F455492

General Info

Members Datasets Scaffolds Average Seq Length
500 216 1000 148

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100313734|Ga0070708_1003137341
Length 148
Sequence MPRIERSATVTWDGNVARGTGLISGDTGAFKELPYSLPTRIGQAEGKTSPEELLASAHAGCLAMGLASELANPDARVEVHTTVRMDEVDGKGHQIVASTVAIRGRVPGLSAEEWQDKVVAADEGCPFSTLLKNAGVEVTVNAELEEGT

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
125 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 2.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.2
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 17.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100313734 3300005445 Bacteria 1477
2 Ga0070658_10011962 3300005327 Bacteria 6968
3 Ga0070658_10045246 3300005327 Bacteria 3559
4 Ga0070658_10076307 3300005327 Bacteria 2749
5 Ga0070658_10077172 3300005327 Bacteria 2732
6 Ga0070658_10294350 3300005327 Bacteria 1383
7 Ga0070683_100020333 3300005329 Bacteria 5908
8 Ga0070683_100155858 3300005329 Bacteria 2166
9 Ga0070680_100008021 3300005336 Bacteria 8064
10 Ga0070680_100068746 3300005336 Unclassified 2907
11 Ga0070680_101192692 3300005336 Bacteria 658
12 Ga0070682_100017361 3300005337 Bacteria 4194
13 Ga0068868_100125221 3300005338 Bacteria 2099
14 Ga0068868_101352315 3300005338 Unclassified 663
15 Ga0070660_100005996 3300005339 Bacteria 8401
16 Ga0070660_100009146 3300005339 Bacteria 6953
17 Ga0070660_100015899 3300005339 Bacteria 5448
18 Ga0070660_100025496 3300005339 Bacteria 4394
19 Ga0070660_100089474 3300005339 Unclassified 2425
20 Ga0070660_100718747 3300005339 Bacteria 838
21 Ga0070661_100032708 3300005344 Bacteria 3765
22 Ga0070661_100171024 3300005344 Bacteria 1650
23 Ga0070661_100397879 3300005344 Bacteria 1089
24 Ga0070661_100543363 3300005344 Unclassified 934
25 Ga0070671_100044120 3300005355 Bacteria 3705
26 Ga0070659_100034413 3300005366 Bacteria 3941
27 Ga0070659_100158481 3300005366 Bacteria 1850
28 Ga0070709_10358845 3300005434 Bacteria 1079
29 Ga0070709_10389331 3300005434 Unclassified 1038
30 Ga0070709_10801935 3300005434 Bacteria 739
31 Ga0070714_100002415 3300005435 Bacteria 13764
32 Ga0070714_100047686 3300005435 Bacteria 3640
33 Ga0070714_100058345 3300005435 Bacteria 3306
34 Ga0070714_100656601 3300005435 Bacteria 1010
35 Ga0070714_100786890 3300005435 Bacteria 921
36 Ga0070714_101281186 3300005435 Bacteria 715
37 Ga0070713_100316270 3300005436 Bacteria 1441
38 Ga0070713_100575567 3300005436 Unclassified 1068
39 Ga0070713_100910810 3300005436 Bacteria 846
40 Ga0070711_100142439 3300005439 Bacteria 1799
41 Ga0070711_101537985 3300005439 Bacteria 581
42 Ga0070694_100342372 3300005444 Bacteria 1156
43 Ga0070694_101500324 3300005444 Unclassified 570
44 Ga0070708_100032513 3300005445 Bacteria 4526
45 Ga0070708_101281406 3300005445 Bacteria 685
46 Ga0070678_100302699 3300005456 Unclassified 1359
47 Ga0070681_10025203 3300005458 Bacteria 5982
48 Ga0070681_10030299 3300005458 Bacteria 5429
49 Ga0070681_10058001 3300005458 Bacteria 3852
50 Ga0070681_10060708 3300005458 Bacteria 3756
51 Ga0070681_10385058 3300005458 Bacteria 1313
52 Ga0070681_10404241 3300005458 Bacteria 1277
53 Ga0070681_10888177 3300005458 Bacteria 809
54 Ga0070707_100005270 3300005468 Bacteria 12102
55 Ga0070707_100848339 3300005468 Bacteria 878
56 Ga0070707_101904039 3300005468 Unclassified 562
57 Ga0070698_100011822 3300005471 Bacteria 9263
58 Ga0070699_100003464 3300005518 Bacteria 13952
59 Ga0070699_100480851 3300005518 Unclassified 1127
60 Ga0070699_101344593 3300005518 Bacteria 655
61 Ga0070679_100055262 3300005530 Bacteria 3954
62 Ga0070679_100075544 3300005530 Bacteria 3359
63 Ga0070679_100149990 3300005530 Unclassified 2308
64 Ga0070679_100178428 3300005530 Bacteria 2097
65 Ga0070679_100180240 3300005530 Unclassified 2085
66 Ga0070679_100263533 3300005530 Bacteria 1678
67 Ga0070679_100275298 3300005530 Bacteria 1636
68 Ga0070679_101275715 3300005530 Bacteria 680
69 Ga0070679_101737457 3300005530 Unclassified 572
70 Ga0070684_100238369 3300005535 Bacteria 1661
71 Ga0070684_100750769 3300005535 Unclassified 911
72 Ga0070684_100947746 3300005535 Bacteria 807
73 Ga0068853_100205587 3300005539 Unclassified 1793
74 Ga0070695_100020405 3300005545 Bacteria 4047
75 Ga0070695_100502989 3300005545 Bacteria 937
76 Ga0070696_100359786 3300005546 Bacteria 1129
77 Ga0070696_100535733 3300005546 Unclassified 936
78 Ga0070696_101050821 3300005546 Viruses 682
79 Ga0070696_101112290 3300005546 Unclassified 664
80 Ga0070693_100072046 3300005547 Bacteria 2037
81 Ga0070693_100141689 3300005547 Bacteria 1514
82 Ga0068855_100065691 3300005563 Bacteria 4229
83 Ga0068855_100223418 3300005563 Bacteria 2111
84 Ga0068855_100250133 3300005563 Unclassified 1977
85 Ga0068855_100354906 3300005563 Bacteria 1614
86 Ga0068855_100535031 3300005563 Unclassified 1270
87 Ga0068855_100765911 3300005563 Bacteria 1028
88 Ga0068855_101543717 3300005563 Bacteria 681
89 Ga0068856_100047541 3300005614 Bacteria 4227
90 Ga0068856_102434364 3300005614 Unclassified 531
91 Ga0068852_101078570 3300005616 Bacteria 823
92 Ga0068860_100125678 3300005843 Bacteria 2458
93 Ga0081539_10019458 3300005985 Bacteria 4645
94 Ga0070717_10001905 3300006028 Bacteria 14595
95 Ga0070716_101061612 3300006173 Bacteria 644
96 Ga0070712_100218335 3300006175 Bacteria 1508
97 Ga0075433_10213721 3300006852 Bacteria 1714
98 Ga0075434_100119935 3300006871 Bacteria 2645
99 Ga0105240_10004954 3300009093 Bacteria 20027
100 Ga0105240_10950956 3300009093 Bacteria 921
101 Ga0105240_12487331 3300009093 Unclassified 535
102 Ga0105243_10578038 3300009148 Bacteria 1078
103 Ga0105248_10130587 3300009177 Bacteria 2834
104 Ga0105237_10439222 3300009545 Bacteria 1311
105 Ga0105238_10274346 3300009551 Unclassified 1667
106 Ga0105238_11121155 3300009551 Bacteria 810
107 Ga0105238_11449586 3300009551 Bacteria 714
108 Ga0157371_10186149 3300013102 Bacteria 1486
109 Ga0157370_10079273 3300013104 Unclassified 3093
110 Ga0157370_10181724 3300013104 Bacteria 1954
111 Ga0157370_10493191 3300013104 Unclassified 1125
112 Ga0157369_10024685 3300013105 Bacteria 6681
113 Ga0157369_10128569 3300013105 Bacteria 2685
114 Ga0157369_10160942 3300013105 Unclassified 2370
115 Ga0157369_11456361 3300013105 Unclassified 697
116 Ga0157374_11140068 3300013296 Bacteria 800
117 Ga0157378_10220518 3300013297 Unclassified 1803
118 Ga0157372_10213802 3300013307 Bacteria 2234
119 Ga0157372_12356431 3300013307 Unclassified 611
120 Ga0182008_10009496 3300014497 Bacteria 5245
121 Ga0182008_10063657 3300014497 Bacteria 1816
122 Ga0182008_10632136 3300014497 Unclassified 604
123 Ga0182006_1011739 3300015261 Bacteria 3846
124 Ga0182006_1140346 3300015261 Unclassified 826
125 Ga0182006_1222659 3300015261 Unclassified 622
126 Ga0182007_10012395 3300015262 Bacteria 3280
127 Ga0197907_10123741 3300020069 Unclassified 1930
128 Ga0206356_10302003 3300020070 Unclassified 849
129 Ga0206356_11554719 3300020070 Unclassified 1739
130 Ga0206356_11802343 3300020070 Unclassified 3102
131 Ga0206354_10271581 3300020081 Unclassified 2478
132 Ga0206354_10346638 3300020081 Bacteria 680
133 Ga0206354_10554102 3300020081 Bacteria 646
134 Ga0206353_11395228 3300020082 Bacteria 2621
135 Ga0206353_11613257 3300020082 Unclassified 2506
136 Ga0206353_11962747 3300020082 Bacteria 1028
137 Ga0206353_11975662 3300020082 Unclassified 595
138 Ga0207653_10214501 3300025885 Viruses 729
139 Ga0207692_10374904 3300025898 Bacteria 882
140 Ga0207685_10267659 3300025905 Unclassified 833
141 Ga0207699_10114178 3300025906 Unclassified 1736
142 Ga0207699_10371500 3300025906 Bacteria 1013
143 Ga0207699_10420234 3300025906 Bacteria 955
144 Ga0207699_10427429 3300025906 Bacteria 947
145 Ga0207705_10015124 3300025909 Bacteria 5547
146 Ga0207705_10016313 3300025909 Bacteria 5327
147 Ga0207705_10037598 3300025909 Bacteria 3464
148 Ga0207705_10410830 3300025909 Bacteria 1047
149 Ga0207684_10138674 3300025910 Bacteria 2090
150 Ga0207707_10045305 3300025912 Bacteria 3833
151 Ga0207707_10060520 3300025912 Bacteria 3294
152 Ga0207707_10066389 3300025912 Bacteria 3142
153 Ga0207707_10177465 3300025912 Bacteria 1860
154 Ga0207707_10283965 3300025912 Bacteria 1433
155 Ga0207707_10347859 3300025912 Unclassified 1278
156 Ga0207707_11551142 3300025912 Bacteria 523
157 Ga0207695_10013024 3300025913 Bacteria 9935
158 Ga0207695_10595079 3300025913 Bacteria 987
159 Ga0207693_10147114 3300025915 Bacteria 1852
160 Ga0207663_10143448 3300025916 Bacteria 1667
161 Ga0207663_10408498 3300025916 Unclassified 1040
162 Ga0207660_10079301 3300025917 Bacteria 2408
163 Ga0207660_10137417 3300025917 Unclassified 1866
164 Ga0207660_10311128 3300025917 Unclassified 1256
165 Ga0207660_11183821 3300025917 Unclassified 622
166 Ga0207660_11349107 3300025917 Bacteria 578
167 Ga0207657_10016209 3300025919 Bacteria 7193
168 Ga0207657_10018943 3300025919 Bacteria 6552
169 Ga0207657_10033248 3300025919 Bacteria 4650
170 Ga0207657_10036142 3300025919 Bacteria 4424
171 Ga0207657_10057856 3300025919 Bacteria 3339
172 Ga0207657_10162548 3300025919 Bacteria 1813
173 Ga0207657_10502786 3300025919 Bacteria 949
174 Ga0207649_10079527 3300025920 Unclassified 2118
175 Ga0207649_10202036 3300025920 Bacteria 1405
176 Ga0207649_10357656 3300025920 Bacteria 1082
177 Ga0207652_10026269 3300025921 Bacteria 4847
178 Ga0207652_10036220 3300025921 Bacteria 4172
179 Ga0207652_10106367 3300025921 Bacteria 2483
180 Ga0207652_10159113 3300025921 Bacteria 2024
181 Ga0207652_10180851 3300025921 Bacteria 1895
182 Ga0207652_10208146 3300025921 Unclassified 1761
183 Ga0207652_10235663 3300025921 Bacteria 1649
184 Ga0207652_10305887 3300025921 Bacteria 1435
185 Ga0207652_10838212 3300025921 Bacteria 815
186 Ga0207646_10148314 3300025922 Bacteria 2114
187 Ga0207646_10239261 3300025922 Bacteria 1640
188 Ga0207646_10815016 3300025922 Unclassified 831
189 Ga0207646_11779332 3300025922 Bacteria 527
190 Ga0207694_10289198 3300025924 Unclassified 1348
191 Ga0207687_10098338 3300025927 Bacteria 2148
192 Ga0207700_10539617 3300025928 Bacteria 1034
193 Ga0207664_10005465 3300025929 Bacteria 8690
194 Ga0207664_10016583 3300025929 Bacteria 5379
195 Ga0207664_10018936 3300025929 Bacteria 5078
196 Ga0207664_10099409 3300025929 Bacteria 2401
197 Ga0207664_10283790 3300025929 Bacteria 1453
198 Ga0207664_10381544 3300025929 Bacteria 1251
199 Ga0207664_10770808 3300025929 Bacteria 865
200 Ga0207664_10972222 3300025929 Bacteria 761
201 Ga0207644_10245494 3300025931 Unclassified 1427
202 Ga0207665_10090238 3300025939 Bacteria 2123
203 Ga0207711_10762399 3300025941 Bacteria 902
204 Ga0207661_10185332 3300025944 Bacteria 1821
205 Ga0207661_10228988 3300025944 Bacteria 1645
206 Ga0207667_10118491 3300025949 Unclassified 2728
207 Ga0207667_10287381 3300025949 Bacteria 1680
208 Ga0207667_11136450 3300025949 Bacteria 763
209 Ga0207677_11149863 3300026023 Bacteria 709
210 Ga0207639_11131362 3300026041 Bacteria 734
211 Ga0207678_11896557 3300026067 Unclassified 520
212 Ga0207702_10188828 3300026078 Bacteria 1902
213 Ga0207702_10330699 3300026078 Bacteria 1453
214 Ga0268264_11398655 3300028381 Bacteria 710
215 Ga0265337_1011273 3300028556 Bacteria 3088
216 Ga0265326_10038339 3300028558 Bacteria 1362
217 Ga0265319_1032725 3300028563 Bacteria 1800
218 Ga0265319_1033462 3300028563 Bacteria 1775
219 Ga0265318_10053495 3300028577 Bacteria 1514
220 Ga0265318_10118985 3300028577 Bacteria 971
221 Ga0265336_10001244 3300028666 Bacteria 12061
222 Ga0265336_10078366 3300028666 Bacteria 986
223 Ga0265338_10000634 3300028800 Bacteria 60990
224 Ga0265338_10003841 3300028800 Bacteria 20854
225 Ga0265338_10019927 3300028800 Bacteria 7082
226 Ga0265338_10055341 3300028800 Bacteria 3529
227 Ga0265338_10189816 3300028800 Unclassified 1559
228 Ga0265324_10023176 3300029957 Bacteria 2213
229 Ga0265330_10033842 3300031235 Bacteria 2284
230 Ga0265320_10047722 3300031240 Bacteria 2093
231 Ga0265320_10076607 3300031240 Bacteria 1567
232 Ga0265340_10025294 3300031247 Bacteria 3008
233 Ga0265340_10196576 3300031247 Bacteria 908
234 Ga0265339_10013415 3300031249 Bacteria 4965
235 Ga0265339_10176036 3300031249 Bacteria 1068
236 Ga0265327_10121316 3300031251 Bacteria 1238
237 Ga0265327_10126391 3300031251 Bacteria 1206
238 Ga0265316_10062707 3300031344 Bacteria 2885
239 Ga0265316_10137516 3300031344 Bacteria 1837
240 Ga0265313_10014468 3300031595 Bacteria 4658
241 Ga0265313_10040686 3300031595 Bacteria 2295
242 Ga0265314_10033807 3300031711 Bacteria 3742
243 Ga0265314_10356810 3300031711 Bacteria 803
244 Ga0265314_10704451 3300031711 Unclassified 510
245 Ga0265342_10106296 3300031712 Bacteria 1593
246 Ga0307409_100073510 3300031995 Bacteria 2727
247 Ga0373926_0041624 3300035083 Bacteria 1642
248 Ga0373945_0021759 3300035116 Bacteria 2206
249 Ga0373953_0207490 3300035117 Unclassified 848
250 Ga0373953_0309092 3300035117 Bacteria 690
251 Ga0373956_0265693 3300035119 Bacteria 816
252 Ga0373943_0000780 3300035170 Bacteria 13932
253 Ga0373943_0209318 3300035170 Bacteria 1082
254 Ga0373946_0010419 3300035171 Bacteria 3440
255 Ga0373955_0554849 3300035172 Bacteria 703
256 Ga0373935_0433193 3300035692 Bacteria 948
257 Ga0373935_0556314 3300035692 Unclassified 836
258 Ga0373927_0135210 3300035695 Bacteria 1611
259 Ga0373933_1089461 3300035724 Unclassified 526
260 Ga0373947_0005731 3300035725 Bacteria 7242
261 Ga0373937_0097012 3300036401 Bacteria 2734
262 Ga0373937_0376251 3300036401 Bacteria 1347
263 Ga0373937_0878675 3300036401 Bacteria 845
264 Ga0373925_0004090 3300037068 Bacteria 11074
265 Ga0373925_0221396 3300037068 Bacteria 1511
266 Ga0395899_0010238 3300037312 Bacteria 7186
267 Ga0395900_0327279 3300037418 Unclassified 1511
268 Ga0395900_0505932 3300037418 Bacteria 1158
269 Ga0395900_1081861 3300037418 Unclassified 719
270 Ga0395898_0023217 3300037466 Bacteria 6268
271 Ga0395898_0101326 3300037466 Unclassified 2765
272 Ga0395898_0224057 3300037466 Bacteria 1794
273 Ga0395898_0325941 3300037466 Bacteria 1465
274 Ga0395898_0612419 3300037466 Unclassified 1032
275 Ga0395898_1493339 3300037466 Bacteria 602
276 Ga0395905_0642111 3300037471 Unclassified 963
277 Ga0395901_0042760 3300038443 Bacteria 4699
278 Ga0395901_0138448 3300038443 Unclassified 2558
279 Ga0395901_0393814 3300038443 Bacteria 1424
280 Ga0395901_0657853 3300038443 Bacteria 1050
281 Ga0395901_0994567 3300038443 Unclassified 815
282 Ga0436363_0055684 3300039450 Unclassified 1087
283 Ga0436362_0175188 3300039453 Bacteria 1027
284 Ga0451807_1379071 3300041486 Bacteria 605
285 Ga0451853_3993528 3300041512 Bacteria 810
286 Ga0439448_0099604 3300042005 Bacteria 987
287 Ga0439458_0102640 3300042157 Bacteria 743
288 Ga0439459_0075955 3300042438 Bacteria 785
289 Ga0466966_0010047 3300044684 Bacteria 6274
290 Ga0466961_0097486 3300044693 Bacteria 1854
291 Ga0466961_0207559 3300044693 Bacteria 1210
292 Ga0466961_0349024 3300044693 Bacteria 901
293 Ga0466963_0001597 3300044694 Bacteria 12314
294 Ga0466963_0002515 3300044694 Bacteria 10261
295 Ga0466963_0003177 3300044694 Bacteria 9336
296 Ga0466963_0008308 3300044694 Bacteria 6217
297 Ga0466963_0022557 3300044694 Bacteria 3987
298 Ga0466963_0037458 3300044694 Bacteria 3167
299 Ga0466963_0105575 3300044694 Bacteria 1931
300 Ga0466963_0168450 3300044694 Bacteria 1526
301 Ga0466963_0173863 3300044694 Bacteria 1502
302 Ga0466963_0257498 3300044694 Bacteria 1225
303 Ga0466964_0182026 3300044706 Bacteria 997
304 Ga0466964_0222970 3300044706 Bacteria 916
305 Ga0466964_0294865 3300044706 Unclassified 815
306 Ga0453684_0761147 3300044712 Unclassified 1048
307 Ga0466971_0007730 3300044719 Bacteria 4684
308 Ga0466971_0122603 3300044719 Bacteria 1204
309 Ga0466968_0009256 3300044735 Bacteria 3787
310 Ga0466968_0061984 3300044735 Bacteria 1614
311 Ga0466968_0640902 3300044735 Bacteria 539
312 Ga0466957_0010629 3300044842 Bacteria 5292
313 Ga0466957_0110847 3300044842 Bacteria 1740
314 Ga0466957_0216164 3300044842 Bacteria 1264
315 Ga0466957_0336700 3300044842 Bacteria 1021
316 Ga0466957_1202121 3300044842 Bacteria 548
317 Ga0466960_0480561 3300044901 Bacteria 726
318 Ga0466959_0030622 3300045049 Bacteria 3984
319 Ga0466959_0036320 3300045049 Bacteria 3641
320 Ga0466959_0294947 3300045049 Bacteria 1111
321 Ga0466958_0011240 3300045836 Bacteria 5039
322 Ga0466958_0082718 3300045836 Bacteria 1978
323 Ga0466958_0290792 3300045836 Bacteria 1048
324 Ga0466958_0376502 3300045836 Bacteria 915
325 Ga0466967_0001818 3300045976 Bacteria 12815
326 Ga0466967_0014075 3300045976 Bacteria 6214
327 Ga0466967_0014421 3300045976 Bacteria 6155
328 Ga0466967_0024515 3300045976 Bacteria 4961
329 Ga0466967_0034968 3300045976 Bacteria 4271
330 Ga0466967_0043831 3300045976 Bacteria 3876
331 Ga0466967_0071578 3300045976 Bacteria 3105
332 Ga0466967_0084482 3300045976 Bacteria 2872
333 Ga0466967_0124999 3300045976 Bacteria 2381
334 Ga0466967_0143843 3300045976 Archaea 2223
335 Ga0466967_0217249 3300045976 Unclassified 1815
336 Ga0466967_0228318 3300045976 Bacteria 1771
337 Ga0466967_0236732 3300045976 Bacteria 1740
338 Ga0466967_0640486 3300045976 Bacteria 1051
339 Ga0466967_0680585 3300045976 Bacteria 1018
340 Ga0466967_0682671 3300045976 Bacteria 1017
341 Ga0466967_1300326 3300045976 Unclassified 724
342 Ga0466967_1526638 3300045976 Unclassified 665
343 Ga0495592_0173676 3300046454 Bacteria 1473
344 Ga0495592_0193837 3300046454 Bacteria 1376
345 Ga0495603_0039292 3300046455 Bacteria 2836
346 Ga0495629_0010429 3300046459 Bacteria 6760
347 Ga0495629_0079859 3300046459 Bacteria 2284
348 Ga0495629_0161000 3300046459 Bacteria 1559
349 Ga0495641_0002128 3300046461 Bacteria 15969
350 Ga0495641_0084277 3300046461 Bacteria 1423
351 Ga0495651_0098855 3300046462 Bacteria 2176
352 Ga0495651_0570853 3300046462 Unclassified 716
353 Ga0495653_0021002 3300046463 Bacteria 5291
354 Ga0495653_0080488 3300046463 Bacteria 2410
355 Ga0495580_0112465 3300046472 Bacteria 1891
356 Ga0495582_0000127 3300046473 Bacteria 40540
357 Ga0495639_0009511 3300046475 Bacteria 4170
358 Ga0495639_0489915 3300046475 Unclassified 627
359 Ga0495662_0004544 3300046476 Bacteria 6960
360 Ga0495664_0073239 3300046477 Bacteria 2048
361 Ga0495664_0100321 3300046477 Bacteria 1743
362 Ga0495608_0024971 3300046511 Bacteria 4082
363 Ga0495608_0053522 3300046511 Bacteria 2671
364 Ga0495608_0086014 3300046511 Bacteria 2038
365 Ga0495608_0421891 3300046511 Unclassified 814
366 Ga0495608_0485159 3300046511 Bacteria 749
367 Ga0495618_0010197 3300046514 Bacteria 5684
368 Ga0495618_0599565 3300046514 Bacteria 655
369 Ga0495618_0649156 3300046514 Bacteria 624
370 Ga0495628_0342397 3300046516 Bacteria 1100
371 Ga0495630_0055887 3300046517 Bacteria 2957
372 Ga0495630_0091748 3300046517 Bacteria 2295
373 Ga0495630_0273383 3300046517 Bacteria 1291
374 Ga0495630_0413073 3300046517 Bacteria 1034
375 Ga0495666_0023771 3300046526 Bacteria 3031
376 Ga0495666_0265190 3300046526 Bacteria 781
377 Ga0495652_0103853 3300046529 Bacteria 2299
378 Ga0495652_0499999 3300046529 Bacteria 843
379 Ga0495665_0018121 3300046531 Bacteria 3785
380 Ga0495640_0068226 3300046533 Bacteria 2393
381 Ga0495640_0399057 3300046533 Unclassified 844
382 Ga0495640_0435209 3300046533 Bacteria 802
383 Ga0495640_0460993 3300046533 Bacteria 775
384 Ga0495640_0582789 3300046533 Bacteria 677
385 Ga0495586_0199732 3300046535 Unclassified 1133
386 Ga0495586_0494319 3300046535 Bacteria 706
387 Ga0495587_0005585 3300046536 Bacteria 8208
388 Ga0495587_0180087 3300046536 Bacteria 1199
389 Ga0495645_0093581 3300046543 Bacteria 2144
390 Ga0495645_0224800 3300046543 Bacteria 1260
391 Ga0495667_0054821 3300046559 Bacteria 2622
392 Ga0495667_0139183 3300046559 Bacteria 1564
393 Ga0495634_0058201 3300046642 Bacteria 2577
394 Ga0495634_0060692 3300046642 Bacteria 2515
395 Ga0495634_0094330 3300046642 Bacteria 1939
396 Ga0495634_0118760 3300046642 Bacteria 1695
397 Ga0495634_0569954 3300046642 Bacteria 659
398 Ga0495635_0023033 3300046663 Bacteria 4341
399 Ga0495635_0160336 3300046663 Unclassified 1530
400 Ga0495635_0420857 3300046663 Bacteria 886
401 Ga0495657_0159690 3300046675 Bacteria 1395
402 Ga0495599_0437706 3300046678 Bacteria 775
403 Ga0495623_0199855 3300046679 Unclassified 1150
404 Ga0495646_0064986 3300046680 Bacteria 2161
405 Ga0495646_0156758 3300046680 Bacteria 1263
406 Ga0495647_0005513 3300046681 Bacteria 4148
407 Ga0495658_0001937 3300046683 Bacteria 10584
408 Ga0495658_0019898 3300046683 Bacteria 3511
409 Ga0495658_0256727 3300046683 Bacteria 1100
410 Ga0495658_0383403 3300046683 Bacteria 895
411 Ga0495613_0002469 3300046689 Bacteria 13937
412 Ga0495613_0338138 3300046689 Bacteria 1036
413 Ga0495624_0009193 3300046690 Bacteria 6851
414 Ga0495624_0176627 3300046690 Bacteria 1302
415 Ga0495600_0008885 3300046809 Bacteria 6191
416 Ga0495600_0030290 3300046809 Bacteria 3505
417 Ga0495581_0002230 3300047315 Bacteria 10908
418 Ga0495604_0047092 3300047317 Bacteria 3360
419 Ga0495674_0058236 3300047319 Bacteria 3378
420 Ga0495674_0116964 3300047319 Bacteria 2255
421 Ga0495674_0563661 3300047319 Bacteria 905
422 Ga0495676_0050373 3300047321 Bacteria 3340
423 Ga0495676_0312598 3300047321 Bacteria 1057
424 Ga0495680_0003111 3300047322 Bacteria 16521
425 Ga0495680_0016243 3300047322 Bacteria 6401
426 Ga0495680_0023166 3300047322 Bacteria 5166
427 Ga0495680_0211471 3300047322 Bacteria 1388
428 Ga0495680_0481709 3300047322 Bacteria 845
429 Ga0495684_0010872 3300047471 Bacteria 7037
430 Ga0495684_0070711 3300047471 Bacteria 2653
431 Ga0495684_0192592 3300047471 Bacteria 1507
432 Ga0495593_0001794 3300047673 Bacteria 12738
433 Ga0495602_0125585 3300048088 Bacteria 2056
434 Ga0495602_0956352 3300048088 Bacteria 567
435 Ga0495614_0001391 3300048089 Bacteria 10443
436 Ga0496100_0264411 3300048903 Bacteria 1277
437 Ga0496101_0470950 3300048904 Unclassified 992
438 Ga0496102_0032803 3300048905 Bacteria 4667
439 Ga0496102_0610848 3300048905 Bacteria 1013
440 Ga0496103_0459896 3300048906 Unclassified 816
441 Ga0496103_0632252 3300048906 Bacteria 681
442 Ga0496104_1084277 3300048907 Unclassified 704
443 Ga0496105_0121156 3300048908 Archaea 2157
444 Ga0496106_0023875 3300048909 Bacteria 4545
445 Ga0496107_0030308 3300048910 Bacteria 3856
446 Ga0496108_0626163 3300048911 Unclassified 936
447 Ga0496108_1446527 3300048911 Archaea 573
448 Ga0496109_0101040 3300048912 Unclassified 2676
449 Ga0496109_1540730 3300048912 Unclassified 599
450 Ga0496110_0409594 3300048913 Bacteria 1236
451 Ga0496112_0015436 3300048915 Bacteria 7130
452 Ga0496112_0097404 3300048915 Bacteria 2912
453 Ga0496112_0165389 3300048915 Bacteria 2178
454 Ga0496112_0192692 3300048915 Unclassified 1999
455 Ga0496112_0195321 3300048915 Bacteria 1984
456 Ga0496112_0326709 3300048915 Bacteria 1478
457 Ga0496112_0424887 3300048915 Unclassified 1267
458 Ga0496113_0032575 3300048916 Bacteria 3788
459 Ga0496113_0608297 3300048916 Unclassified 875
460 Ga0496114_0470588 3300048917 Unclassified 1112
461 Ga0501034_0126617 3300049571 Bacteria 2539
462 Ga0501046_0674182 3300049580 Bacteria 730
463 Ga0501047_0013261 3300049581 Bacteria 7807
464 Ga0501047_0177038 3300049581 Bacteria 2000
465 Ga0501047_0209152 3300049581 Bacteria 1810
466 Ga0501067_0025117 3300049583 Bacteria 3304
467 Ga0501067_0071205 3300049583 Bacteria 1925
468 Ga0501067_0138105 3300049583 Bacteria 1357
469 Ga0501067_0447537 3300049583 Bacteria 721
470 Ga0501069_0152607 3300049585 Bacteria 1328
471 Ga0501069_0217382 3300049585 Bacteria 1110
472 Ga0501070_0047956 3300049586 Bacteria 3549
473 Ga0501070_0125194 3300049586 Bacteria 2124
474 Ga0501070_0724477 3300049586 Bacteria 785
475 Ga0501073_0042852 3300049589 Bacteria 3193
476 Ga0501074_0005639 3300049590 Bacteria 9017
477 Ga0501074_0195358 3300049590 Bacteria 1442
478 Ga0501080_0002832 3300049742 Bacteria 15244
479 Ga0501035_0289818 3300049822 Bacteria 1382
480 Ga0501044_0423530 3300049823 Bacteria 1241
481 nmdc:mga0n895_396681_c1 3300050512 Bacteria 1395
482 nmdc:mga08x19_206832_c1 3300050514 Unclassified 1346
483 nmdc:mga0a205_150154_c1 3300050515 Bacteria 2230
484 Ga0495601_0039309 3300053077 Bacteria 2962
485 Ga0495601_0560742 3300053077 Bacteria 734
486 Ga0495612_0074160 3300053078 Bacteria 1422
487 Ga0495655_0003215 3300053083 Bacteria 2672
488 Ga0495595_0037546 3300053084 Unclassified 2203
489 Ga0495595_0343386 3300053084 Bacteria 753
490 Ga0495619_0007443 3300053085 Bacteria 6934
491 Ga0495619_0008287 3300053085 Bacteria 6574
492 Ga0495619_0017230 3300053085 Bacteria 4575
493 Ga0495619_0053885 3300053085 Bacteria 2662
494 Ga0495619_0230054 3300053085 Bacteria 1284
495 Ga0501084_0046818 3300054114 Bacteria 3623
496 Ga0466962_0002758 3300061719 Bacteria 8343
497 Ga0466962_0024478 3300061719 Bacteria 2900
498 Ga0466962_0064014 3300061719 Bacteria 1756
499 Ga0466962_0338115 3300061719 Bacteria 748
500 Ga0530510_0533130 3300061734 Bacteria 891
501 Ga0070708_100313734
502 Ga0070658_10011962
503 Ga0070658_10045246
504 Ga0070658_10076307
505 Ga0070658_10077172
506 Ga0070658_10294350
507 Ga0070683_100020333
508 Ga0070683_100155858
509 Ga0070680_100008021
510 Ga0070680_100068746
511 Ga0070680_101192692
512 Ga0070682_100017361
513 Ga0068868_100125221
514 Ga0068868_101352315
515 Ga0070660_100005996
516 Ga0070660_100009146
517 Ga0070660_100015899
518 Ga0070660_100025496
519 Ga0070660_100089474
520 Ga0070660_100718747
521 Ga0070661_100032708
522 Ga0070661_100171024
523 Ga0070661_100397879
524 Ga0070661_100543363
525 Ga0070671_100044120
526 Ga0070659_100034413
527 Ga0070659_100158481
528 Ga0070709_10358845
529 Ga0070709_10389331
530 Ga0070709_10801935
531 Ga0070714_100002415
532 Ga0070714_100047686
533 Ga0070714_100058345
534 Ga0070714_100656601
535 Ga0070714_100786890
536 Ga0070714_101281186
537 Ga0070713_100316270
538 Ga0070713_100575567
539 Ga0070713_100910810
540 Ga0070711_100142439
541 Ga0070711_101537985
542 Ga0070694_100342372
543 Ga0070694_101500324
544 Ga0070708_100032513
545 Ga0070708_101281406
546 Ga0070678_100302699
547 Ga0070681_10025203
548 Ga0070681_10030299
549 Ga0070681_10058001
550 Ga0070681_10060708
551 Ga0070681_10385058
552 Ga0070681_10404241
553 Ga0070681_10888177
554 Ga0070707_100005270
555 Ga0070707_100848339
556 Ga0070707_101904039
557 Ga0070698_100011822
558 Ga0070699_100003464
559 Ga0070699_100480851
560 Ga0070699_101344593
561 Ga0070679_100055262
562 Ga0070679_100075544
563 Ga0070679_100149990
564 Ga0070679_100178428
565 Ga0070679_100180240
566 Ga0070679_100263533
567 Ga0070679_100275298
568 Ga0070679_101275715
569 Ga0070679_101737457
570 Ga0070684_100238369
571 Ga0070684_100750769
572 Ga0070684_100947746
573 Ga0068853_100205587
574 Ga0070695_100020405
575 Ga0070695_100502989
576 Ga0070696_100359786
577 Ga0070696_100535733
578 Ga0070696_101050821
579 Ga0070696_101112290
580 Ga0070693_100072046
581 Ga0070693_100141689
582 Ga0068855_100065691
583 Ga0068855_100223418
584 Ga0068855_100250133
585 Ga0068855_100354906
586 Ga0068855_100535031
587 Ga0068855_100765911
588 Ga0068855_101543717
589 Ga0068856_100047541
590 Ga0068856_102434364
591 Ga0068852_101078570
592 Ga0068860_100125678
593 Ga0081539_10019458
594 Ga0070717_10001905
595 Ga0070716_101061612
596 Ga0070712_100218335
597 Ga0075433_10213721
598 Ga0075434_100119935
599 Ga0105240_10004954
600 Ga0105240_10950956
601 Ga0105240_12487331
602 Ga0105243_10578038
603 Ga0105248_10130587
604 Ga0105237_10439222
605 Ga0105238_10274346
606 Ga0105238_11121155
607 Ga0105238_11449586
608 Ga0157371_10186149
609 Ga0157370_10079273
610 Ga0157370_10181724
611 Ga0157370_10493191
612 Ga0157369_10024685
613 Ga0157369_10128569
614 Ga0157369_10160942
615 Ga0157369_11456361
616 Ga0157374_11140068
617 Ga0157378_10220518
618 Ga0157372_10213802
619 Ga0157372_12356431
620 Ga0182008_10009496
621 Ga0182008_10063657
622 Ga0182008_10632136
623 Ga0182006_1011739
624 Ga0182006_1140346
625 Ga0182006_1222659
626 Ga0182007_10012395
627 Ga0197907_10123741
628 Ga0206356_10302003
629 Ga0206356_11554719
630 Ga0206356_11802343
631 Ga0206354_10271581
632 Ga0206354_10346638
633 Ga0206354_10554102
634 Ga0206353_11395228
635 Ga0206353_11613257
636 Ga0206353_11962747
637 Ga0206353_11975662
638 Ga0207653_10214501
639 Ga0207692_10374904
640 Ga0207685_10267659
641 Ga0207699_10114178
642 Ga0207699_10371500
643 Ga0207699_10420234
644 Ga0207699_10427429
645 Ga0207705_10015124
646 Ga0207705_10016313
647 Ga0207705_10037598
648 Ga0207705_10410830
649 Ga0207684_10138674
650 Ga0207707_10045305
651 Ga0207707_10060520
652 Ga0207707_10066389
653 Ga0207707_10177465
654 Ga0207707_10283965
655 Ga0207707_10347859
656 Ga0207707_11551142
657 Ga0207695_10013024
658 Ga0207695_10595079
659 Ga0207693_10147114
660 Ga0207663_10143448
661 Ga0207663_10408498
662 Ga0207660_10079301
663 Ga0207660_10137417
664 Ga0207660_10311128
665 Ga0207660_11183821
666 Ga0207660_11349107
667 Ga0207657_10016209
668 Ga0207657_10018943
669 Ga0207657_10033248
670 Ga0207657_10036142
671 Ga0207657_10057856
672 Ga0207657_10162548
673 Ga0207657_10502786
674 Ga0207649_10079527
675 Ga0207649_10202036
676 Ga0207649_10357656
677 Ga0207652_10026269
678 Ga0207652_10036220
679 Ga0207652_10106367
680 Ga0207652_10159113
681 Ga0207652_10180851
682 Ga0207652_10208146
683 Ga0207652_10235663
684 Ga0207652_10305887
685 Ga0207652_10838212
686 Ga0207646_10148314
687 Ga0207646_10239261
688 Ga0207646_10815016
689 Ga0207646_11779332
690 Ga0207694_10289198
691 Ga0207687_10098338
692 Ga0207700_10539617
693 Ga0207664_10005465
694 Ga0207664_10016583
695 Ga0207664_10018936
696 Ga0207664_10099409
697 Ga0207664_10283790
698 Ga0207664_10381544
699 Ga0207664_10770808
700 Ga0207664_10972222
701 Ga0207644_10245494
702 Ga0207665_10090238
703 Ga0207711_10762399
704 Ga0207661_10185332
705 Ga0207661_10228988
706 Ga0207667_10118491
707 Ga0207667_10287381
708 Ga0207667_11136450
709 Ga0207677_11149863
710 Ga0207639_11131362
711 Ga0207678_11896557
712 Ga0207702_10188828
713 Ga0207702_10330699
714 Ga0268264_11398655
715 Ga0265337_1011273
716 Ga0265326_10038339
717 Ga0265319_1032725
718 Ga0265319_1033462
719 Ga0265318_10053495
720 Ga0265318_10118985
721 Ga0265336_10001244
722 Ga0265336_10078366
723 Ga0265338_10000634
724 Ga0265338_10003841
725 Ga0265338_10019927
726 Ga0265338_10055341
727 Ga0265338_10189816
728 Ga0265324_10023176
729 Ga0265330_10033842
730 Ga0265320_10047722
731 Ga0265320_10076607
732 Ga0265340_10025294
733 Ga0265340_10196576
734 Ga0265339_10013415
735 Ga0265339_10176036
736 Ga0265327_10121316
737 Ga0265327_10126391
738 Ga0265316_10062707
739 Ga0265316_10137516
740 Ga0265313_10014468
741 Ga0265313_10040686
742 Ga0265314_10033807
743 Ga0265314_10356810
744 Ga0265314_10704451
745 Ga0265342_10106296
746 Ga0307409_100073510
747 Ga0373926_0041624
748 Ga0373945_0021759
749 Ga0373953_0207490
750 Ga0373953_0309092
751 Ga0373956_0265693
752 Ga0373943_0000780
753 Ga0373943_0209318
754 Ga0373946_0010419
755 Ga0373955_0554849
756 Ga0373935_0433193
757 Ga0373935_0556314
758 Ga0373927_0135210
759 Ga0373933_1089461
760 Ga0373947_0005731
761 Ga0373937_0097012
762 Ga0373937_0376251
763 Ga0373937_0878675
764 Ga0373925_0004090
765 Ga0373925_0221396
766 Ga0395899_0010238
767 Ga0395900_0327279
768 Ga0395900_0505932
769 Ga0395900_1081861
770 Ga0395898_0023217
771 Ga0395898_0101326
772 Ga0395898_0224057
773 Ga0395898_0325941
774 Ga0395898_0612419
775 Ga0395898_1493339
776 Ga0395905_0642111
777 Ga0395901_0042760
778 Ga0395901_0138448
779 Ga0395901_0393814
780 Ga0395901_0657853
781 Ga0395901_0994567
782 Ga0436363_0055684
783 Ga0436362_0175188
784 Ga0451807_1379071
785 Ga0451853_3993528
786 Ga0439448_0099604
787 Ga0439458_0102640
788 Ga0439459_0075955
789 Ga0466966_0010047
790 Ga0466961_0097486
791 Ga0466961_0207559
792 Ga0466961_0349024
793 Ga0466963_0001597
794 Ga0466963_0002515
795 Ga0466963_0003177
796 Ga0466963_0008308
797 Ga0466963_0022557
798 Ga0466963_0037458
799 Ga0466963_0105575
800 Ga0466963_0168450
801 Ga0466963_0173863
802 Ga0466963_0257498
803 Ga0466964_0182026
804 Ga0466964_0222970
805 Ga0466964_0294865
806 Ga0453684_0761147
807 Ga0466971_0007730
808 Ga0466971_0122603
809 Ga0466968_0009256
810 Ga0466968_0061984
811 Ga0466968_0640902
812 Ga0466957_0010629
813 Ga0466957_0110847
814 Ga0466957_0216164
815 Ga0466957_0336700
816 Ga0466957_1202121
817 Ga0466960_0480561
818 Ga0466959_0030622
819 Ga0466959_0036320
820 Ga0466959_0294947
821 Ga0466958_0011240
822 Ga0466958_0082718
823 Ga0466958_0290792
824 Ga0466958_0376502
825 Ga0466967_0001818
826 Ga0466967_0014075
827 Ga0466967_0014421
828 Ga0466967_0024515
829 Ga0466967_0034968
830 Ga0466967_0043831
831 Ga0466967_0071578
832 Ga0466967_0084482
833 Ga0466967_0124999
834 Ga0466967_0143843
835 Ga0466967_0217249
836 Ga0466967_0228318
837 Ga0466967_0236732
838 Ga0466967_0640486
839 Ga0466967_0680585
840 Ga0466967_0682671
841 Ga0466967_1300326
842 Ga0466967_1526638
843 Ga0495592_0173676
844 Ga0495592_0193837
845 Ga0495603_0039292
846 Ga0495629_0010429
847 Ga0495629_0079859
848 Ga0495629_0161000
849 Ga0495641_0002128
850 Ga0495641_0084277
851 Ga0495651_0098855
852 Ga0495651_0570853
853 Ga0495653_0021002
854 Ga0495653_0080488
855 Ga0495580_0112465
856 Ga0495582_0000127
857 Ga0495639_0009511
858 Ga0495639_0489915
859 Ga0495662_0004544
860 Ga0495664_0073239
861 Ga0495664_0100321
862 Ga0495608_0024971
863 Ga0495608_0053522
864 Ga0495608_0086014
865 Ga0495608_0421891
866 Ga0495608_0485159
867 Ga0495618_0010197
868 Ga0495618_0599565
869 Ga0495618_0649156
870 Ga0495628_0342397
871 Ga0495630_0055887
872 Ga0495630_0091748
873 Ga0495630_0273383
874 Ga0495630_0413073
875 Ga0495666_0023771
876 Ga0495666_0265190
877 Ga0495652_0103853
878 Ga0495652_0499999
879 Ga0495665_0018121
880 Ga0495640_0068226
881 Ga0495640_0399057
882 Ga0495640_0435209
883 Ga0495640_0460993
884 Ga0495640_0582789
885 Ga0495586_0199732
886 Ga0495586_0494319
887 Ga0495587_0005585
888 Ga0495587_0180087
889 Ga0495645_0093581
890 Ga0495645_0224800
891 Ga0495667_0054821
892 Ga0495667_0139183
893 Ga0495634_0058201
894 Ga0495634_0060692
895 Ga0495634_0094330
896 Ga0495634_0118760
897 Ga0495634_0569954
898 Ga0495635_0023033
899 Ga0495635_0160336
900 Ga0495635_0420857
901 Ga0495657_0159690
902 Ga0495599_0437706
903 Ga0495623_0199855
904 Ga0495646_0064986
905 Ga0495646_0156758
906 Ga0495647_0005513
907 Ga0495658_0001937
908 Ga0495658_0019898
909 Ga0495658_0256727
910 Ga0495658_0383403
911 Ga0495613_0002469
912 Ga0495613_0338138
913 Ga0495624_0009193
914 Ga0495624_0176627
915 Ga0495600_0008885
916 Ga0495600_0030290
917 Ga0495581_0002230
918 Ga0495604_0047092
919 Ga0495674_0058236
920 Ga0495674_0116964
921 Ga0495674_0563661
922 Ga0495676_0050373
923 Ga0495676_0312598
924 Ga0495680_0003111
925 Ga0495680_0016243
926 Ga0495680_0023166
927 Ga0495680_0211471
928 Ga0495680_0481709
929 Ga0495684_0010872
930 Ga0495684_0070711
931 Ga0495684_0192592
932 Ga0495593_0001794
933 Ga0495602_0125585
934 Ga0495602_0956352
935 Ga0495614_0001391
936 Ga0496100_0264411
937 Ga0496101_0470950
938 Ga0496102_0032803
939 Ga0496102_0610848
940 Ga0496103_0459896
941 Ga0496103_0632252
942 Ga0496104_1084277
943 Ga0496105_0121156
944 Ga0496106_0023875
945 Ga0496107_0030308
946 Ga0496108_0626163
947 Ga0496108_1446527
948 Ga0496109_0101040
949 Ga0496109_1540730
950 Ga0496110_0409594
951 Ga0496112_0015436
952 Ga0496112_0097404
953 Ga0496112_0165389
954 Ga0496112_0192692
955 Ga0496112_0195321
956 Ga0496112_0326709
957 Ga0496112_0424887
958 Ga0496113_0032575
959 Ga0496113_0608297
960 Ga0496114_0470588
961 Ga0501034_0126617
962 Ga0501046_0674182
963 Ga0501047_0013261
964 Ga0501047_0177038
965 Ga0501047_0209152
966 Ga0501067_0025117
967 Ga0501067_0071205
968 Ga0501067_0138105
969 Ga0501067_0447537
970 Ga0501069_0152607
971 Ga0501069_0217382
972 Ga0501070_0047956
973 Ga0501070_0125194
974 Ga0501070_0724477
975 Ga0501073_0042852
976 Ga0501074_0005639
977 Ga0501074_0195358
978 Ga0501080_0002832
979 Ga0501035_0289818
980 Ga0501044_0423530
981 nmdc:mga0n895_396681_c1
982 nmdc:mga08x19_206832_c1
983 nmdc:mga0a205_150154_c1
984 Ga0495601_0039309
985 Ga0495601_0560742
986 Ga0495612_0074160
987 Ga0495655_0003215
988 Ga0495595_0037546
989 Ga0495595_0343386
990 Ga0495619_0007443
991 Ga0495619_0008287
992 Ga0495619_0017230
993 Ga0495619_0053885
994 Ga0495619_0230054
995 Ga0501084_0046818
996 Ga0466962_0002758
997 Ga0466962_0024478
998 Ga0466962_0064014
999 Ga0466962_0338115
1000 Ga0530510_0533130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

42

141

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9411 3 148
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9341 3 147
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.9339 3 147
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9297 1 148
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9292 3 147
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9378 3 147 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9229 7 148 3.30.300.20
af_I1LGJ8_386_491_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9203 52 79 3.90.1150.10
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9186 49 148 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9165 4 148 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A538EQH0-F1-model_v4 OsmC family peroxiredoxin 0.9796 1 147 GO:0004601
GO:0006979
AF-A0A7M2YZU4-F1-model_v4 Peroxiredoxin, OsmC subfamily 0.9782 1 148 GO:0004601
GO:0006979
AF-A0A7W1N6Z2-F1-model_v4 OsmC family peroxiredoxin 0.9737 38 146 GO:0004601
GO:0006979
AF-A0A7V9VK09-F1-model_v4 OsmC family peroxiredoxin 0.9653 1 148 GO:0004601
GO:0006979
AF-A0A7W1N6Z2-F1-model_v4 OsmC family peroxiredoxin 0.965 38 146 GO:0004601
GO:0006979

Map