Ga0495658_0200211_547_885 112
45 3300046689 Ga0495613_0009924 Ga0495613_0009924_3044_3382 112
46 3300046809 Ga0495600_0005970 Ga0495600_0005970_5595_5933 112
47 3300047315 Ga0495581_0189395 Ga0495581_0189395_636_974 112
48 3300047317 Ga0495604_0002542 Ga0495604_0002542_11371_11709 112
49 3300047319 Ga0495674_0211922 Ga0495674_0211922_96_434 112
50 3300047322 Ga0495680_0002911 Ga0495680_0002911_4600_4938 112
51 3300047444 Ga0495675_0323058 Ga0495675_0323058_19_357 112
52 3300047471 Ga0495684_0084720 Ga0495684_0084720_1592_1930 112
53 3300048088 Ga0495602_0421494 Ga0495602_0421494_551_889 112
54 3300049514 Ga0501291_009393 Ga0501291_009393_682_1020 112
55 3300049520 Ga0501297_010039 Ga0501297_010039_69_407 112
56 3300049526 Ga0501303_018346 Ga0501303_018346_354_692 112
57 3300049568 Ga0501031_0416968 Ga0501031_0416968_389_730 112
58 3300049572 Ga0501036_1169962 Ga0501036_1169962_74_415 112
59 3300049588 Ga0501072_0739262 Ga0501072_0739262_86_424 112
60 3300049591 Ga0501075_0050681 Ga0501075_0050681_327_668 112
61 3300049679 Ga0501249_106735 Ga0501249_106735_118_456 112
62 3300049706 Ga0501229_034932 Ga0501229_034932_129_467 112
63 3300049706 Ga0501229_073317 Ga0501229_073317_174_512 112
64 3300049741 Ga0501079_0483758 Ga0501079_0483758_400_738 112
65 3300049741 Ga0501079_0969635 Ga0501079_0969635_317_658 112
66 3300049779 Ga0501283_037426 Ga0501283_037426_33_371 112
67 3300049849 Ga0501200_04253 Ga0501200_04253_187_525 112
68 3300050509 nmdc:mga0qj67_13031_c1 nmdc:mga0qj67_13031_c1_376_714 112
69 3300053077 Ga0495601_0004787 Ga0495601_0004787_4598_4936 112
70 3300053085 Ga0495619_0027542 Ga0495619_0027542_610_948 112
71 3300053094 Ga0500566_0065186 Ga0500566_0065186_1691_2029 112
72 3300061734 Ga0530510_0949820 Ga0530510_0949820_126_467 112
73 3300005295 Ga0065707_10191332 Ga0065707_101913321 113
74 3300005329 Ga0070683_100051185 Ga0070683_1000511854 113
75 3300005330 Ga0070690_100117755 Ga0070690_1001177553 113
76 3300005334 Ga0068869_100086077 Ga0068869_1000860772 113
77 3300005337 Ga0070682_100233164 Ga0070682_1002331642 113
78 3300005340 Ga0070689_100341583 Ga0070689_1003415832 113
79 3300005343 Ga0070687_100118586 Ga0070687_1001185862 113
80 3300005343 Ga0070687_100151901 Ga0070687_1001519012 113
81 3300005343 Ga0070687_100287497 Ga0070687_1002874972 113
82 3300005364 Ga0070673_100368667 Ga0070673_1003686672 113
83 3300005364 Ga0070673_100951106 Ga0070673_1009511062 113
84 3300005367 Ga0070667_100535788 Ga0070667_1005357882 113
85 3300005441 Ga0070700_100717083 Ga0070700_1007170832 113
86 3300005444 Ga0070694_100481495 Ga0070694_1004814952 113
87 3300005444 Ga0070694_101717797 Ga0070694_1017177971 113
88 3300005445 Ga0070708_100054938 Ga0070708_1000549384 113
89 3300005458 Ga0070681_11516317 Ga0070681_115163172 113
90 3300005518 Ga0070699_100016436 Ga0070699_1000164363 113
91 3300005518 Ga0070699_100056007 Ga0070699_1000560072 113
92 3300005535 Ga0070684_100032377 Ga0070684_1000323772 113
93 3300005536 Ga0070697_100003905 Ga0070697_1000039055 113
94 3300005536 Ga0070697_100011057 Ga0070697_1000110577 113
95 3300005544 Ga0070686_100574699 Ga0070686_1005746991 113
96 3300005545 Ga0070695_100004450 Ga0070695_1000044508 113
97 3300005546 Ga0070696_100002080 Ga0070696_1000020804 113
98 3300005547 Ga0070693_100451774 Ga0070693_1004517742 113
99 3300005549 Ga0070704_101884127 Ga0070704_1018841271 113
100 3300005563 Ga0068855_100645752 Ga0068855_1006457522 113
101 3300005614 Ga0068856_102143725 Ga0068856_1021437251 113
102 3300005615 Ga0070702_100259710 Ga0070702_1002597102 113
103 3300005616 Ga0068852_100117789 Ga0068852_1001177893 113
104 3300005617 Ga0068859_100778688 Ga0068859_1007786882 113
105 3300005618 Ga0068864_100062790 Ga0068864_1000627905 113
106 3300005719 Ga0068861_101401254 Ga0068861_1014012542 113
107 3300005842 Ga0068858_100299891 Ga0068858_1002998912 113
108 3300005843 Ga0068860_100789073 Ga0068860_1007890732 113
109 3300005844 Ga0068862_102080388 Ga0068862_1020803881 113
110 3300005985 Ga0081539_10001863 Ga0081539_100018638 113
111 3300006237 Ga0097621_100061307 Ga0097621_1000613073 113
112 3300006358 Ga0068871_100054820 Ga0068871_1000548202 113
113 3300006358 Ga0068871_101435557 Ga0068871_1014355572 113
114 3300006852 Ga0075433_10030372 Ga0075433_100303723 113
115 3300006871 Ga0075434_100002625 Ga0075434_10000262516 113
116 3300006871 Ga0075434_102091415 Ga0075434_1020914152 113
117 3300006914 Ga0075436_100000603 Ga0075436_10000060326 113
118 3300006914 Ga0075436_100002515 Ga0075436_1000025155 113
119 3300006914 Ga0075436_100008101 Ga0075436_1000081014 113
120 3300006914 Ga0075436_100167425 Ga0075436_1001674252 113
121 3300006931 Ga0097620_100778686 Ga0097620_1007786862 113
122 3300007076 Ga0075435_100000089 Ga0075435_10000008916 113
123 3300007076 Ga0075435_100608160 Ga0075435_1006081602 113
124 3300007265 Ga0099794_10070459 Ga0099794_100704592 113
125 3300009094 Ga0111539_10023116 Ga0111539_100231165 113
126 3300009098 Ga0105245_11453553 Ga0105245_114535531 113
127 3300009176 Ga0105242_12285643 Ga0105242_122856432 113
128 3300009177 Ga0105248_10254312 Ga0105248_102543122 113
129 3300010375 Ga0105239_10948590 Ga0105239_109485901 113
130 3300013308 Ga0157375_13740312 Ga0157375_137403122 113
131 3300014745 Ga0157377_11177841 Ga0157377_111778412 113
132 3300014968 Ga0157379_11687667 Ga0157379_116876672 113
133 3300014969 Ga0157376_10165650 Ga0157376_101656503 113
134 3300025918 Ga0207662_10094029 Ga0207662_100940292 113
135 3300025918 Ga0207662_10123321 Ga0207662_101233212 113
136 3300025929 Ga0207664_10585256 Ga0207664_105852562 113
137 3300025931 Ga0207644_10714049 Ga0207644_107140492 113
138 3300025936 Ga0207670_10266961 Ga0207670_102669612 113
139 3300025939 Ga0207665_10086265 Ga0207665_100862652 113
140 3300025944 Ga0207661_10019509 Ga0207661_100195095 113
141 3300025949 Ga0207667_10324629 Ga0207667_103246292 113
142 3300025960 Ga0207651_10310267 Ga0207651_103102672 113
143 3300025981 Ga0207640_11950851 Ga0207640_119508512 113
144 3300026023 Ga0207677_10702671 Ga0207677_107026712 113
145 3300026035 Ga0207703_10799019 Ga0207703_107990192 113
146 3300026075 Ga0207708_11292659 Ga0207708_112926591 113
147 3300026078 Ga0207702_10044244 Ga0207702_100442445 113
148 3300026078 Ga0207702_12189634 Ga0207702_121896341 113
149 3300026095 Ga0207676_12451083 Ga0207676_124510831 113
150 3300026118 Ga0207675_100385734 Ga0207675_1003857342 113
151 3300026118 Ga0207675_101311030 Ga0207675_1013110301 113
152 3300026142 Ga0207698_11150826 Ga0207698_111508262 113
153 3300027907 Ga0207428_10028825 Ga0207428_100288253 113
154 3300028381 Ga0268264_10786590 Ga0268264_107865902 113
155 3300031995 Ga0307409_100186747 Ga0307409_1001867471 113
156 3300034816 Ga0373930_0060391 Ga0373930_0060391_61_402 113
157 3300035085 Ga0373929_0119115 Ga0373929_0119115_234_575 113
158 3300035086 Ga0373934_0018924 Ga0373934_0018924_1556_1897 113
159 3300035091 Ga0373951_0031159 Ga0373951_0031159_423_764 113
160 3300035092 Ga0373952_0006875 Ga0373952_0006875_51_392 113
161 3300035092 Ga0373952_0075597 Ga0373952_0075597_486_830 113
162 3300035114 Ga0373939_0108856 Ga0373939_0108856_591_932 113
163 3300035114 Ga0373939_0343893 Ga0373939_0343893_60_401 113
164 3300035115 Ga0373941_0075941 Ga0373941_0075941_70_414 113
165 3300035115 Ga0373941_0105279 Ga0373941_0105279_421_762 113
166 3300035115 Ga0373941_0144268 Ga0373941_0144268_396_737 113
167 3300035118 Ga0373954_0000052 Ga0373954_0000052_23982_24323 113
168 3300035121 Ga0373960_0032587 Ga0373960_0032587_1049_1393 113
169 3300035121 Ga0373960_0059849 Ga0373960_0059849_326_667 113
170 3300035172 Ga0373955_0168029 Ga0373955_0168029_498_839 113
171 3300035207 Ga0373942_0040679 Ga0373942_0040679_186_527 113
172 3300035241 Ga0373961_0034864 Ga0373961_0034864_201_542 113
173 3300035242 Ga0373962_0039360 Ga0373962_0039360_302_643 113
174 3300035242 Ga0373962_0158433 Ga0373962_0158433_203_544 113
175 3300035410 Ga0373924_0038267 Ga0373924_0038267_537_878 113
176 3300035691 Ga0373931_0059839 Ga0373931_0059839_1613_1957 113
177 3300035691 Ga0373931_0165167 Ga0373931_0165167_484_825 113
178 3300035691 Ga0373931_0345815 Ga0373931_0345815_557_898 113
179 3300035691 Ga0373931_0365234 Ga0373931_0365234_278_619 113
180 3300035724 Ga0373933_0002126 Ga0373933_0002126_10526_10867 113
181 3300036401 Ga0373937_0000645 Ga0373937_0000645_17185_17526 113
182 3300041408 Ga0439453_0096831 Ga0439453_0096831_209_553 113
183 3300042001 Ga0439441_008147 Ga0439441_008147_533_877 113
184 3300042003 Ga0439443_003534 Ga0439443_003534_1488_1832 113
185 3300042156 Ga0439446_0212777 Ga0439446_0212777_161_502 113
186 3300042436 Ga0439435_0000198 Ga0439435_0000198_2715_3059 113
187 3300042437 Ga0439444_0001686 Ga0439444_0001686_1055_1399 113
188 3300042461 Ga0439460_0000008 Ga0439460_0000008_11291_11635 113
189 3300044901 Ga0466960_0109761 Ga0466960_0109761_182_523 113
190 3300044901 Ga0466960_0782125 Ga0466960_0782125_32_373 113
191 3300045051 Ga0451576_1977939 Ga0451576_1977939_131_472 113
192 3300046462 Ga0495651_0342969 Ga0495651_0342969_473_814 113
193 3300046511 Ga0495608_0028404 Ga0495608_0028404_2414_2755 113
194 3300046535 Ga0495586_0038752 Ga0495586_0038752_623_964 113
195 3300046675 Ga0495657_0026094 Ga0495657_0026094_2146_2487 113
196 3300047444 Ga0495675_0374947 Ga0495675_0374947_33_374 113
197 3300048090 Ga0495615_0255349 Ga0495615_0255349_34_375 113
198 3300049570 Ga0501033_0069666 Ga0501033_0069666_1586_1930 113
199 3300049576 Ga0501040_0007394 Ga0501040_0007394_3697_4041 113
200 3300049576 Ga0501040_0015626 Ga0501040_0015626_4456_4800 113
201 3300049577 Ga0501041_0082521 Ga0501041_0082521_1274_1618 113
202 3300049578 Ga0501042_0033113 Ga0501042_0033113_2788_3132 113
203 3300049579 Ga0501043_0322636 Ga0501043_0322636_498_842 113
204 3300049582 Ga0501048_0157039 Ga0501048_0157039_1239_1583 113
205 3300049743 Ga0501081_0618844 Ga0501081_0618844_157_501 113
206 3300049824 Ga0501045_0052139 Ga0501045_0052139_39_383 113
207 3300050511 nmdc:mga08y16_31837_c1 nmdc:mga08y16_31837_c1_4988_5329 113
208 3300050512 nmdc:mga0n895_1551_c1 nmdc:mga0n895_1551_c1_2234_2575 113
209 3300050512 nmdc:mga0n895_837272_c1 nmdc:mga0n895_837272_c1_335_676 113
210 3300050513 nmdc:mga0rr50_128_c1 nmdc:mga0rr50_128_c1_39279_39620 113
211 3300050513 nmdc:mga0rr50_407622_c1 nmdc:mga0rr50_407622_c1_35_376 113
212 3300050514 nmdc:mga08x19_21130_c1 nmdc:mga08x19_21130_c1_717_1058 113
213 3300050514 nmdc:mga08x19_32687_c1 nmdc:mga08x19_32687_c1_1276_1617 113
214 3300050514 nmdc:mga08x19_762_c1 nmdc:mga08x19_762_c1_13766_14107 113
215 3300050514 nmdc:mga08x19_9930_c1 nmdc:mga08x19_9930_c1_287_628 113
216 3300050515 nmdc:mga0a205_1116_c1 nmdc:mga0a205_1116_c1_3873_4214 113
217 3300027462 Ga0210000_1006730 Ga0210000_10067303 114
218 3300042015 Ga0439462_0087978 Ga0439462_0087978_49_393 114
219 3300042137 Ga0450902_101715 Ga0450902_101715_46_390 114
220 3300046615 Ga0495656_0332878 Ga0495656_0332878_396_773 114
221 3300049585 Ga0501069_0858001 Ga0501069_0858001_15_359 114
222 3300049586 Ga0501070_1090489 Ga0501070_1090489_108_452 114
223 3300049587 Ga0501071_0687620 Ga0501071_0687620_95_439 114
224 3300049671 Ga0501238_061156 Ga0501238_061156_33_377 114
225 3300005471 Ga0070698_102131915 Ga0070698_1021319151 115
226 3300005545 Ga0070695_101214314 Ga0070695_1012143142 115
227 3300005546 Ga0070696_100315095 Ga0070696_1003150952 115
228 3300006195 Ga0075366_10713370 Ga0075366_107133702 115
229 3300006847 Ga0075431_100329083 Ga0075431_1003290832 115
230 3300007265 Ga0099794_10418945 Ga0099794_104189452 115
231 3300025916 Ga0207663_10499580 Ga0207663_104995802 115
232 3300025933 Ga0207706_11549746 Ga0207706_115497462 115
233 3300027360 Ga0209969_1009241 Ga0209969_10092412 115
234 3300027364 Ga0209967_1023295 Ga0209967_10232951 115
235 3300027378 Ga0209981_1024830 Ga0209981_10248302 115
236 3300027395 Ga0209996_1008695 Ga0209996_10086952 115
237 3300027462 Ga0210000_1000752 Ga0210000_10007524 115
238 3300027471 Ga0209995_1001148 Ga0209995_10011484 115
239 3300027526 Ga0209968_1001709 Ga0209968_10017093 115
240 3300027543 Ga0209999_1001859 Ga0209999_10018595 115
241 3300027543 Ga0209999_1056457 Ga0209999_10564572 115
242 3300027614 Ga0209970_1010653 Ga0209970_10106532 115
243 3300027682 Ga0209971_1003137 Ga0209971_10031372 115
244 3300027682 Ga0209971_1015242 Ga0209971_10152422 115
245 3300032005 Ga0307411_10823847 Ga0307411_108238472 115
246 3300035083 Ga0373926_0002727 Ga0373926_0002727_3937_4284 115
247 3300035089 Ga0373944_0161837 Ga0373944_0161837_160_507 115
248 3300035113 Ga0373936_0008202 Ga0373936_0008202_1827_2174 115
249 3300035170 Ga0373943_0024809 Ga0373943_0024809_1413_1760 115
250 3300035171 Ga0373946_0024068 Ga0373946_0024068_616_963 115
251 3300035692 Ga0373935_0053758 Ga0373935_0053758_1726_2073 115
252 3300035695 Ga0373927_0123990 Ga0373927_0123990_1043_1390 115
253 3300035725 Ga0373947_0057276 Ga0373947_0057276_773_1120 115
254 3300037068 Ga0373925_0051431 Ga0373925_0051431_1039_1386 115
255 3300041408 Ga0439453_0095103 Ga0439453_0095103_146_496 115
256 3300041486 Ga0451807_1600787 Ga0451807_1600787_223_570 115
257 3300041486 Ga0451807_1843495 Ga0451807_1843495_174_524 115
258 3300042001 Ga0439441_004064 Ga0439441_004064_70_420 115
259 3300042013 Ga0439456_042819 Ga0439456_042819_256_606 115
260 3300042436 Ga0439435_0036754 Ga0439435_0036754_314_664 115
261 3300046455 Ga0495603_0001057 Ga0495603_0001057_15534_15881 115
262 3300046472 Ga0495580_0003042 Ga0495580_0003042_9371_9718 115
263 3300046473 Ga0495582_0014161 Ga0495582_0014161_2391_2738 115
264 3300046517 Ga0495630_0117452 Ga0495630_0117452_1343_1690 115
265 3300046681 Ga0495647_0007219 Ga0495647_0007219_3114_3461 115
266 3300046683 Ga0495658_0032953 Ga0495658_0032953_954_1301 115
267 3300046690 Ga0495624_0087526 Ga0495624_0087526_80_427 115
268 3300047315 Ga0495581_0016957 Ga0495581_0016957_1746_2093 115
269 3300047321 Ga0495676_0665283 Ga0495676_0665283_146_493 115
270 3300049514 Ga0501291_037943 Ga0501291_037943_132_482 115
271 3300049572 Ga0501036_0107244 Ga0501036_0107244_1121_1474 115
272 3300049572 Ga0501036_1005400 Ga0501036_1005400_223_573 115
273 3300049575 Ga0501039_0068277 Ga0501039_0068277_2224_2574 115
274 3300049576 Ga0501040_0508332 Ga0501040_0508332_106_459 115
275 3300049577 Ga0501041_0000908 Ga0501041_0000908_15258_15611 115
276 3300049578 Ga0501042_0260531 Ga0501042_0260531_601_954 115
277 3300049578 Ga0501042_0476503 Ga0501042_0476503_68_418 115
278 3300049587 Ga0501071_0467830 Ga0501071_0467830_243_593 115
279 3300049588 Ga0501072_0015294 Ga0501072_0015294_3372_3725 115
280 3300049588 Ga0501072_0078388 Ga0501072_0078388_532_885 115
281 3300049590 Ga0501074_0106739 Ga0501074_0106739_171_524 115
282 3300049591 Ga0501075_0186259 Ga0501075_0186259_932_1285 115
283 3300049592 Ga0501076_0651585 Ga0501076_0651585_366_719 115
284 3300049593 Ga0501077_0069379 Ga0501077_0069379_1579_1932 115
285 3300049593 Ga0501077_0905828 Ga0501077_0905828_81_431 115
286 3300049741 Ga0501079_0025877 Ga0501079_0025877_1034_1387 115
287 3300049742 Ga0501080_0007436 Ga0501080_0007436_6038_6391 115
288 3300049743 Ga0501081_0612145 Ga0501081_0612145_365_715 115
289 3300049824 Ga0501045_0090703 Ga0501045_0090703_1652_2005 115
290 3300049824 Ga0501045_0267545 Ga0501045_0267545_800_1150 115
291 3300050508 nmdc:mga09592_1013400_c1 nmdc:mga09592_1013400_c1_161_511 115
292 3300050510 nmdc:mga06r32_204633_c1 nmdc:mga06r32_204633_c1_581_931 115
293 3300059424 Ga0590075_220950 Ga0590075_220950_48_398 115
294 3300060353 Ga0501082_0021131 Ga0501082_0021131_89_439 115
295 3300060353 Ga0501082_1821717 Ga0501082_1821717_122_472 115
296 3300061734 Ga0530510_0005523 Ga0530510_0005523_3493_3846 115
297 3300005327 Ga0070658_10203150 Ga0070658_102031502 116
298 3300005329 Ga0070683_100031612 Ga0070683_1000316124 116
299 3300005331 Ga0070670_100041906 Ga0070670_1000419065 116
300 3300005335 Ga0070666_10700680 Ga0070666_107006801 116
301 3300005336 Ga0070680_100058520 Ga0070680_1000585202 116
302 3300005336 Ga0070680_100779376 Ga0070680_1007793762 116
303 3300005338 Ga0068868_100328276 Ga0068868_1003282762 116
304 3300005340 Ga0070689_100087538 Ga0070689_1000875382 116
305 3300005340 Ga0070689_100136219 Ga0070689_1001362192 116
306 3300005341 Ga0070691_10377201 Ga0070691_103772012 116
307 3300005345 Ga0070692_10134901 Ga0070692_101349012 116
308 3300005353 Ga0070669_100403612 Ga0070669_1004036122 116
309 3300005364 Ga0070673_100112543 Ga0070673_1001125432 116
310 3300005364 Ga0070673_100169292 Ga0070673_1001692922 116
311 3300005438 Ga0070701_10637537 Ga0070701_106375372 116
312 3300005438 Ga0070701_10764816 Ga0070701_107648162 116
313 3300005440 Ga0070705_100035134 Ga0070705_1000351343 116
314 3300005440 Ga0070705_100284141 Ga0070705_1002841412 116
315 3300005444 Ga0070694_100018713 Ga0070694_1000187134 116
316 3300005444 Ga0070694_100223414 Ga0070694_1002234142 116
317 3300005444 Ga0070694_100949481 Ga0070694_1009494811 116
318 3300005445 Ga0070708_101999136 Ga0070708_1019991362 116
319 3300005456 Ga0070678_100106708 Ga0070678_1001067082 116
320 3300005456 Ga0070678_102210288 Ga0070678_1022102881 116
321 3300005459 Ga0068867_100384507 Ga0068867_1003845072 116
322 3300005468 Ga0070707_100984274 Ga0070707_1009842741 116
323 3300005544 Ga0070686_100347225 Ga0070686_1003472252 116
324 3300005544 Ga0070686_101206764 Ga0070686_1012067641 116
325 3300005545 Ga0070695_100375390 Ga0070695_1003753901 116
326 3300005546 Ga0070696_100013690 Ga0070696_1000136901 116
327 3300005546 Ga0070696_101438877 Ga0070696_1014388771 116
328 3300005547 Ga0070693_101168837 Ga0070693_1011688372 116
329 3300005548 Ga0070665_100143976 Ga0070665_1001439763 116
330 3300005549 Ga0070704_100033082 Ga0070704_1000330825 116
331 3300005549 Ga0070704_100039661 Ga0070704_1000396612 116
332 3300005549 Ga0070704_101780679 Ga0070704_1017806792 116
333 3300005564 Ga0070664_100005230 Ga0070664_1000052304 116
334 3300005578 Ga0068854_100041829 Ga0068854_1000418294 116
335 3300005578 Ga0068854_102131125 Ga0068854_1021311252 116
336 3300005615 Ga0070702_101706557 Ga0070702_1017065571 116
337 3300005616 Ga0068852_100103368 Ga0068852_1001033682 116
338 3300005618 Ga0068864_100703999 Ga0068864_1007039992 116
339 3300005719 Ga0068861_101066598 Ga0068861_1010665982 116
340 3300005834 Ga0068851_10032475 Ga0068851_100324753 116
341 3300005840 Ga0068870_10103306 Ga0068870_101033062 116
342 3300005840 Ga0068870_11159196 Ga0068870_111591962 116
343 3300006195 Ga0075366_10380945 Ga0075366_103809452 116
344 3300006237 Ga0097621_101171277 Ga0097621_1011712772 116
345 3300006237 Ga0097621_101977056 Ga0097621_1019770562 116
346 3300006358 Ga0068871_101557675 Ga0068871_1015576751 116
347 3300006846 Ga0075430_100000762 Ga0075430_10000076220 116
348 3300006847 Ga0075431_100032295 Ga0075431_1000322954 116
349 3300006880 Ga0075429_100052125 Ga0075429_1000521252 116
350 3300006881 Ga0068865_100948889 Ga0068865_1009488892 116
351 3300009094 Ga0111539_10330593 Ga0111539_103305932 116
352 3300009147 Ga0114129_11490088 Ga0114129_114900882 116
353 3300009147 Ga0114129_11868878 Ga0114129_118688782 116
354 3300009176 Ga0105242_10478574 Ga0105242_104785742 116
355 3300009177 Ga0105248_11250571 Ga0105248_112505712 116
356 3300013102 Ga0157371_10335086 Ga0157371_103350862 116
357 3300013105 Ga0157369_10317641 Ga0157369_103176412 116
358 3300013296 Ga0157374_10136911 Ga0157374_101369113 116
359 3300013306 Ga0163162_13398014 Ga0163162_133980141 116
360 3300013307 Ga0157372_10018330 Ga0157372_100183303 116
361 3300014745 Ga0157377_10060913 Ga0157377_100609132 116
362 3300014969 Ga0157376_11613784 Ga0157376_116137842 116
363 3300025321 Ga0207656_10023949 Ga0207656_100239492 116
364 3300025898 Ga0207692_10174052 Ga0207692_101740522 116
365 3300025901 Ga0207688_10064627 Ga0207688_100646274 116
366 3300025903 Ga0207680_10219215 Ga0207680_102192152 116
367 3300025908 Ga0207643_10109163 Ga0207643_101091633 116
368 3300025908 Ga0207643_10553049 Ga0207643_105530492 116
369 3300025909 Ga0207705_10132578 Ga0207705_101325783 116
370 3300025917 Ga0207660_10177903 Ga0207660_101779032 116
371 3300025920 Ga0207649_10079842 Ga0207649_100798422 116
372 3300025922 Ga0207646_10469099 Ga0207646_104690992 116
373 3300025923 Ga0207681_10600770 Ga0207681_106007702 116
374 3300025925 Ga0207650_10199663 Ga0207650_101996632 116
375 3300025925 Ga0207650_10656204 Ga0207650_106562042 116
376 3300025926 Ga0207659_10010425 Ga0207659_100104252 116
377 3300025926 Ga0207659_11364090 Ga0207659_113640902 116
378 3300025934 Ga0207686_11556648 Ga0207686_115566481 116
379 3300025935 Ga0207709_11405234 Ga0207709_114052342 116
380 3300025936 Ga0207670_10399731 Ga0207670_103997312 116
381 3300025938 Ga0207704_10273349 Ga0207704_102733492 116
382 3300025942 Ga0207689_10065652 Ga0207689_100656522 116
383 3300025945 Ga0207679_11473809 Ga0207679_114738091 116
384 3300025960 Ga0207651_10111204 Ga0207651_101112042 116
385 3300025960 Ga0207651_10557511 Ga0207651_105575112 116
386 3300025981 Ga0207640_10256782 Ga0207640_102567822 116
387 3300026023 Ga0207677_10173046 Ga0207677_101730462 116
388 3300026023 Ga0207677_10250939 Ga0207677_102509392 116
389 3300026075 Ga0207708_10208080 Ga0207708_102080802 116
390 3300026075 Ga0207708_10825717 Ga0207708_108257172 116
391 3300026088 Ga0207641_11185171 Ga0207641_111851711 116
392 3300026089 Ga0207648_10379370 Ga0207648_103793702 116
393 3300026095 Ga0207676_10580268 Ga0207676_105802682 116
394 3300026121 Ga0207683_10102344 Ga0207683_101023442 116
395 3300026121 Ga0207683_10863090 Ga0207683_108630902 116
396 3300028379 Ga0268266_10578185 Ga0268266_105781852 116
397 3300031731 Ga0307405_11889926 Ga0307405_118899261 116
398 3300031901 Ga0307406_10433790 Ga0307406_104337902 116
399 3300031901 Ga0307406_11781381 Ga0307406_117813812 116
400 3300031911 Ga0307412_11113449 Ga0307412_111134492 116
401 3300031995 Ga0307409_101828801 Ga0307409_1018288012 116
402 3300032002 Ga0307416_100073180 Ga0307416_1000731802 116
403 3300032005 Ga0307411_10480438 Ga0307411_104804382 116
404 3300032126 Ga0307415_101192528 Ga0307415_1011925282 116
405 3300035088 Ga0373940_0294884 Ga0373940_0294884_120_470 116
406 3300035111 Ga0373923_0215844 Ga0373923_0215844_205_555 116
407 3300035118 Ga0373954_0091444 Ga0373954_0091444_589_939 116
408 3300035120 Ga0373957_0022860 Ga0373957_0022860_805_1155 116
409 3300035172 Ga0373955_0033297 Ga0373955_0033297_191_541 116
410 3300035410 Ga0373924_0027660 Ga0373924_0027660_13_363 116
411 3300035410 Ga0373924_0188984 Ga0373924_0188984_160_510 116
412 3300035692 Ga0373935_0831663 Ga0373935_0831663_301_651 116
413 3300035695 Ga0373927_0804517 Ga0373927_0804517_94_444 116
414 3300035724 Ga0373933_0008680 Ga0373933_0008680_5178_5528 116
415 3300036401 Ga0373937_0017644 Ga0373937_0017644_5618_5968 116
416 3300036401 Ga0373937_0614973 Ga0373937_0614973_231_581 116
417 3300041496 Ga0451839_0569028 Ga0451839_0569028_130_480 116
418 3300042125 Ga0450923_037104 Ga0450923_037104_69_419 116
419 3300044673 Ga0453683_0836485 Ga0453683_0836485_146_496 116
420 3300045051 Ga0451576_0956901 Ga0451576_0956901_345_695 116
421 3300045051 Ga0451576_1079350 Ga0451576_1079350_447_797 116
422 3300046477 Ga0495664_0413496 Ga0495664_0413496_301_651 116
423 3300046511 Ga0495608_0191942 Ga0495608_0191942_630_980 116
424 3300046511 Ga0495608_0406613 Ga0495608_0406613_395_745 116
425 3300046514 Ga0495618_0282426 Ga0495618_0282426_88_438 116
426 3300046516 Ga0495628_0405386 Ga0495628_0405386_387_737 116
427 3300046517 Ga0495630_0140347 Ga0495630_0140347_64_414 116
428 3300046517 Ga0495630_0210280 Ga0495630_0210280_881_1231 116
429 3300046528 Ga0495642_0011770 Ga0495642_0011770_731_1081 116
430 3300046529 Ga0495652_0987367 Ga0495652_0987367_157_507 116
431 3300046533 Ga0495640_0033792 Ga0495640_0033792_1515_1865 116
432 3300046535 Ga0495586_0053946 Ga0495586_0053946_1494_1844 116
433 3300046559 Ga0495667_0823530 Ga0495667_0823530_32_382 116
434 3300046642 Ga0495634_0121993 Ga0495634_0121993_280_630 116
435 3300046663 Ga0495635_0134542 Ga0495635_0134542_164_514 116
436 3300046675 Ga0495657_0404266 Ga0495657_0404266_441_791 116
437 3300046679 Ga0495623_0108790 Ga0495623_0108790_1250_1600 116
438 3300046683 Ga0495658_0286066 Ga0495658_0286066_18_368 116
439 3300046684 Ga0495669_0020457 Ga0495669_0020457_426_776 116
440 3300047315 Ga0495581_0239355 Ga0495581_0239355_523_873 116
441 3300047317 Ga0495604_0589793 Ga0495604_0589793_299_649 116
442 3300047318 Ga0495636_0501236 Ga0495636_0501236_120_470 116
443 3300047319 Ga0495674_0182463 Ga0495674_0182463_1017_1367 116
444 3300047471 Ga0495684_0272956 Ga0495684_0272956_658_1008 116
445 3300047673 Ga0495593_0274739 Ga0495593_0274739_123_473 116
446 3300049514 Ga0501291_028608 Ga0501291_028608_250_624 116
447 3300049526 Ga0501303_022080 Ga0501303_022080_76_426 116
448 3300049587 Ga0501071_0925164 Ga0501071_0925164_289_663 116
449 3300049661 Ga0501217_061830 Ga0501217_061830_615_989 116
450 3300050507 nmdc:mga05p37_1727927_c1 nmdc:mga05p37_1727927_c1_161_511 116
451 3300050508 nmdc:mga09592_189086_c1 nmdc:mga09592_189086_c1_267_617 116
452 3300050509 nmdc:mga0qj67_252562_c1 nmdc:mga0qj67_252562_c1_190_540 116
453 3300050510 nmdc:mga06r32_1190330_c1 nmdc:mga06r32_1190330_c1_150_500 116
454 3300050513 nmdc:mga0rr50_850442_c1 nmdc:mga0rr50_850442_c1_125_475 116
455 3300053077 Ga0495601_0581767 Ga0495601_0581767_15_365 116
456 3300053085 Ga0495619_0092985 Ga0495619_0092985_147_497 116
457 3300005336 Ga0070680_100779317 Ga0070680_1007793172 117
458 3300005341 Ga0070691_10567005 Ga0070691_105670051 117
459 3300005435 Ga0070714_101265671 Ga0070714_1012656711 117
460 3300005440 Ga0070705_100644597 Ga0070705_1006445972 117
461 3300005444 Ga0070694_100294931 Ga0070694_1002949312 117
462 3300005444 Ga0070694_101524625 Ga0070694_1015246252 117
463 3300005458 Ga0070681_10000135 Ga0070681_1000013524 117
464 3300005545 Ga0070695_100079059 Ga0070695_1000790592 117
465 3300005545 Ga0070695_100349373 Ga0070695_1003493732 117
466 3300005546 Ga0070696_100158409 Ga0070696_1001584092 117
467 3300005546 Ga0070696_100322594 Ga0070696_1003225941 117
468 3300005615 Ga0070702_100802799 Ga0070702_1008027992 117
469 3300006163 Ga0070715_10580159 Ga0070715_105801592 117
470 3300006852 Ga0075433_10163878 Ga0075433_101638783 117
471 3300006914 Ga0075436_100053209 Ga0075436_1000532093 117
472 3300007076 Ga0075435_100015168 Ga0075435_1000151684 117
473 3300009147 Ga0114129_11117082 Ga0114129_111170822 117
474 3300025912 Ga0207707_10003001 Ga0207707_100030019 117
475 3300025916 Ga0207663_11360281 Ga0207663_113602812 117
476 3300031548 Ga0307408_100326289 Ga0307408_1003262892 117
477 3300032005 Ga0307411_10579765 Ga0307411_105797652 117
478 3300035691 Ga0373931_0096223 Ga0373931_0096223_568_921 117
479 3300035692 Ga0373935_0638765 Ga0373935_0638765_233_586 117
480 3300041406 Ga0439439_0029870 Ga0439439_0029870_273_632 117
481 3300045051 Ga0451576_0652736 Ga0451576_0652736_724_1086 117
482 3300046537 Ga0495598_0377400 Ga0495598_0377400_111_464 117
483 3300049522 Ga0501299_148580 Ga0501299_148580_205_567 117
484 3300049583 Ga0501067_0117974 Ga0501067_0117974_170_523 117
485 3300049585 Ga0501069_0055250 Ga0501069_0055250_1542_1895 117
486 3300049668 Ga0501233_213540 Ga0501233_213540_161_523 117
487 3300049779 Ga0501283_079170 Ga0501283_079170_38_391 117
488 3300050507 nmdc:mga05p37_1349504_c1 nmdc:mga05p37_1349504_c1_42_395 117
489 3300050508 nmdc:mga09592_379145_c1 nmdc:mga09592_379145_c1_259_633 117
490 3300050510 nmdc:mga06r32_944444_c1 nmdc:mga06r32_944444_c1_31_405 117
491 3300050512 nmdc:mga0n895_41094_c1 nmdc:mga0n895_41094_c1_1850_2203 117
492 3300050512 nmdc:mga0n895_539645_c1 nmdc:mga0n895_539645_c1_291_644 117
493 3300050513 nmdc:mga0rr50_136899_c1 nmdc:mga0rr50_136899_c1_841_1194 117
494 3300050514 nmdc:mga08x19_39521_c1 nmdc:mga08x19_39521_c1_993_1346 117
495 3300050514 nmdc:mga08x19_44248_c1 nmdc:mga08x19_44248_c1_1305_1658 117
496 3300050514 nmdc:mga08x19_54389_c1 nmdc:mga08x19_54389_c1_214_567 117
497 3300050515 nmdc:mga0a205_181055_c1 nmdc:mga0a205_181055_c1_507_860 117
498 iso_pu_bacteria 2643221644 2644245550 117
499 3300025910 Ga0207684_10992543 Ga0207684_109925432 118
500 3300003322 rootL2_10137912 rootL2_101379122 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07746

LigA

Aromatic-ring-opening dioxygenase LigAB, LigA subunit

39

125

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wpm-assembly1.cif.gz_A crystal structure of the anaerobic desb-gallate complex by co-crystallization 0.9275 18 117
3wrb-assembly1.cif.gz_A crystal structure of the anaerobic h124f desb-gallate complex 0.9274 18 117
3wku-assembly1.cif.gz_B crystal structure of the anaerobic desb-gallate complex 0.9218 20 114
3wrc-assembly1.cif.gz_A crystal structure of the anaerobic desb-protocatechuate (pca) complex 0.8814 12 117
1bou-assembly1.cif.gz_C three-dimensional structure of ligab 0.8359 13 120
ID Description Score Start End Superfamily
3wraB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.9339 18 112 1.10.700.10
3wkuA02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.9308 18 117 1.10.700.10
3wpmB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.93 18 114 1.10.700.10
3wr8A02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.9268 18 117 1.10.700.10
3wpmB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.8871 18 114 1.10.700.10
ID Description Score Start End GO Terms
AF-A0A318BED9-F1-model_v4 Gallate dioxygenase 0.9564 18 116 GO:0008198
GO:0051213
AF-A0A6N0BUR7-F1-model_v4 Extradiol ring-cleavage dioxygenase LigAB LigA subunit domain-containing protein 0.9549 18 116
AF-A0A7C2U2I3-F1-model_v4 Extradiol ring-cleavage dioxygenase LigAB LigA subunit domain-containing protein 0.9549 22 113
AF-A0A829YAG2-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.954 18 116 GO:0008198
GO:0016491
AF-A0A378B4E9-F1-model_v4 4-hydroxybenzoate transporter 0.9523 18 116 GO:0005886
GO:0008198
GO:0016491
GO:0046943

Feature Viewer

pLDDT pTM Quality
84.9 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map