F455365
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 499 | 234 | 499 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10757446|Ga0105241_107574462 |
| Length | 159 |
| Sequence | VIAITPAPEAVSPVYNVSAWGSSKEKLMSQVIPDKFRDLFNKRSFASLSTLMPDGSPQVTPVWCDIEGDLVIVNTAKGRQKDKNMRRDPRVALAIIDPENPYRYLEIRGRIVETTENGAAEHIDKMAKKYLGADKYPYRQPNEVRVIYKILPESVSTMG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 167 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 190 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 221 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 233 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 0 |
| Rhizoplane | 2.61 |
| Rhizosphere | 95.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1035938 | 3300000546 | Unclassified | 536 |
| 2 | rootL2_10244063 | 3300003322 | Bacteria | 2377 |
| 3 | rootH1_10286685 | 3300003323 | Bacteria | 1192 |
| 4 | Ga0065712_10672436 | 3300005290 | Unclassified | 558 |
| 5 | Ga0065712_10709284 | 3300005290 | Bacteria | 543 |
| 6 | Ga0070683_100010905 | 3300005329 | Bacteria | 7825 |
| 7 | Ga0070683_100062131 | 3300005329 | Bacteria | 3473 |
| 8 | Ga0070690_100061631 | 3300005330 | Unclassified | 2417 |
| 9 | Ga0070670_101521414 | 3300005331 | Unclassified | 614 |
| 10 | Ga0070677_10776812 | 3300005333 | Unclassified | 545 |
| 11 | Ga0068869_100057474 | 3300005334 | Bacteria | 2840 |
| 12 | Ga0070666_10828958 | 3300005335 | Unclassified | 682 |
| 13 | Ga0070680_100011744 | 3300005336 | Bacteria | 6791 |
| 14 | Ga0070680_101668830 | 3300005336 | Unclassified | 552 |
| 15 | Ga0068868_100192436 | 3300005338 | Bacteria | 1697 |
| 16 | Ga0070660_100085113 | 3300005339 | Bacteria | 2486 |
| 17 | Ga0070691_10431667 | 3300005341 | Unclassified | 749 |
| 18 | Ga0070687_100441704 | 3300005343 | Unclassified | 863 |
| 19 | Ga0070661_100042486 | 3300005344 | Bacteria | 3318 |
| 20 | Ga0070661_100573881 | 3300005344 | Unclassified | 910 |
| 21 | Ga0070661_100846808 | 3300005344 | Unclassified | 752 |
| 22 | Ga0070669_100168297 | 3300005353 | Unclassified | 1707 |
| 23 | Ga0070669_100704771 | 3300005353 | Unclassified | 853 |
| 24 | Ga0070675_100900201 | 3300005354 | Bacteria | 811 |
| 25 | Ga0070671_100105084 | 3300005355 | Bacteria | 2370 |
| 26 | Ga0070671_101521302 | 3300005355 | Unclassified | 592 |
| 27 | Ga0070673_100337224 | 3300005364 | Bacteria | 1335 |
| 28 | Ga0070673_101417427 | 3300005364 | Unclassified | 654 |
| 29 | Ga0070659_101919364 | 3300005366 | Unclassified | 531 |
| 30 | Ga0070709_10104776 | 3300005434 | Bacteria | 1891 |
| 31 | Ga0070709_10192991 | 3300005434 | Unclassified | 1438 |
| 32 | Ga0070709_10196623 | 3300005434 | Unclassified | 1426 |
| 33 | Ga0070714_100040115 | 3300005435 | Bacteria | 3946 |
| 34 | Ga0070714_100048004 | 3300005435 | Bacteria | 3629 |
| 35 | Ga0070714_100076987 | 3300005435 | Bacteria | 2897 |
| 36 | Ga0070714_100192610 | 3300005435 | Bacteria | 1861 |
| 37 | Ga0070714_100205874 | 3300005435 | Bacteria | 1802 |
| 38 | Ga0070713_100002376 | 3300005436 | Bacteria | 12263 |
| 39 | Ga0070713_100045022 | 3300005436 | Unclassified | 3614 |
| 40 | Ga0070713_100058527 | 3300005436 | Unclassified | 3214 |
| 41 | Ga0070713_100232336 | 3300005436 | Bacteria | 1677 |
| 42 | Ga0070713_100403675 | 3300005436 | Unclassified | 1277 |
| 43 | Ga0070711_100025331 | 3300005439 | Bacteria | 3881 |
| 44 | Ga0070711_100122680 | 3300005439 | Bacteria | 1924 |
| 45 | Ga0070711_100523138 | 3300005439 | Unclassified | 981 |
| 46 | Ga0070711_101440437 | 3300005439 | Unclassified | 600 |
| 47 | Ga0070705_100155178 | 3300005440 | Archaea | 1523 |
| 48 | Ga0070705_100577133 | 3300005440 | Unclassified | 866 |
| 49 | Ga0070694_100017333 | 3300005444 | Archaea | 4549 |
| 50 | Ga0070694_101146934 | 3300005444 | Unclassified | 650 |
| 51 | Ga0070708_100031279 | 3300005445 | Bacteria | 4606 |
| 52 | Ga0070708_100070584 | 3300005445 | Unclassified | 3142 |
| 53 | Ga0070708_101224516 | 3300005445 | Bacteria | 702 |
| 54 | Ga0070678_100913915 | 3300005456 | Unclassified | 803 |
| 55 | Ga0070681_10000858 | 3300005458 | Bacteria | 25550 |
| 56 | Ga0070681_10017216 | 3300005458 | Bacteria | 7226 |
| 57 | Ga0070681_10094586 | 3300005458 | Bacteria | 2937 |
| 58 | Ga0068867_100010529 | 3300005459 | Bacteria | 6526 |
| 59 | Ga0068867_100057107 | 3300005459 | Bacteria | 2890 |
| 60 | Ga0070706_100001682 | 3300005467 | Bacteria | 23043 |
| 61 | Ga0070706_100515412 | 3300005467 | Unclassified | 1112 |
| 62 | Ga0070707_100000591 | 3300005468 | Bacteria | 36492 |
| 63 | Ga0070707_100002000 | 3300005468 | Bacteria | 19516 |
| 64 | Ga0070707_100854108 | 3300005468 | Unclassified | 874 |
| 65 | Ga0070698_100000375 | 3300005471 | Bacteria | 46615 |
| 66 | Ga0070698_100030629 | 3300005471 | Bacteria | 5578 |
| 67 | Ga0070699_100002758 | 3300005518 | Bacteria | 15661 |
| 68 | Ga0070699_100048157 | 3300005518 | Bacteria | 3688 |
| 69 | Ga0070699_100488852 | 3300005518 | Archaea | 1117 |
| 70 | Ga0070679_100656507 | 3300005530 | Bacteria | 991 |
| 71 | Ga0070684_100128265 | 3300005535 | Bacteria | 2287 |
| 72 | Ga0070684_100814590 | 3300005535 | Unclassified | 873 |
| 73 | Ga0070697_100004133 | 3300005536 | Bacteria | 11125 |
| 74 | Ga0070697_100004988 | 3300005536 | Bacteria | 10189 |
| 75 | Ga0070697_100044629 | 3300005536 | Archaea | 3591 |
| 76 | Ga0070697_100558820 | 3300005536 | Unclassified | 1004 |
| 77 | Ga0070697_100795465 | 3300005536 | Unclassified | 837 |
| 78 | Ga0068853_100037072 | 3300005539 | Bacteria | 4147 |
| 79 | Ga0068853_100415506 | 3300005539 | Bacteria | 1261 |
| 80 | Ga0070672_100719220 | 3300005543 | Unclassified | 875 |
| 81 | Ga0070686_100367063 | 3300005544 | Bacteria | 1086 |
| 82 | Ga0070695_100403472 | 3300005545 | Unclassified | 1037 |
| 83 | Ga0070695_100413080 | 3300005545 | Unclassified | 1026 |
| 84 | Ga0070696_100167807 | 3300005546 | Bacteria | 1621 |
| 85 | Ga0070696_100305696 | 3300005546 | Archaea | 1219 |
| 86 | Ga0070696_101215816 | 3300005546 | Unclassified | 637 |
| 87 | Ga0070696_101995072 | 3300005546 | Unclassified | 504 |
| 88 | Ga0070693_100005329 | 3300005547 | Bacteria | 6167 |
| 89 | Ga0070693_100117236 | 3300005547 | Bacteria | 1647 |
| 90 | Ga0070693_101220038 | 3300005547 | Bacteria | 578 |
| 91 | Ga0070665_100231186 | 3300005548 | Bacteria | 1849 |
| 92 | Ga0070704_100008254 | 3300005549 | Archaea | 6233 |
| 93 | Ga0070704_100055269 | 3300005549 | Bacteria | 2814 |
| 94 | Ga0068855_100038914 | 3300005563 | Bacteria | 5647 |
| 95 | Ga0068855_100044583 | 3300005563 | Bacteria | 5249 |
| 96 | Ga0068855_100113160 | 3300005563 | Unclassified | 3114 |
| 97 | Ga0068855_100188121 | 3300005563 | Bacteria | 2331 |
| 98 | Ga0068855_100208892 | 3300005563 | Bacteria | 2195 |
| 99 | Ga0068855_101287772 | 3300005563 | Unclassified | 757 |
| 100 | Ga0070664_100000655 | 3300005564 | Bacteria | 26466 |
| 101 | Ga0070664_100161237 | 3300005564 | Bacteria | 1984 |
| 102 | Ga0070664_100295899 | 3300005564 | Bacteria | 1462 |
| 103 | Ga0070664_100759865 | 3300005564 | Bacteria | 905 |
| 104 | Ga0068857_100001890 | 3300005577 | Bacteria | 16879 |
| 105 | Ga0068857_100003336 | 3300005577 | Bacteria | 13363 |
| 106 | Ga0068857_101230842 | 3300005577 | Bacteria | 725 |
| 107 | Ga0068854_100038150 | 3300005578 | Bacteria | 3377 |
| 108 | Ga0068854_100535342 | 3300005578 | Bacteria | 991 |
| 109 | Ga0068856_100001186 | 3300005614 | Bacteria | 27468 |
| 110 | Ga0068856_100013056 | 3300005614 | Bacteria | 8046 |
| 111 | Ga0068856_100032697 | 3300005614 | Bacteria | 5094 |
| 112 | Ga0068856_100038258 | 3300005614 | Bacteria | 4709 |
| 113 | Ga0068856_100070817 | 3300005614 | Unclassified | 3450 |
| 114 | Ga0070702_100228540 | 3300005615 | Unclassified | 1248 |
| 115 | Ga0070702_100848396 | 3300005615 | Unclassified | 711 |
| 116 | Ga0068852_100009585 | 3300005616 | Bacteria | 7196 |
| 117 | Ga0068852_100203208 | 3300005616 | Bacteria | 1876 |
| 118 | Ga0068859_100033660 | 3300005617 | Bacteria | 5145 |
| 119 | Ga0068859_100041212 | 3300005617 | Bacteria | 4638 |
| 120 | Ga0068864_100000347 | 3300005618 | Bacteria | 40801 |
| 121 | Ga0068864_100004216 | 3300005618 | Bacteria | 11828 |
| 122 | Ga0068864_101226741 | 3300005618 | Unclassified | 749 |
| 123 | Ga0068866_10244525 | 3300005718 | Unclassified | 1094 |
| 124 | Ga0068861_100451455 | 3300005719 | Bacteria | 1152 |
| 125 | Ga0068861_100730398 | 3300005719 | Unclassified | 923 |
| 126 | Ga0068851_10128176 | 3300005834 | Unclassified | 1370 |
| 127 | Ga0068863_100184209 | 3300005841 | Bacteria | 2005 |
| 128 | Ga0068863_100353500 | 3300005841 | Bacteria | 1431 |
| 129 | Ga0068863_100414945 | 3300005841 | Bacteria | 1318 |
| 130 | Ga0068858_100003905 | 3300005842 | Bacteria | 14724 |
| 131 | Ga0068858_100006670 | 3300005842 | Bacteria | 11227 |
| 132 | Ga0068858_100155750 | 3300005842 | Bacteria | 2150 |
| 133 | Ga0068860_100021893 | 3300005843 | Bacteria | 6185 |
| 134 | Ga0068860_100119519 | 3300005843 | Bacteria | 2523 |
| 135 | Ga0068860_100318740 | 3300005843 | Bacteria | 1526 |
| 136 | Ga0068860_100539901 | 3300005843 | Bacteria | 1167 |
| 137 | Ga0068860_100575194 | 3300005843 | Bacteria | 1130 |
| 138 | Ga0068862_100026666 | 3300005844 | Bacteria | 4858 |
| 139 | Ga0068862_100207702 | 3300005844 | Bacteria | 1768 |
| 140 | Ga0068862_100225783 | 3300005844 | Bacteria | 1697 |
| 141 | Ga0081455_10019817 | 3300005937 | Bacteria | 6352 |
| 142 | Ga0081455_10514430 | 3300005937 | Unclassified | 800 |
| 143 | Ga0081540_1045540 | 3300005983 | Bacteria | 2226 |
| 144 | Ga0070717_10038338 | 3300006028 | Bacteria | 3895 |
| 145 | Ga0070717_10230632 | 3300006028 | Unclassified | 1630 |
| 146 | Ga0070715_10627900 | 3300006163 | Unclassified | 633 |
| 147 | Ga0070716_100137851 | 3300006173 | Bacteria | 1552 |
| 148 | Ga0070716_100171015 | 3300006173 | Bacteria | 1418 |
| 149 | Ga0070712_100010608 | 3300006175 | Bacteria | 5819 |
| 150 | Ga0070712_100232026 | 3300006175 | Unclassified | 1466 |
| 151 | Ga0070712_100655557 | 3300006175 | Unclassified | 892 |
| 152 | Ga0097621_100000133 | 3300006237 | Bacteria | 43711 |
| 153 | Ga0097621_100017370 | 3300006237 | Bacteria | 5461 |
| 154 | Ga0097621_100020479 | 3300006237 | Bacteria | 5096 |
| 155 | Ga0097621_100051862 | 3300006237 | Bacteria | 3339 |
| 156 | Ga0068871_100000448 | 3300006358 | Bacteria | 28345 |
| 157 | Ga0068871_100003253 | 3300006358 | Bacteria | 11143 |
| 158 | Ga0068871_100066191 | 3300006358 | Unclassified | 2961 |
| 159 | Ga0068871_100079138 | 3300006358 | Bacteria | 2719 |
| 160 | Ga0068871_100113343 | 3300006358 | Bacteria | 2283 |
| 161 | Ga0068871_100114893 | 3300006358 | Bacteria | 2268 |
| 162 | Ga0068871_100678711 | 3300006358 | Unclassified | 942 |
| 163 | Ga0075428_100000407 | 3300006844 | Bacteria | 42753 |
| 164 | Ga0075428_100316630 | 3300006844 | Bacteria | 1677 |
| 165 | Ga0075428_100438915 | 3300006844 | Bacteria | 1398 |
| 166 | Ga0075430_100557526 | 3300006846 | Bacteria | 945 |
| 167 | Ga0075431_100608694 | 3300006847 | Bacteria | 1076 |
| 168 | Ga0075431_102144044 | 3300006847 | Unclassified | 513 |
| 169 | Ga0075433_10363389 | 3300006852 | Bacteria | 1278 |
| 170 | Ga0075434_100012876 | 3300006871 | Bacteria | 7945 |
| 171 | Ga0075434_100901338 | 3300006871 | Unclassified | 899 |
| 172 | Ga0075429_100440271 | 3300006880 | Bacteria | 1142 |
| 173 | Ga0068865_100132421 | 3300006881 | Bacteria | 1870 |
| 174 | Ga0068865_100293756 | 3300006881 | Bacteria | 1298 |
| 175 | Ga0075436_100027872 | 3300006914 | Unclassified | 3888 |
| 176 | Ga0075436_101272081 | 3300006914 | Unclassified | 556 |
| 177 | Ga0097620_100033662 | 3300006931 | Bacteria | 5145 |
| 178 | Ga0097620_100041212 | 3300006931 | Bacteria | 4638 |
| 179 | Ga0075435_100076717 | 3300007076 | Bacteria | 2739 |
| 180 | Ga0105240_10012666 | 3300009093 | Bacteria | 11625 |
| 181 | Ga0105240_10053713 | 3300009093 | Bacteria | 5055 |
| 182 | Ga0105240_10154863 | 3300009093 | Bacteria | 2727 |
| 183 | Ga0105240_10163995 | 3300009093 | Unclassified | 2637 |
| 184 | Ga0105240_10242833 | 3300009093 | Bacteria | 2087 |
| 185 | Ga0111539_10012318 | 3300009094 | Bacteria | 10716 |
| 186 | Ga0111539_12037365 | 3300009094 | Unclassified | 666 |
| 187 | Ga0105245_10237128 | 3300009098 | Unclassified | 1767 |
| 188 | Ga0105245_11248923 | 3300009098 | Bacteria | 791 |
| 189 | Ga0105247_10018885 | 3300009101 | Unclassified | 4139 |
| 190 | Ga0105247_10728515 | 3300009101 | Unclassified | 749 |
| 191 | Ga0114129_10000472 | 3300009147 | Bacteria | 48405 |
| 192 | Ga0114129_10166153 | 3300009147 | Bacteria | 3011 |
| 193 | Ga0114129_10200534 | 3300009147 | Bacteria | 2703 |
| 194 | Ga0114129_10208891 | 3300009147 | Bacteria | 2640 |
| 195 | Ga0114129_10835578 | 3300009147 | Bacteria | 1172 |
| 196 | Ga0114129_11371604 | 3300009147 | Unclassified | 873 |
| 197 | Ga0105243_10114819 | 3300009148 | Bacteria | 2260 |
| 198 | Ga0105241_10034189 | 3300009174 | Bacteria | 3818 |
| 199 | Ga0105241_10041323 | 3300009174 | Bacteria | 3484 |
| 200 | Ga0105241_10160210 | 3300009174 | Bacteria | 1849 |
| 201 | Ga0105241_10176486 | 3300009174 | Bacteria | 1769 |
| 202 | Ga0105241_10757446 | 3300009174 | Unclassified | 891 |
| 203 | Ga0105242_10575640 | 3300009176 | Bacteria | 1084 |
| 204 | Ga0105242_11493029 | 3300009176 | Unclassified | 706 |
| 205 | Ga0105248_10026986 | 3300009177 | Bacteria | 6388 |
| 206 | Ga0105248_10070839 | 3300009177 | Bacteria | 3915 |
| 207 | Ga0105237_10049680 | 3300009545 | Bacteria | 4215 |
| 208 | Ga0105237_10062101 | 3300009545 | Bacteria | 3735 |
| 209 | Ga0105237_10300718 | 3300009545 | Unclassified | 1608 |
| 210 | Ga0105237_10314293 | 3300009545 | Bacteria | 1570 |
| 211 | Ga0105237_10571910 | 3300009545 | Unclassified | 1137 |
| 212 | Ga0105237_10594889 | 3300009545 | Bacteria | 1113 |
| 213 | Ga0105237_11154934 | 3300009545 | Unclassified | 781 |
| 214 | Ga0105237_11187055 | 3300009545 | Bacteria | 770 |
| 215 | Ga0105237_12591154 | 3300009545 | Unclassified | 518 |
| 216 | Ga0105238_10000368 | 3300009551 | Bacteria | 48371 |
| 217 | Ga0105238_10216908 | 3300009551 | Bacteria | 1889 |
| 218 | Ga0105249_10140411 | 3300009553 | Unclassified | 2316 |
| 219 | Ga0105239_10018608 | 3300010375 | Bacteria | 7673 |
| 220 | Ga0105239_10428165 | 3300010375 | Bacteria | 1500 |
| 221 | Ga0105239_10616543 | 3300010375 | Bacteria | 1238 |
| 222 | Ga0105246_10063510 | 3300011119 | Bacteria | 2576 |
| 223 | Ga0157373_10021467 | 3300013100 | Bacteria | 4690 |
| 224 | Ga0157373_10140135 | 3300013100 | Bacteria | 1700 |
| 225 | Ga0157373_10162511 | 3300013100 | Bacteria | 1571 |
| 226 | Ga0157373_10174529 | 3300013100 | Unclassified | 1513 |
| 227 | Ga0157373_10426942 | 3300013100 | Unclassified | 952 |
| 228 | Ga0157371_10475769 | 3300013102 | Unclassified | 920 |
| 229 | Ga0157371_10527787 | 3300013102 | Unclassified | 873 |
| 230 | Ga0157370_10071517 | 3300013104 | Bacteria | 3273 |
| 231 | Ga0157370_10314773 | 3300013104 | Unclassified | 1444 |
| 232 | Ga0157369_10006808 | 3300013105 | Bacteria | 13181 |
| 233 | Ga0157369_10026425 | 3300013105 | Bacteria | 6438 |
| 234 | Ga0157369_10035928 | 3300013105 | Bacteria | 5431 |
| 235 | Ga0157369_10083788 | 3300013105 | Unclassified | 3409 |
| 236 | Ga0157369_10706963 | 3300013105 | Unclassified | 1038 |
| 237 | Ga0157369_11685427 | 3300013105 | Unclassified | 644 |
| 238 | Ga0157374_10000254 | 3300013296 | Bacteria | 49194 |
| 239 | Ga0157374_10000302 | 3300013296 | Bacteria | 45742 |
| 240 | Ga0157374_10001933 | 3300013296 | Bacteria | 17370 |
| 241 | Ga0157374_10022733 | 3300013296 | Bacteria | 5598 |
| 242 | Ga0157374_10151785 | 3300013296 | Bacteria | 2252 |
| 243 | Ga0157378_10000055 | 3300013297 | Bacteria | 97875 |
| 244 | Ga0157378_10000554 | 3300013297 | Bacteria | 35545 |
| 245 | Ga0157378_10050680 | 3300013297 | Bacteria | 3694 |
| 246 | Ga0157378_10197896 | 3300013297 | Bacteria | 1899 |
| 247 | Ga0157378_10603933 | 3300013297 | Unclassified | 1109 |
| 248 | Ga0163162_10312975 | 3300013306 | Bacteria | 1703 |
| 249 | Ga0157372_10000661 | 3300013307 | Bacteria | 37855 |
| 250 | Ga0157372_10001984 | 3300013307 | Bacteria | 22243 |
| 251 | Ga0157372_10002739 | 3300013307 | Bacteria | 19040 |
| 252 | Ga0157372_10030721 | 3300013307 | Bacteria | 5878 |
| 253 | Ga0157372_10037604 | 3300013307 | Bacteria | 5341 |
| 254 | Ga0157372_10070218 | 3300013307 | Unclassified | 3940 |
| 255 | Ga0157372_10075292 | 3300013307 | Bacteria | 3809 |
| 256 | Ga0157372_10333653 | 3300013307 | Bacteria | 1766 |
| 257 | Ga0157372_11745418 | 3300013307 | Unclassified | 716 |
| 258 | Ga0157372_11966979 | 3300013307 | Unclassified | 672 |
| 259 | Ga0157375_10236237 | 3300013308 | Bacteria | 1987 |
| 260 | Ga0163163_10678328 | 3300014325 | Unclassified | 1094 |
| 261 | Ga0163163_10876256 | 3300014325 | Bacteria | 961 |
| 262 | Ga0157380_10101877 | 3300014326 | Bacteria | 2393 |
| 263 | Ga0157380_10411414 | 3300014326 | Unclassified | 1287 |
| 264 | Ga0157380_11130282 | 3300014326 | Bacteria | 824 |
| 265 | Ga0157377_10123562 | 3300014745 | Bacteria | 1572 |
| 266 | Ga0157377_10370357 | 3300014745 | Unclassified | 967 |
| 267 | Ga0157379_10037210 | 3300014968 | Unclassified | 4338 |
| 268 | Ga0157376_10180109 | 3300014969 | Bacteria | 1931 |
| 269 | Ga0157376_10626621 | 3300014969 | Bacteria | 1073 |
| 270 | Ga0213873_10007662 | 3300021358 | Unclassified | 2172 |
| 271 | Ga0213875_10118931 | 3300021388 | Bacteria | 1234 |
| 272 | Ga0207697_10424993 | 3300025315 | Unclassified | 590 |
| 273 | Ga0207656_10138394 | 3300025321 | Unclassified | 1146 |
| 274 | Ga0207642_10444759 | 3300025899 | Unclassified | 784 |
| 275 | Ga0207688_10402040 | 3300025901 | Unclassified | 849 |
| 276 | Ga0207647_10000903 | 3300025904 | Bacteria | 22977 |
| 277 | Ga0207647_10078719 | 3300025904 | Unclassified | 1980 |
| 278 | Ga0207685_10148843 | 3300025905 | Unclassified | 1057 |
| 279 | Ga0207699_10089305 | 3300025906 | Bacteria | 1931 |
| 280 | Ga0207699_10139235 | 3300025906 | Unclassified | 1593 |
| 281 | Ga0207645_10434367 | 3300025907 | Unclassified | 885 |
| 282 | Ga0207684_10014797 | 3300025910 | Bacteria | 6718 |
| 283 | Ga0207684_10392366 | 3300025910 | Bacteria | 1193 |
| 284 | Ga0207684_10444213 | 3300025910 | Unclassified | 1114 |
| 285 | Ga0207654_10008545 | 3300025911 | Bacteria | 5185 |
| 286 | Ga0207654_10042499 | 3300025911 | Bacteria | 2573 |
| 287 | Ga0207654_10833837 | 3300025911 | Unclassified | 667 |
| 288 | Ga0207707_10010028 | 3300025912 | Bacteria | 8219 |
| 289 | Ga0207707_10016930 | 3300025912 | Bacteria | 6350 |
| 290 | Ga0207707_10566349 | 3300025912 | Bacteria | 964 |
| 291 | Ga0207695_10023048 | 3300025913 | Bacteria | 7048 |
| 292 | Ga0207695_10024582 | 3300025913 | Bacteria | 6771 |
| 293 | Ga0207695_10096246 | 3300025913 | Bacteria | 2962 |
| 294 | Ga0207695_10219021 | 3300025913 | Unclassified | 1811 |
| 295 | Ga0207695_10545590 | 3300025913 | Unclassified | 1041 |
| 296 | Ga0207695_10875569 | 3300025913 | Bacteria | 778 |
| 297 | Ga0207671_10031806 | 3300025914 | Bacteria | 3931 |
| 298 | Ga0207671_10051514 | 3300025914 | Unclassified | 3051 |
| 299 | Ga0207671_10354978 | 3300025914 | Bacteria | 1163 |
| 300 | Ga0207671_10456207 | 3300025914 | Bacteria | 1018 |
| 301 | Ga0207671_10880263 | 3300025914 | Unclassified | 708 |
| 302 | Ga0207671_11255758 | 3300025914 | Bacteria | 578 |
| 303 | Ga0207671_11510401 | 3300025914 | Unclassified | 518 |
| 304 | Ga0207693_10147969 | 3300025915 | Bacteria | 1847 |
| 305 | Ga0207693_10494367 | 3300025915 | Bacteria | 955 |
| 306 | Ga0207693_10778010 | 3300025915 | Bacteria | 738 |
| 307 | Ga0207693_10857051 | 3300025915 | Unclassified | 698 |
| 308 | Ga0207663_10463199 | 3300025916 | Bacteria | 979 |
| 309 | Ga0207663_10838494 | 3300025916 | Bacteria | 733 |
| 310 | Ga0207663_11021039 | 3300025916 | Unclassified | 664 |
| 311 | Ga0207663_11403540 | 3300025916 | Bacteria | 562 |
| 312 | Ga0207660_10037639 | 3300025917 | Bacteria | 3373 |
| 313 | Ga0207657_10194614 | 3300025919 | Bacteria | 1634 |
| 314 | Ga0207649_10085349 | 3300025920 | Unclassified | 2054 |
| 315 | Ga0207649_11622856 | 3300025920 | Unclassified | 512 |
| 316 | Ga0207652_10799491 | 3300025921 | Bacteria | 837 |
| 317 | Ga0207652_11847023 | 3300025921 | Unclassified | 509 |
| 318 | Ga0207646_10000742 | 3300025922 | Bacteria | 42389 |
| 319 | Ga0207646_10001179 | 3300025922 | Bacteria | 32952 |
| 320 | Ga0207681_10152384 | 3300025923 | Bacteria | 1734 |
| 321 | Ga0207694_10001767 | 3300025924 | Bacteria | 18091 |
| 322 | Ga0207694_10071998 | 3300025924 | Bacteria | 2702 |
| 323 | Ga0207694_10302177 | 3300025924 | Unclassified | 1318 |
| 324 | Ga0207650_11128038 | 3300025925 | Unclassified | 667 |
| 325 | Ga0207687_11246365 | 3300025927 | Unclassified | 639 |
| 326 | Ga0207700_10084080 | 3300025928 | Unclassified | 2493 |
| 327 | Ga0207700_10124979 | 3300025928 | Bacteria | 2091 |
| 328 | Ga0207700_10184344 | 3300025928 | Bacteria | 1750 |
| 329 | Ga0207700_10688629 | 3300025928 | Unclassified | 912 |
| 330 | Ga0207700_11823822 | 3300025928 | Bacteria | 534 |
| 331 | Ga0207664_10025845 | 3300025929 | Bacteria | 4429 |
| 332 | Ga0207664_10054863 | 3300025929 | Bacteria | 3159 |
| 333 | Ga0207664_10122714 | 3300025929 | Bacteria | 2176 |
| 334 | Ga0207664_10332556 | 3300025929 | Unclassified | 1342 |
| 335 | Ga0207664_11111057 | 3300025929 | Unclassified | 706 |
| 336 | Ga0207644_10125475 | 3300025931 | Bacteria | 1959 |
| 337 | Ga0207706_10831108 | 3300025933 | Unclassified | 783 |
| 338 | Ga0207686_10750670 | 3300025934 | Unclassified | 779 |
| 339 | Ga0207704_10004764 | 3300025938 | Bacteria | 6227 |
| 340 | Ga0207704_10159875 | 3300025938 | Bacteria | 1601 |
| 341 | Ga0207665_10156576 | 3300025939 | Unclassified | 1636 |
| 342 | Ga0207665_10307934 | 3300025939 | Bacteria | 1186 |
| 343 | Ga0207665_10913377 | 3300025939 | Bacteria | 697 |
| 344 | Ga0207691_10282607 | 3300025940 | Bacteria | 1428 |
| 345 | Ga0207691_10691597 | 3300025940 | Unclassified | 860 |
| 346 | Ga0207711_10062799 | 3300025941 | Bacteria | 3205 |
| 347 | Ga0207711_11330862 | 3300025941 | Unclassified | 661 |
| 348 | Ga0207689_10000788 | 3300025942 | Bacteria | 30435 |
| 349 | Ga0207689_10338048 | 3300025942 | Unclassified | 1250 |
| 350 | Ga0207661_10106361 | 3300025944 | Bacteria | 2365 |
| 351 | Ga0207661_11031510 | 3300025944 | Unclassified | 757 |
| 352 | Ga0207661_11038252 | 3300025944 | Unclassified | 755 |
| 353 | Ga0207679_10062560 | 3300025945 | Unclassified | 2774 |
| 354 | Ga0207679_10115941 | 3300025945 | Bacteria | 2123 |
| 355 | Ga0207667_10010578 | 3300025949 | Bacteria | 10777 |
| 356 | Ga0207667_10035751 | 3300025949 | Bacteria | 5328 |
| 357 | Ga0207667_10043425 | 3300025949 | Bacteria | 4770 |
| 358 | Ga0207667_10127389 | 3300025949 | Unclassified | 2623 |
| 359 | Ga0207667_10205283 | 3300025949 | Bacteria | 2021 |
| 360 | Ga0207667_10339051 | 3300025949 | Bacteria | 1534 |
| 361 | Ga0207667_11135505 | 3300025949 | Unclassified | 763 |
| 362 | Ga0207651_10319853 | 3300025960 | Unclassified | 1297 |
| 363 | Ga0207651_10496908 | 3300025960 | Bacteria | 1054 |
| 364 | Ga0207712_11524496 | 3300025961 | Unclassified | 599 |
| 365 | Ga0207668_10892149 | 3300025972 | Bacteria | 791 |
| 366 | Ga0207640_10037949 | 3300025981 | Bacteria | 3036 |
| 367 | Ga0207640_10457662 | 3300025981 | Unclassified | 1053 |
| 368 | Ga0207640_10492854 | 3300025981 | Bacteria | 1019 |
| 369 | Ga0207640_10555446 | 3300025981 | Bacteria | 965 |
| 370 | Ga0207658_10209729 | 3300025986 | Bacteria | 1632 |
| 371 | Ga0207677_10085004 | 3300026023 | Bacteria | 2282 |
| 372 | Ga0207677_11318499 | 3300026023 | Unclassified | 663 |
| 373 | Ga0207703_10017439 | 3300026035 | Bacteria | 5604 |
| 374 | Ga0207703_10025019 | 3300026035 | Bacteria | 4696 |
| 375 | Ga0207703_10149566 | 3300026035 | Bacteria | 2035 |
| 376 | Ga0207639_10029075 | 3300026041 | Bacteria | 4043 |
| 377 | Ga0207639_10281803 | 3300026041 | Bacteria | 1462 |
| 378 | Ga0207639_10389554 | 3300026041 | Bacteria | 1253 |
| 379 | Ga0207708_11214608 | 3300026075 | Unclassified | 659 |
| 380 | Ga0207702_10001337 | 3300026078 | Bacteria | 24659 |
| 381 | Ga0207702_10002787 | 3300026078 | Bacteria | 16382 |
| 382 | Ga0207702_10013220 | 3300026078 | Bacteria | 6864 |
| 383 | Ga0207702_10429122 | 3300026078 | Bacteria | 1279 |
| 384 | Ga0207702_10439410 | 3300026078 | Bacteria | 1264 |
| 385 | Ga0207641_10337580 | 3300026088 | Bacteria | 1433 |
| 386 | Ga0207641_10952717 | 3300026088 | Unclassified | 854 |
| 387 | Ga0207648_10002663 | 3300026089 | Bacteria | 19026 |
| 388 | Ga0207648_10050680 | 3300026089 | Bacteria | 3629 |
| 389 | Ga0207676_10007557 | 3300026095 | Bacteria | 7711 |
| 390 | Ga0207676_10041511 | 3300026095 | Bacteria | 3532 |
| 391 | Ga0207674_10000514 | 3300026116 | Bacteria | 50775 |
| 392 | Ga0207674_10002979 | 3300026116 | Bacteria | 21005 |
| 393 | Ga0207674_11584276 | 3300026116 | Unclassified | 624 |
| 394 | Ga0207675_100048527 | 3300026118 | Bacteria | 3963 |
| 395 | Ga0207675_101241456 | 3300026118 | Bacteria | 766 |
| 396 | Ga0207683_10344806 | 3300026121 | Bacteria | 1366 |
| 397 | Ga0207683_11018176 | 3300026121 | Unclassified | 769 |
| 398 | Ga0207698_10100327 | 3300026142 | Unclassified | 2397 |
| 399 | Ga0207698_10778502 | 3300026142 | Unclassified | 957 |
| 400 | Ga0207698_11098042 | 3300026142 | Unclassified | 808 |
| 401 | Ga0207428_10010335 | 3300027907 | Bacteria | 8344 |
| 402 | Ga0265354_1004140 | 3300028016 | Bacteria | 1548 |
| 403 | Ga0265355_1002924 | 3300028036 | Bacteria | 1229 |
| 404 | Ga0268266_10362459 | 3300028379 | Bacteria | 1364 |
| 405 | Ga0268265_10100064 | 3300028380 | Bacteria | 2339 |
| 406 | Ga0268264_10053356 | 3300028381 | Unclassified | 3372 |
| 407 | Ga0268264_10075735 | 3300028381 | Bacteria | 2861 |
| 408 | Ga0268264_10147562 | 3300028381 | Bacteria | 2105 |
| 409 | Ga0265770_1006881 | 3300030878 | Bacteria | 1587 |
| 410 | Ga0265765_1060876 | 3300030879 | Bacteria | 533 |
| 411 | Ga0265760_10002657 | 3300031090 | Bacteria | 5230 |
| 412 | Ga0265760_10003777 | 3300031090 | Bacteria | 4391 |
| 413 | Ga0265760_10062877 | 3300031090 | Bacteria | 1130 |
| 414 | Ga0265320_10291436 | 3300031240 | Unclassified | 722 |
| 415 | Ga0307414_12295469 | 3300032004 | Bacteria | 504 |
| 416 | Ga0373934_0137766 | 3300035086 | Bacteria | 997 |
| 417 | Ga0373953_0302855 | 3300035117 | Bacteria | 698 |
| 418 | Ga0373960_0101156 | 3300035121 | Bacteria | 934 |
| 419 | Ga0373955_0112953 | 3300035172 | Bacteria | 1572 |
| 420 | Ga0373931_0080917 | 3300035691 | Bacteria | 1792 |
| 421 | Ga0373931_0137390 | 3300035691 | Unclassified | 1412 |
| 422 | Ga0373931_0296946 | 3300035691 | Bacteria | 996 |
| 423 | Ga0373927_0301073 | 3300035695 | Bacteria | 1055 |
| 424 | Ga0373947_0073091 | 3300035725 | Bacteria | 2107 |
| 425 | Ga0373937_1045288 | 3300036401 | Unclassified | 765 |
| 426 | Ga0373925_0581965 | 3300037068 | Unclassified | 921 |
| 427 | Ga0395901_0792401 | 3300038443 | Unclassified | 937 |
| 428 | Ga0436365_0306336 | 3300039437 | Unclassified | 855 |
| 429 | Ga0436363_0192214 | 3300039450 | Unclassified | 1233 |
| 430 | Ga0436363_0951780 | 3300039450 | Unclassified | 944 |
| 431 | Ga0436362_0814820 | 3300039453 | Bacteria | 4946 |
| 432 | Ga0451839_0427549 | 3300041496 | Unclassified | 1098 |
| 433 | Ga0453683_0018226 | 3300044673 | Archaea | 4508 |
| 434 | Ga0466965_0171362 | 3300044683 | Bacteria | 1142 |
| 435 | Ga0466966_0348016 | 3300044684 | Unclassified | 891 |
| 436 | Ga0466961_0274994 | 3300044693 | Bacteria | 1031 |
| 437 | Ga0466963_0040977 | 3300044694 | Bacteria | 3036 |
| 438 | Ga0466963_0043209 | 3300044694 | Unclassified | 2962 |
| 439 | Ga0466964_0048888 | 3300044706 | Bacteria | 1731 |
| 440 | Ga0453684_0466643 | 3300044712 | Bacteria | 1403 |
| 441 | Ga0466957_0101837 | 3300044842 | Unclassified | 1811 |
| 442 | Ga0466959_0255632 | 3300045049 | Bacteria | 1207 |
| 443 | Ga0451576_0151412 | 3300045051 | Bacteria | 2419 |
| 444 | Ga0451576_0228681 | 3300045051 | Bacteria | 1942 |
| 445 | Ga0451576_0530996 | 3300045051 | Bacteria | 1236 |
| 446 | Ga0451576_2075084 | 3300045051 | Unclassified | 585 |
| 447 | Ga0466958_0187435 | 3300045836 | Bacteria | 1314 |
| 448 | Ga0466958_0578952 | 3300045836 | Bacteria | 730 |
| 449 | Ga0466967_0154733 | 3300045976 | Bacteria | 2146 |
| 450 | Ga0466967_0355207 | 3300045976 | Bacteria | 1419 |
| 451 | Ga0466967_0370892 | 3300045976 | Bacteria | 1388 |
| 452 | Ga0495590_0123115 | 3300046457 | Unclassified | 930 |
| 453 | Ga0495580_0058661 | 3300046472 | Unclassified | 2706 |
| 454 | Ga0495580_0141720 | 3300046472 | Bacteria | 1666 |
| 455 | Ga0495628_1004218 | 3300046516 | Bacteria | 574 |
| 456 | Ga0495645_0858414 | 3300046543 | Bacteria | 541 |
| 457 | Ga0495667_0604608 | 3300046559 | Bacteria | 683 |
| 458 | Ga0495623_0439141 | 3300046679 | Unclassified | 697 |
| 459 | Ga0495674_1493393 | 3300047319 | Bacteria | 500 |
| 460 | Ga0496102_0144152 | 3300048905 | Bacteria | 2234 |
| 461 | Ga0496102_1247825 | 3300048905 | Bacteria | 662 |
| 462 | Ga0496104_0085166 | 3300048907 | Bacteria | 3017 |
| 463 | Ga0496104_0124899 | 3300048907 | Bacteria | 2471 |
| 464 | Ga0496104_0967714 | 3300048907 | Unclassified | 755 |
| 465 | Ga0496105_1057301 | 3300048908 | Unclassified | 604 |
| 466 | Ga0496112_0009029 | 3300048915 | Bacteria | 8954 |
| 467 | Ga0496112_0046687 | 3300048915 | Unclassified | 4249 |
| 468 | Ga0496112_0058269 | 3300048915 | Bacteria | 3803 |
| 469 | Ga0496112_0306799 | 3300048915 | Bacteria | 1532 |
| 470 | Ga0496113_0312706 | 3300048916 | Unclassified | 1259 |
| 471 | Ga0496113_0449744 | 3300048916 | Bacteria | 1035 |
| 472 | Ga0496115_0304666 | 3300048918 | Bacteria | 1305 |
| 473 | Ga0501048_0351777 | 3300049582 | Bacteria | 1051 |
| 474 | Ga0501070_0966888 | 3300049586 | Bacteria | 662 |
| 475 | Ga0501072_0563667 | 3300049588 | Bacteria | 899 |
| 476 | Ga0501234_072702 | 3300049707 | Unclassified | 596 |
| 477 | Ga0501079_0303252 | 3300049741 | Unclassified | 1250 |
| 478 | Ga0501264_045693 | 3300049761 | Unclassified | 551 |
| 479 | Ga0501045_0293538 | 3300049824 | Bacteria | 1210 |
| 480 | nmdc:mga05p37_299_c2 | 3300050507 | Bacteria | 40446 |
| 481 | nmdc:mga05p37_32056_c1 | 3300050507 | Bacteria | 6426 |
| 482 | nmdc:mga05p37_516684_c1 | 3300050507 | Bacteria | 1367 |
| 483 | nmdc:mga09592_394092_c1 | 3300050508 | Bacteria | 1197 |
| 484 | nmdc:mga09592_736586_c1 | 3300050508 | Bacteria | 837 |
| 485 | nmdc:mga0qj67_686477_c1 | 3300050509 | Bacteria | 815 |
| 486 | nmdc:mga06r32_128516_c1 | 3300050510 | Bacteria | 2504 |
| 487 | nmdc:mga06r32_568168_c1 | 3300050510 | Bacteria | 1107 |
| 488 | nmdc:mga06r32_717384_c1 | 3300050510 | Unclassified | 965 |
| 489 | nmdc:mga08y16_1598894_c1 | 3300050511 | Bacteria | 610 |
| 490 | nmdc:mga08y16_2228_c1 | 3300050511 | Bacteria | 19862 |
| 491 | nmdc:mga0n895_22419_c1 | 3300050512 | Bacteria | 5921 |
| 492 | nmdc:mga0rr50_31610_c1 | 3300050513 | Bacteria | 3762 |
| 493 | nmdc:mga08x19_1029084_c1 | 3300050514 | Bacteria | 585 |
| 494 | nmdc:mga08x19_493360_c1 | 3300050514 | Bacteria | 864 |
| 495 | nmdc:mga0a205_176028_c1 | 3300050515 | Bacteria | 2035 |
| 496 | Ga0495612_0272049 | 3300053078 | Bacteria | 756 |
| 497 | Ga0500643_039824 | 3300053087 | Bacteria | 1386 |
| 498 | Ga0500650_0000152 | 3300053098 | Bacteria | 18057 |
| 499 | Ga0501082_1478201 | 3300060353 | Archaea | 593 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10053713 | Ga0105240_100537133 | 130 |
| 2 | 3300010375 | Ga0105239_10428165 | Ga0105239_104281652 | 130 |
| 3 | 3300025913 | Ga0207695_10096246 | Ga0207695_100962464 | 130 |
| 4 | 3300039450 | Ga0436363_0192214 | Ga0436363_0192214_57_449 | 130 |
| 5 | 3300005290 | Ga0065712_10709284 | Ga0065712_107092841 | 131 |
| 6 | 3300005353 | Ga0070669_100704771 | Ga0070669_1007047711 | 131 |
| 7 | 3300005471 | Ga0070698_100030629 | Ga0070698_1000306294 | 131 |
| 8 | 3300005536 | Ga0070697_100558820 | Ga0070697_1005588202 | 131 |
| 9 | 3300005546 | Ga0070696_100167807 | Ga0070696_1001678071 | 131 |
| 10 | 3300005719 | Ga0068861_100451455 | Ga0068861_1004514552 | 131 |
| 11 | 3300006844 | Ga0075428_100000407 | Ga0075428_10000040731 | 131 |
| 12 | 3300006846 | Ga0075430_100557526 | Ga0075430_1005575262 | 131 |
| 13 | 3300006847 | Ga0075431_100608694 | Ga0075431_1006086942 | 131 |
| 14 | 3300006852 | Ga0075433_10363389 | Ga0075433_103633892 | 131 |
| 15 | 3300006880 | Ga0075429_100440271 | Ga0075429_1004402712 | 131 |
| 16 | 3300009094 | Ga0111539_10012318 | Ga0111539_1001231812 | 131 |
| 17 | 3300009147 | Ga0114129_10000472 | Ga0114129_1000047231 | 131 |
| 18 | 3300014326 | Ga0157380_10411414 | Ga0157380_104114142 | 131 |
| 19 | 3300014326 | Ga0157380_11130282 | Ga0157380_111302822 | 131 |
| 20 | 3300025910 | Ga0207684_10392366 | Ga0207684_103923662 | 131 |
| 21 | 3300025949 | Ga0207667_10043425 | Ga0207667_100434254 | 131 |
| 22 | 3300026118 | Ga0207675_101241456 | Ga0207675_1012414562 | 131 |
| 23 | 3300027907 | Ga0207428_10010335 | Ga0207428_100103359 | 131 |
| 24 | 3300032004 | Ga0307414_12295469 | Ga0307414_122954692 | 131 |
| 25 | 3300044712 | Ga0453684_0466643 | Ga0453684_0466643_943_1389 | 131 |
| 26 | 3300045051 | Ga0451576_0151412 | Ga0451576_0151412_929_1375 | 131 |
| 27 | 3300049761 | Ga0501264_045693 | Ga0501264_045693_57_452 | 131 |
| 28 | 3300050507 | nmdc:mga05p37_299_c2 | nmdc:mga05p37_299_c2_6867_7265 | 131 |
| 29 | 3300050508 | nmdc:mga09592_394092_c1 | nmdc:mga09592_394092_c1_292_687 | 131 |
| 30 | 3300050509 | nmdc:mga0qj67_686477_c1 | nmdc:mga0qj67_686477_c1_185_580 | 131 |
| 31 | 3300050510 | nmdc:mga06r32_568168_c1 | nmdc:mga06r32_568168_c1_226_621 | 131 |
| 32 | 3300050511 | nmdc:mga08y16_2228_c1 | nmdc:mga08y16_2228_c1_1301_1696 | 131 |
| 33 | 3300050515 | nmdc:mga0a205_176028_c1 | nmdc:mga0a205_176028_c1_1334_1729 | 131 |
| 34 | 3300053098 | Ga0500650_0000152 | Ga0500650_0000152_8810_9205 | 131 |
| 35 | 3300000546 | LJNas_1035938 | LJNas_10359382 | 132 |
| 36 | 3300003322 | rootL2_10244063 | rootL2_102440633 | 132 |
| 37 | 3300003323 | rootH1_10286685 | rootH1_102866851 | 132 |
| 38 | 3300005290 | Ga0065712_10672436 | Ga0065712_106724361 | 132 |
| 39 | 3300005329 | Ga0070683_100010905 | Ga0070683_1000109053 | 132 |
| 40 | 3300005329 | Ga0070683_100062131 | Ga0070683_1000621312 | 132 |
| 41 | 3300005330 | Ga0070690_100061631 | Ga0070690_1000616312 | 132 |
| 42 | 3300005331 | Ga0070670_101521414 | Ga0070670_1015214141 | 132 |
| 43 | 3300005333 | Ga0070677_10776812 | Ga0070677_107768121 | 132 |
| 44 | 3300005334 | Ga0068869_100057474 | Ga0068869_1000574743 | 132 |
| 45 | 3300005335 | Ga0070666_10828958 | Ga0070666_108289582 | 132 |
| 46 | 3300005336 | Ga0070680_100011744 | Ga0070680_1000117444 | 132 |
| 47 | 3300005336 | Ga0070680_101668830 | Ga0070680_1016688301 | 132 |
| 48 | 3300005338 | Ga0068868_100192436 | Ga0068868_1001924362 | 132 |
| 49 | 3300005339 | Ga0070660_100085113 | Ga0070660_1000851131 | 132 |
| 50 | 3300005341 | Ga0070691_10431667 | Ga0070691_104316671 | 132 |
| 51 | 3300005343 | Ga0070687_100441704 | Ga0070687_1004417041 | 132 |
| 52 | 3300005344 | Ga0070661_100042486 | Ga0070661_1000424863 | 132 |
| 53 | 3300005344 | Ga0070661_100573881 | Ga0070661_1005738812 | 132 |
| 54 | 3300005344 | Ga0070661_100846808 | Ga0070661_1008468081 | 132 |
| 55 | 3300005353 | Ga0070669_100168297 | Ga0070669_1001682971 | 132 |
| 56 | 3300005354 | Ga0070675_100900201 | Ga0070675_1009002012 | 132 |
| 57 | 3300005355 | Ga0070671_100105084 | Ga0070671_1001050842 | 132 |
| 58 | 3300005355 | Ga0070671_101521302 | Ga0070671_1015213021 | 132 |
| 59 | 3300005364 | Ga0070673_100337224 | Ga0070673_1003372241 | 132 |
| 60 | 3300005364 | Ga0070673_101417427 | Ga0070673_1014174271 | 132 |
| 61 | 3300005366 | Ga0070659_101919364 | Ga0070659_1019193641 | 132 |
| 62 | 3300005434 | Ga0070709_10104776 | Ga0070709_101047762 | 132 |
| 63 | 3300005434 | Ga0070709_10192991 | Ga0070709_101929912 | 132 |
| 64 | 3300005434 | Ga0070709_10196623 | Ga0070709_101966233 | 132 |
| 65 | 3300005435 | Ga0070714_100040115 | Ga0070714_1000401152 | 132 |
| 66 | 3300005435 | Ga0070714_100048004 | Ga0070714_1000480042 | 132 |
| 67 | 3300005435 | Ga0070714_100076987 | Ga0070714_1000769872 | 132 |
| 68 | 3300005435 | Ga0070714_100192610 | Ga0070714_1001926102 | 132 |
| 69 | 3300005435 | Ga0070714_100205874 | Ga0070714_1002058742 | 132 |
| 70 | 3300005436 | Ga0070713_100002376 | Ga0070713_1000023768 | 132 |
| 71 | 3300005436 | Ga0070713_100045022 | Ga0070713_1000450222 | 132 |
| 72 | 3300005436 | Ga0070713_100058527 | Ga0070713_1000585273 | 132 |
| 73 | 3300005436 | Ga0070713_100232336 | Ga0070713_1002323361 | 132 |
| 74 | 3300005436 | Ga0070713_100403675 | Ga0070713_1004036752 | 132 |
| 75 | 3300005439 | Ga0070711_100025331 | Ga0070711_1000253313 | 132 |
| 76 | 3300005439 | Ga0070711_100122680 | Ga0070711_1001226802 | 132 |
| 77 | 3300005439 | Ga0070711_100523138 | Ga0070711_1005231382 | 132 |
| 78 | 3300005439 | Ga0070711_101440437 | Ga0070711_1014404371 | 132 |
| 79 | 3300005440 | Ga0070705_100155178 | Ga0070705_1001551783 | 132 |
| 80 | 3300005440 | Ga0070705_100577133 | Ga0070705_1005771332 | 132 |
| 81 | 3300005444 | Ga0070694_100017333 | Ga0070694_1000173336 | 132 |
| 82 | 3300005444 | Ga0070694_101146934 | Ga0070694_1011469341 | 132 |
| 83 | 3300005445 | Ga0070708_100031279 | Ga0070708_1000312791 | 132 |
| 84 | 3300005445 | Ga0070708_100070584 | Ga0070708_1000705843 | 132 |
| 85 | 3300005445 | Ga0070708_101224516 | Ga0070708_1012245161 | 132 |
| 86 | 3300005456 | Ga0070678_100913915 | Ga0070678_1009139151 | 132 |
| 87 | 3300005458 | Ga0070681_10000858 | Ga0070681_1000085814 | 132 |
| 88 | 3300005458 | Ga0070681_10017216 | Ga0070681_100172164 | 132 |
| 89 | 3300005458 | Ga0070681_10094586 | Ga0070681_100945864 | 132 |
| 90 | 3300005459 | Ga0068867_100010529 | Ga0068867_1000105294 | 132 |
| 91 | 3300005459 | Ga0068867_100057107 | Ga0068867_1000571073 | 132 |
| 92 | 3300005467 | Ga0070706_100001682 | Ga0070706_10000168213 | 132 |
| 93 | 3300005467 | Ga0070706_100515412 | Ga0070706_1005154121 | 132 |
| 94 | 3300005468 | Ga0070707_100000591 | Ga0070707_10000059113 | 132 |
| 95 | 3300005468 | Ga0070707_100002000 | Ga0070707_10000200019 | 132 |
| 96 | 3300005468 | Ga0070707_100854108 | Ga0070707_1008541081 | 132 |
| 97 | 3300005471 | Ga0070698_100000375 | Ga0070698_10000037531 | 132 |
| 98 | 3300005518 | Ga0070699_100002758 | Ga0070699_10000275815 | 132 |
| 99 | 3300005518 | Ga0070699_100048157 | Ga0070699_1000481574 | 132 |
| 100 | 3300005518 | Ga0070699_100488852 | Ga0070699_1004888521 | 132 |
| 101 | 3300005530 | Ga0070679_100656507 | Ga0070679_1006565072 | 132 |
| 102 | 3300005535 | Ga0070684_100128265 | Ga0070684_1001282652 | 132 |
| 103 | 3300005535 | Ga0070684_100814590 | Ga0070684_1008145902 | 132 |
| 104 | 3300005536 | Ga0070697_100004133 | Ga0070697_10000413311 | 132 |
| 105 | 3300005536 | Ga0070697_100004988 | Ga0070697_10000498811 | 132 |
| 106 | 3300005536 | Ga0070697_100044629 | Ga0070697_1000446294 | 132 |
| 107 | 3300005536 | Ga0070697_100795465 | Ga0070697_1007954651 | 132 |
| 108 | 3300005539 | Ga0068853_100037072 | Ga0068853_1000370722 | 132 |
| 109 | 3300005539 | Ga0068853_100415506 | Ga0068853_1004155062 | 132 |
| 110 | 3300005543 | Ga0070672_100719220 | Ga0070672_1007192202 | 132 |
| 111 | 3300005544 | Ga0070686_100367063 | Ga0070686_1003670632 | 132 |
| 112 | 3300005545 | Ga0070695_100403472 | Ga0070695_1004034721 | 132 |
| 113 | 3300005545 | Ga0070695_100413080 | Ga0070695_1004130801 | 132 |
| 114 | 3300005546 | Ga0070696_100305696 | Ga0070696_1003056962 | 132 |
| 115 | 3300005546 | Ga0070696_101215816 | Ga0070696_1012158161 | 132 |
| 116 | 3300005546 | Ga0070696_101995072 | Ga0070696_1019950722 | 132 |
| 117 | 3300005547 | Ga0070693_100005329 | Ga0070693_1000053296 | 132 |
| 118 | 3300005547 | Ga0070693_100117236 | Ga0070693_1001172362 | 132 |
| 119 | 3300005547 | Ga0070693_101220038 | Ga0070693_1012200381 | 132 |
| 120 | 3300005548 | Ga0070665_100231186 | Ga0070665_1002311862 | 132 |
| 121 | 3300005549 | Ga0070704_100008254 | Ga0070704_1000082543 | 132 |
| 122 | 3300005549 | Ga0070704_100055269 | Ga0070704_1000552692 | 132 |
| 123 | 3300005563 | Ga0068855_100038914 | Ga0068855_1000389143 | 132 |
| 124 | 3300005563 | Ga0068855_100044583 | Ga0068855_1000445832 | 132 |
| 125 | 3300005563 | Ga0068855_100113160 | Ga0068855_1001131602 | 132 |
| 126 | 3300005563 | Ga0068855_100188121 | Ga0068855_1001881212 | 132 |
| 127 | 3300005563 | Ga0068855_100208892 | Ga0068855_1002088923 | 132 |
| 128 | 3300005563 | Ga0068855_101287772 | Ga0068855_1012877721 | 132 |
| 129 | 3300005564 | Ga0070664_100000655 | Ga0070664_10000065529 | 132 |
| 130 | 3300005564 | Ga0070664_100161237 | Ga0070664_1001612372 | 132 |
| 131 | 3300005564 | Ga0070664_100295899 | Ga0070664_1002958993 | 132 |
| 132 | 3300005564 | Ga0070664_100759865 | Ga0070664_1007598652 | 132 |
| 133 | 3300005577 | Ga0068857_100001890 | Ga0068857_10000189015 | 132 |
| 134 | 3300005577 | Ga0068857_100003336 | Ga0068857_10000333613 | 132 |
| 135 | 3300005577 | Ga0068857_101230842 | Ga0068857_1012308421 | 132 |
| 136 | 3300005578 | Ga0068854_100038150 | Ga0068854_1000381502 | 132 |
| 137 | 3300005578 | Ga0068854_100535342 | Ga0068854_1005353422 | 132 |
| 138 | 3300005614 | Ga0068856_100001186 | Ga0068856_10000118623 | 132 |
| 139 | 3300005614 | Ga0068856_100013056 | Ga0068856_1000130568 | 132 |
| 140 | 3300005614 | Ga0068856_100032697 | Ga0068856_1000326972 | 132 |
| 141 | 3300005614 | Ga0068856_100038258 | Ga0068856_1000382585 | 132 |
| 142 | 3300005614 | Ga0068856_100070817 | Ga0068856_1000708172 | 132 |
| 143 | 3300005615 | Ga0070702_100228540 | Ga0070702_1002285401 | 132 |
| 144 | 3300005615 | Ga0070702_100848396 | Ga0070702_1008483961 | 132 |
| 145 | 3300005616 | Ga0068852_100009585 | Ga0068852_1000095854 | 132 |
| 146 | 3300005616 | Ga0068852_100203208 | Ga0068852_1002032082 | 132 |
| 147 | 3300005617 | Ga0068859_100033660 | Ga0068859_1000336604 | 132 |
| 148 | 3300005617 | Ga0068859_100041212 | Ga0068859_1000412124 | 132 |
| 149 | 3300005618 | Ga0068864_100000347 | Ga0068864_1000003475 | 132 |
| 150 | 3300005618 | Ga0068864_100004216 | Ga0068864_10000421611 | 132 |
| 151 | 3300005618 | Ga0068864_101226741 | Ga0068864_1012267412 | 132 |
| 152 | 3300005718 | Ga0068866_10244525 | Ga0068866_102445252 | 132 |
| 153 | 3300005719 | Ga0068861_100730398 | Ga0068861_1007303981 | 132 |
| 154 | 3300005834 | Ga0068851_10128176 | Ga0068851_101281762 | 132 |
| 155 | 3300005841 | Ga0068863_100184209 | Ga0068863_1001842092 | 132 |
| 156 | 3300005841 | Ga0068863_100353500 | Ga0068863_1003535002 | 132 |
| 157 | 3300005841 | Ga0068863_100414945 | Ga0068863_1004149452 | 132 |
| 158 | 3300005842 | Ga0068858_100003905 | Ga0068858_1000039059 | 132 |
| 159 | 3300005842 | Ga0068858_100006670 | Ga0068858_1000066708 | 132 |
| 160 | 3300005842 | Ga0068858_100155750 | Ga0068858_1001557501 | 132 |
| 161 | 3300005843 | Ga0068860_100021893 | Ga0068860_1000218936 | 132 |
| 162 | 3300005843 | Ga0068860_100119519 | Ga0068860_1001195193 | 132 |
| 163 | 3300005843 | Ga0068860_100318740 | Ga0068860_1003187401 | 132 |
| 164 | 3300005843 | Ga0068860_100539901 | Ga0068860_1005399012 | 132 |
| 165 | 3300005843 | Ga0068860_100575194 | Ga0068860_1005751942 | 132 |
| 166 | 3300005844 | Ga0068862_100026666 | Ga0068862_1000266663 | 132 |
| 167 | 3300005844 | Ga0068862_100207702 | Ga0068862_1002077022 | 132 |
| 168 | 3300005844 | Ga0068862_100225783 | Ga0068862_1002257832 | 132 |
| 169 | 3300005937 | Ga0081455_10019817 | Ga0081455_100198174 | 132 |
| 170 | 3300005937 | Ga0081455_10514430 | Ga0081455_105144302 | 132 |
| 171 | 3300005983 | Ga0081540_1045540 | Ga0081540_10455401 | 132 |
| 172 | 3300006028 | Ga0070717_10038338 | Ga0070717_100383383 | 132 |
| 173 | 3300006028 | Ga0070717_10230632 | Ga0070717_102306322 | 132 |
| 174 | 3300006163 | Ga0070715_10627900 | Ga0070715_106279001 | 132 |
| 175 | 3300006173 | Ga0070716_100137851 | Ga0070716_1001378512 | 132 |
| 176 | 3300006173 | Ga0070716_100171015 | Ga0070716_1001710152 | 132 |
| 177 | 3300006175 | Ga0070712_100010608 | Ga0070712_1000106082 | 132 |
| 178 | 3300006175 | Ga0070712_100232026 | Ga0070712_1002320261 | 132 |
| 179 | 3300006175 | Ga0070712_100655557 | Ga0070712_1006555572 | 132 |
| 180 | 3300006237 | Ga0097621_100000133 | Ga0097621_10000013316 | 132 |
| 181 | 3300006237 | Ga0097621_100017370 | Ga0097621_1000173702 | 132 |
| 182 | 3300006237 | Ga0097621_100020479 | Ga0097621_1000204793 | 132 |
| 183 | 3300006237 | Ga0097621_100051862 | Ga0097621_1000518624 | 132 |
| 184 | 3300006358 | Ga0068871_100000448 | Ga0068871_1000004486 | 132 |
| 185 | 3300006358 | Ga0068871_100003253 | Ga0068871_10000325310 | 132 |
| 186 | 3300006358 | Ga0068871_100066191 | Ga0068871_1000661914 | 132 |
| 187 | 3300006358 | Ga0068871_100079138 | Ga0068871_1000791383 | 132 |
| 188 | 3300006358 | Ga0068871_100113343 | Ga0068871_1001133432 | 132 |
| 189 | 3300006358 | Ga0068871_100114893 | Ga0068871_1001148934 | 132 |
| 190 | 3300006358 | Ga0068871_100678711 | Ga0068871_1006787112 | 132 |
| 191 | 3300006844 | Ga0075428_100316630 | Ga0075428_1003166302 | 132 |
| 192 | 3300006844 | Ga0075428_100438915 | Ga0075428_1004389151 | 132 |
| 193 | 3300006847 | Ga0075431_102144044 | Ga0075431_1021440442 | 132 |
| 194 | 3300006871 | Ga0075434_100012876 | Ga0075434_10001287611 | 132 |
| 195 | 3300006871 | Ga0075434_100901338 | Ga0075434_1009013382 | 132 |
| 196 | 3300006881 | Ga0068865_100132421 | Ga0068865_1001324213 | 132 |
| 197 | 3300006881 | Ga0068865_100293756 | Ga0068865_1002937562 | 132 |
| 198 | 3300006914 | Ga0075436_100027872 | Ga0075436_1000278725 | 132 |
| 199 | 3300006914 | Ga0075436_101272081 | Ga0075436_1012720811 | 132 |
| 200 | 3300006931 | Ga0097620_100033662 | Ga0097620_1000336623 | 132 |
| 201 | 3300006931 | Ga0097620_100041212 | Ga0097620_1000412121 | 132 |
| 202 | 3300007076 | Ga0075435_100076717 | Ga0075435_1000767172 | 132 |
| 203 | 3300009093 | Ga0105240_10012666 | Ga0105240_1001266612 | 132 |
| 204 | 3300009093 | Ga0105240_10154863 | Ga0105240_101548632 | 132 |
| 205 | 3300009093 | Ga0105240_10163995 | Ga0105240_101639952 | 132 |
| 206 | 3300009093 | Ga0105240_10242833 | Ga0105240_102428332 | 132 |
| 207 | 3300009094 | Ga0111539_12037365 | Ga0111539_120373651 | 132 |
| 208 | 3300009098 | Ga0105245_10237128 | Ga0105245_102371281 | 132 |
| 209 | 3300009098 | Ga0105245_11248923 | Ga0105245_112489231 | 132 |
| 210 | 3300009101 | Ga0105247_10018885 | Ga0105247_100188852 | 132 |
| 211 | 3300009101 | Ga0105247_10728515 | Ga0105247_107285151 | 132 |
| 212 | 3300009147 | Ga0114129_10166153 | Ga0114129_101661532 | 132 |
| 213 | 3300009147 | Ga0114129_10200534 | Ga0114129_102005341 | 132 |
| 214 | 3300009147 | Ga0114129_10208891 | Ga0114129_102088913 | 132 |
| 215 | 3300009147 | Ga0114129_10835578 | Ga0114129_108355782 | 132 |
| 216 | 3300009147 | Ga0114129_11371604 | Ga0114129_113716042 | 132 |
| 217 | 3300009148 | Ga0105243_10114819 | Ga0105243_101148192 | 132 |
| 218 | 3300009174 | Ga0105241_10034189 | Ga0105241_100341895 | 132 |
| 219 | 3300009174 | Ga0105241_10041323 | Ga0105241_100413232 | 132 |
| 220 | 3300009174 | Ga0105241_10160210 | Ga0105241_101602103 | 132 |
| 221 | 3300009174 | Ga0105241_10176486 | Ga0105241_101764862 | 132 |
| 222 | 3300009174 | Ga0105241_10757446 | Ga0105241_107574462 | 132 |
| 223 | 3300009176 | Ga0105242_10575640 | Ga0105242_105756402 | 132 |
| 224 | 3300009176 | Ga0105242_11493029 | Ga0105242_114930291 | 132 |
| 225 | 3300009177 | Ga0105248_10026986 | Ga0105248_100269862 | 132 |
| 226 | 3300009177 | Ga0105248_10070839 | Ga0105248_100708391 | 132 |
| 227 | 3300009545 | Ga0105237_10049680 | Ga0105237_100496802 | 132 |
| 228 | 3300009545 | Ga0105237_10062101 | Ga0105237_100621012 | 132 |
| 229 | 3300009545 | Ga0105237_10300718 | Ga0105237_103007182 | 132 |
| 230 | 3300009545 | Ga0105237_10314293 | Ga0105237_103142932 | 132 |
| 231 | 3300009545 | Ga0105237_10571910 | Ga0105237_105719102 | 132 |
| 232 | 3300009545 | Ga0105237_10594889 | Ga0105237_105948892 | 132 |
| 233 | 3300009545 | Ga0105237_11154934 | Ga0105237_111549341 | 132 |
| 234 | 3300009545 | Ga0105237_11187055 | Ga0105237_111870552 | 132 |
| 235 | 3300009545 | Ga0105237_12591154 | Ga0105237_125911541 | 132 |
| 236 | 3300009551 | Ga0105238_10000368 | Ga0105238_1000036817 | 132 |
| 237 | 3300009551 | Ga0105238_10216908 | Ga0105238_102169082 | 132 |
| 238 | 3300009553 | Ga0105249_10140411 | Ga0105249_101404113 | 132 |
| 239 | 3300010375 | Ga0105239_10018608 | Ga0105239_100186085 | 132 |
| 240 | 3300010375 | Ga0105239_10616543 | Ga0105239_106165432 | 132 |
| 241 | 3300011119 | Ga0105246_10063510 | Ga0105246_100635102 | 132 |
| 242 | 3300013100 | Ga0157373_10021467 | Ga0157373_100214675 | 132 |
| 243 | 3300013100 | Ga0157373_10140135 | Ga0157373_101401352 | 132 |
| 244 | 3300013100 | Ga0157373_10162511 | Ga0157373_101625112 | 132 |
| 245 | 3300013100 | Ga0157373_10174529 | Ga0157373_101745293 | 132 |
| 246 | 3300013100 | Ga0157373_10426942 | Ga0157373_104269422 | 132 |
| 247 | 3300013102 | Ga0157371_10475769 | Ga0157371_104757692 | 132 |
| 248 | 3300013102 | Ga0157371_10527787 | Ga0157371_105277872 | 132 |
| 249 | 3300013104 | Ga0157370_10071517 | Ga0157370_100715171 | 132 |
| 250 | 3300013104 | Ga0157370_10314773 | Ga0157370_103147731 | 132 |
| 251 | 3300013105 | Ga0157369_10006808 | Ga0157369_1000680810 | 132 |
| 252 | 3300013105 | Ga0157369_10026425 | Ga0157369_100264252 | 132 |
| 253 | 3300013105 | Ga0157369_10035928 | Ga0157369_100359286 | 132 |
| 254 | 3300013105 | Ga0157369_10083788 | Ga0157369_100837882 | 132 |
| 255 | 3300013105 | Ga0157369_10706963 | Ga0157369_107069631 | 132 |
| 256 | 3300013105 | Ga0157369_11685427 | Ga0157369_116854271 | 132 |
| 257 | 3300013296 | Ga0157374_10000254 | Ga0157374_1000025418 | 132 |
| 258 | 3300013296 | Ga0157374_10000302 | Ga0157374_1000030236 | 132 |
| 259 | 3300013296 | Ga0157374_10001933 | Ga0157374_1000193312 | 132 |
| 260 | 3300013296 | Ga0157374_10022733 | Ga0157374_100227332 | 132 |
| 261 | 3300013296 | Ga0157374_10151785 | Ga0157374_101517851 | 132 |
| 262 | 3300013297 | Ga0157378_10000055 | Ga0157378_1000005571 | 132 |
| 263 | 3300013297 | Ga0157378_10000554 | Ga0157378_100005542 | 132 |
| 264 | 3300013297 | Ga0157378_10050680 | Ga0157378_100506802 | 132 |
| 265 | 3300013297 | Ga0157378_10197896 | Ga0157378_101978962 | 132 |
| 266 | 3300013297 | Ga0157378_10603933 | Ga0157378_106039332 | 132 |
| 267 | 3300013306 | Ga0163162_10312975 | Ga0163162_103129752 | 132 |
| 268 | 3300013307 | Ga0157372_10000661 | Ga0157372_1000066111 | 132 |
| 269 | 3300013307 | Ga0157372_10001984 | Ga0157372_100019842 | 132 |
| 270 | 3300013307 | Ga0157372_10002739 | Ga0157372_100027391 | 132 |
| 271 | 3300013307 | Ga0157372_10030721 | Ga0157372_100307214 | 132 |
| 272 | 3300013307 | Ga0157372_10037604 | Ga0157372_100376046 | 132 |
| 273 | 3300013307 | Ga0157372_10070218 | Ga0157372_100702182 | 132 |
| 274 | 3300013307 | Ga0157372_10075292 | Ga0157372_100752924 | 132 |
| 275 | 3300013307 | Ga0157372_10333653 | Ga0157372_103336532 | 132 |
| 276 | 3300013307 | Ga0157372_11745418 | Ga0157372_117454181 | 132 |
| 277 | 3300013307 | Ga0157372_11966979 | Ga0157372_119669791 | 132 |
| 278 | 3300013308 | Ga0157375_10236237 | Ga0157375_102362372 | 132 |
| 279 | 3300014325 | Ga0163163_10678328 | Ga0163163_106783281 | 132 |
| 280 | 3300014325 | Ga0163163_10876256 | Ga0163163_108762562 | 132 |
| 281 | 3300014326 | Ga0157380_10101877 | Ga0157380_101018773 | 132 |
| 282 | 3300014745 | Ga0157377_10123562 | Ga0157377_101235622 | 132 |
| 283 | 3300014745 | Ga0157377_10370357 | Ga0157377_103703572 | 132 |
| 284 | 3300014968 | Ga0157379_10037210 | Ga0157379_100372102 | 132 |
| 285 | 3300014969 | Ga0157376_10180109 | Ga0157376_101801091 | 132 |
| 286 | 3300014969 | Ga0157376_10626621 | Ga0157376_106266212 | 132 |
| 287 | 3300021358 | Ga0213873_10007662 | Ga0213873_100076622 | 132 |
| 288 | 3300021388 | Ga0213875_10118931 | Ga0213875_101189312 | 132 |
| 289 | 3300025315 | Ga0207697_10424993 | Ga0207697_104249932 | 132 |
| 290 | 3300025321 | Ga0207656_10138394 | Ga0207656_101383942 | 132 |
| 291 | 3300025899 | Ga0207642_10444759 | Ga0207642_104447591 | 132 |
| 292 | 3300025901 | Ga0207688_10402040 | Ga0207688_104020402 | 132 |
| 293 | 3300025904 | Ga0207647_10000903 | Ga0207647_1000090313 | 132 |
| 294 | 3300025904 | Ga0207647_10078719 | Ga0207647_100787193 | 132 |
| 295 | 3300025905 | Ga0207685_10148843 | Ga0207685_101488432 | 132 |
| 296 | 3300025906 | Ga0207699_10089305 | Ga0207699_100893052 | 132 |
| 297 | 3300025906 | Ga0207699_10139235 | Ga0207699_101392353 | 132 |
| 298 | 3300025907 | Ga0207645_10434367 | Ga0207645_104343672 | 132 |
| 299 | 3300025910 | Ga0207684_10014797 | Ga0207684_100147972 | 132 |
| 300 | 3300025910 | Ga0207684_10444213 | Ga0207684_104442131 | 132 |
| 301 | 3300025911 | Ga0207654_10008545 | Ga0207654_100085455 | 132 |
| 302 | 3300025911 | Ga0207654_10042499 | Ga0207654_100424992 | 132 |
| 303 | 3300025911 | Ga0207654_10833837 | Ga0207654_108338371 | 132 |
| 304 | 3300025912 | Ga0207707_10010028 | Ga0207707_100100283 | 132 |
| 305 | 3300025912 | Ga0207707_10016930 | Ga0207707_100169304 | 132 |
| 306 | 3300025912 | Ga0207707_10566349 | Ga0207707_105663492 | 132 |
| 307 | 3300025913 | Ga0207695_10023048 | Ga0207695_100230482 | 132 |
| 308 | 3300025913 | Ga0207695_10024582 | Ga0207695_100245825 | 132 |
| 309 | 3300025913 | Ga0207695_10219021 | Ga0207695_102190211 | 132 |
| 310 | 3300025913 | Ga0207695_10545590 | Ga0207695_105455902 | 132 |
| 311 | 3300025913 | Ga0207695_10875569 | Ga0207695_108755691 | 132 |
| 312 | 3300025914 | Ga0207671_10031806 | Ga0207671_100318062 | 132 |
| 313 | 3300025914 | Ga0207671_10051514 | Ga0207671_100515141 | 132 |
| 314 | 3300025914 | Ga0207671_10354978 | Ga0207671_103549782 | 132 |
| 315 | 3300025914 | Ga0207671_10456207 | Ga0207671_104562071 | 132 |
| 316 | 3300025914 | Ga0207671_10880263 | Ga0207671_108802632 | 132 |
| 317 | 3300025914 | Ga0207671_11255758 | Ga0207671_112557581 | 132 |
| 318 | 3300025914 | Ga0207671_11510401 | Ga0207671_115104012 | 132 |
| 319 | 3300025915 | Ga0207693_10147969 | Ga0207693_101479692 | 132 |
| 320 | 3300025915 | Ga0207693_10494367 | Ga0207693_104943672 | 132 |
| 321 | 3300025915 | Ga0207693_10778010 | Ga0207693_107780102 | 132 |
| 322 | 3300025915 | Ga0207693_10857051 | Ga0207693_108570512 | 132 |
| 323 | 3300025916 | Ga0207663_10463199 | Ga0207663_104631991 | 132 |
| 324 | 3300025916 | Ga0207663_10838494 | Ga0207663_108384942 | 132 |
| 325 | 3300025916 | Ga0207663_11021039 | Ga0207663_110210391 | 132 |
| 326 | 3300025916 | Ga0207663_11403540 | Ga0207663_114035401 | 132 |
| 327 | 3300025917 | Ga0207660_10037639 | Ga0207660_100376393 | 132 |
| 328 | 3300025919 | Ga0207657_10194614 | Ga0207657_101946142 | 132 |
| 329 | 3300025920 | Ga0207649_10085349 | Ga0207649_100853491 | 132 |
| 330 | 3300025920 | Ga0207649_11622856 | Ga0207649_116228561 | 132 |
| 331 | 3300025921 | Ga0207652_10799491 | Ga0207652_107994911 | 132 |
| 332 | 3300025921 | Ga0207652_11847023 | Ga0207652_118470231 | 132 |
| 333 | 3300025922 | Ga0207646_10000742 | Ga0207646_1000074213 | 132 |
| 334 | 3300025922 | Ga0207646_10001179 | Ga0207646_1000117911 | 132 |
| 335 | 3300025923 | Ga0207681_10152384 | Ga0207681_101523842 | 132 |
| 336 | 3300025924 | Ga0207694_10001767 | Ga0207694_100017673 | 132 |
| 337 | 3300025924 | Ga0207694_10071998 | Ga0207694_100719982 | 132 |
| 338 | 3300025924 | Ga0207694_10302177 | Ga0207694_103021772 | 132 |
| 339 | 3300025925 | Ga0207650_11128038 | Ga0207650_111280381 | 132 |
| 340 | 3300025927 | Ga0207687_11246365 | Ga0207687_112463651 | 132 |
| 341 | 3300025928 | Ga0207700_10084080 | Ga0207700_100840802 | 132 |
| 342 | 3300025928 | Ga0207700_10124979 | Ga0207700_101249793 | 132 |
| 343 | 3300025928 | Ga0207700_10184344 | Ga0207700_101843442 | 132 |
| 344 | 3300025928 | Ga0207700_10688629 | Ga0207700_106886291 | 132 |
| 345 | 3300025928 | Ga0207700_11823822 | Ga0207700_118238221 | 132 |
| 346 | 3300025929 | Ga0207664_10025845 | Ga0207664_100258453 | 132 |
| 347 | 3300025929 | Ga0207664_10054863 | Ga0207664_100548632 | 132 |
| 348 | 3300025929 | Ga0207664_10122714 | Ga0207664_101227142 | 132 |
| 349 | 3300025929 | Ga0207664_10332556 | Ga0207664_103325562 | 132 |
| 350 | 3300025929 | Ga0207664_11111057 | Ga0207664_111110571 | 132 |
| 351 | 3300025931 | Ga0207644_10125475 | Ga0207644_101254751 | 132 |
| 352 | 3300025933 | Ga0207706_10831108 | Ga0207706_108311082 | 132 |
| 353 | 3300025934 | Ga0207686_10750670 | Ga0207686_107506702 | 132 |
| 354 | 3300025938 | Ga0207704_10004764 | Ga0207704_100047646 | 132 |
| 355 | 3300025938 | Ga0207704_10159875 | Ga0207704_101598751 | 132 |
| 356 | 3300025939 | Ga0207665_10156576 | Ga0207665_101565761 | 132 |
| 357 | 3300025939 | Ga0207665_10307934 | Ga0207665_103079341 | 132 |
| 358 | 3300025939 | Ga0207665_10913377 | Ga0207665_109133771 | 132 |
| 359 | 3300025940 | Ga0207691_10282607 | Ga0207691_102826072 | 132 |
| 360 | 3300025940 | Ga0207691_10691597 | Ga0207691_106915972 | 132 |
| 361 | 3300025941 | Ga0207711_10062799 | Ga0207711_100627993 | 132 |
| 362 | 3300025941 | Ga0207711_11330862 | Ga0207711_113308621 | 132 |
| 363 | 3300025942 | Ga0207689_10000788 | Ga0207689_1000078810 | 132 |
| 364 | 3300025942 | Ga0207689_10338048 | Ga0207689_103380481 | 132 |
| 365 | 3300025944 | Ga0207661_10106361 | Ga0207661_101063612 | 132 |
| 366 | 3300025944 | Ga0207661_11031510 | Ga0207661_110315101 | 132 |
| 367 | 3300025944 | Ga0207661_11038252 | Ga0207661_110382522 | 132 |
| 368 | 3300025945 | Ga0207679_10062560 | Ga0207679_100625603 | 132 |
| 369 | 3300025945 | Ga0207679_10115941 | Ga0207679_101159413 | 132 |
| 370 | 3300025949 | Ga0207667_10010578 | Ga0207667_100105785 | 132 |
| 371 | 3300025949 | Ga0207667_10035751 | Ga0207667_100357515 | 132 |
| 372 | 3300025949 | Ga0207667_10127389 | Ga0207667_101273892 | 132 |
| 373 | 3300025949 | Ga0207667_10205283 | Ga0207667_102052833 | 132 |
| 374 | 3300025949 | Ga0207667_10339051 | Ga0207667_103390511 | 132 |
| 375 | 3300025949 | Ga0207667_11135505 | Ga0207667_111355051 | 132 |
| 376 | 3300025960 | Ga0207651_10319853 | Ga0207651_103198532 | 132 |
| 377 | 3300025960 | Ga0207651_10496908 | Ga0207651_104969082 | 132 |
| 378 | 3300025961 | Ga0207712_11524496 | Ga0207712_115244961 | 132 |
| 379 | 3300025972 | Ga0207668_10892149 | Ga0207668_108921492 | 132 |
| 380 | 3300025981 | Ga0207640_10037949 | Ga0207640_100379493 | 132 |
| 381 | 3300025981 | Ga0207640_10457662 | Ga0207640_104576622 | 132 |
| 382 | 3300025981 | Ga0207640_10492854 | Ga0207640_104928541 | 132 |
| 383 | 3300025981 | Ga0207640_10555446 | Ga0207640_105554462 | 132 |
| 384 | 3300025986 | Ga0207658_10209729 | Ga0207658_102097292 | 132 |
| 385 | 3300026023 | Ga0207677_10085004 | Ga0207677_100850041 | 132 |
| 386 | 3300026023 | Ga0207677_11318499 | Ga0207677_113184991 | 132 |
| 387 | 3300026035 | Ga0207703_10017439 | Ga0207703_100174392 | 132 |
| 388 | 3300026035 | Ga0207703_10025019 | Ga0207703_100250194 | 132 |
| 389 | 3300026035 | Ga0207703_10149566 | Ga0207703_101495663 | 132 |
| 390 | 3300026041 | Ga0207639_10029075 | Ga0207639_100290753 | 132 |
| 391 | 3300026041 | Ga0207639_10281803 | Ga0207639_102818032 | 132 |
| 392 | 3300026041 | Ga0207639_10389554 | Ga0207639_103895541 | 132 |
| 393 | 3300026075 | Ga0207708_11214608 | Ga0207708_112146081 | 132 |
| 394 | 3300026078 | Ga0207702_10001337 | Ga0207702_1000133724 | 132 |
| 395 | 3300026078 | Ga0207702_10002787 | Ga0207702_100027874 | 132 |
| 396 | 3300026078 | Ga0207702_10013220 | Ga0207702_100132205 | 132 |
| 397 | 3300026078 | Ga0207702_10429122 | Ga0207702_104291222 | 132 |
| 398 | 3300026078 | Ga0207702_10439410 | Ga0207702_104394102 | 132 |
| 399 | 3300026088 | Ga0207641_10337580 | Ga0207641_103375802 | 132 |
| 400 | 3300026088 | Ga0207641_10952717 | Ga0207641_109527172 | 132 |
| 401 | 3300026089 | Ga0207648_10002663 | Ga0207648_1000266314 | 132 |
| 402 | 3300026089 | Ga0207648_10050680 | Ga0207648_100506804 | 132 |
| 403 | 3300026095 | Ga0207676_10007557 | Ga0207676_100075577 | 132 |
| 404 | 3300026095 | Ga0207676_10041511 | Ga0207676_100415113 | 132 |
| 405 | 3300026116 | Ga0207674_10000514 | Ga0207674_1000051438 | 132 |
| 406 | 3300026116 | Ga0207674_10002979 | Ga0207674_1000297918 | 132 |
| 407 | 3300026116 | Ga0207674_11584276 | Ga0207674_115842761 | 132 |
| 408 | 3300026118 | Ga0207675_100048527 | Ga0207675_1000485274 | 132 |
| 409 | 3300026121 | Ga0207683_10344806 | Ga0207683_103448062 | 132 |
| 410 | 3300026121 | Ga0207683_11018176 | Ga0207683_110181761 | 132 |
| 411 | 3300026142 | Ga0207698_10100327 | Ga0207698_101003271 | 132 |
| 412 | 3300026142 | Ga0207698_10778502 | Ga0207698_107785022 | 132 |
| 413 | 3300026142 | Ga0207698_11098042 | Ga0207698_110980421 | 132 |
| 414 | 3300028016 | Ga0265354_1004140 | Ga0265354_10041402 | 132 |
| 415 | 3300028036 | Ga0265355_1002924 | Ga0265355_10029241 | 132 |
| 416 | 3300028379 | Ga0268266_10362459 | Ga0268266_103624592 | 132 |
| 417 | 3300028380 | Ga0268265_10100064 | Ga0268265_101000642 | 132 |
| 418 | 3300028381 | Ga0268264_10053356 | Ga0268264_100533562 | 132 |
| 419 | 3300028381 | Ga0268264_10075735 | Ga0268264_100757352 | 132 |
| 420 | 3300028381 | Ga0268264_10147562 | Ga0268264_101475623 | 132 |
| 421 | 3300030878 | Ga0265770_1006881 | Ga0265770_10068811 | 132 |
| 422 | 3300030879 | Ga0265765_1060876 | Ga0265765_10608761 | 132 |
| 423 | 3300031090 | Ga0265760_10002657 | Ga0265760_100026574 | 132 |
| 424 | 3300031090 | Ga0265760_10003777 | Ga0265760_100037774 | 132 |
| 425 | 3300031090 | Ga0265760_10062877 | Ga0265760_100628771 | 132 |
| 426 | 3300031240 | Ga0265320_10291436 | Ga0265320_102914362 | 132 |
| 427 | 3300035086 | Ga0373934_0137766 | Ga0373934_0137766_431_829 | 132 |
| 428 | 3300035117 | Ga0373953_0302855 | Ga0373953_0302855_169_567 | 132 |
| 429 | 3300035121 | Ga0373960_0101156 | Ga0373960_0101156_462_860 | 132 |
| 430 | 3300035172 | Ga0373955_0112953 | Ga0373955_0112953_451_849 | 132 |
| 431 | 3300035691 | Ga0373931_0080917 | Ga0373931_0080917_209_631 | 132 |
| 432 | 3300035691 | Ga0373931_0137390 | Ga0373931_0137390_449_880 | 132 |
| 433 | 3300035691 | Ga0373931_0296946 | Ga0373931_0296946_288_686 | 132 |
| 434 | 3300035695 | Ga0373927_0301073 | Ga0373927_0301073_192_590 | 132 |
| 435 | 3300035725 | Ga0373947_0073091 | Ga0373947_0073091_1263_1661 | 132 |
| 436 | 3300036401 | Ga0373937_1045288 | Ga0373937_1045288_174_572 | 132 |
| 437 | 3300037068 | Ga0373925_0581965 | Ga0373925_0581965_237_635 | 132 |
| 438 | 3300038443 | Ga0395901_0792401 | Ga0395901_0792401_228_626 | 132 |
| 439 | 3300039437 | Ga0436365_0306336 | Ga0436365_0306336_304_702 | 132 |
| 440 | 3300039450 | Ga0436363_0951780 | Ga0436363_0951780_378_776 | 132 |
| 441 | 3300039453 | Ga0436362_0814820 | Ga0436362_0814820_2334_2732 | 132 |
| 442 | 3300041496 | Ga0451839_0427549 | Ga0451839_0427549_399_797 | 132 |
| 443 | 3300044673 | Ga0453683_0018226 | Ga0453683_0018226_1968_2375 | 132 |
| 444 | 3300044683 | Ga0466965_0171362 | Ga0466965_0171362_199_597 | 132 |
| 445 | 3300044684 | Ga0466966_0348016 | Ga0466966_0348016_371_769 | 132 |
| 446 | 3300044693 | Ga0466961_0274994 | Ga0466961_0274994_592_990 | 132 |
| 447 | 3300044694 | Ga0466963_0040977 | Ga0466963_0040977_186_584 | 132 |
| 448 | 3300044694 | Ga0466963_0043209 | Ga0466963_0043209_1644_2042 | 132 |
| 449 | 3300044706 | Ga0466964_0048888 | Ga0466964_0048888_473_871 | 132 |
| 450 | 3300044842 | Ga0466957_0101837 | Ga0466957_0101837_165_563 | 132 |
| 451 | 3300045049 | Ga0466959_0255632 | Ga0466959_0255632_371_769 | 132 |
| 452 | 3300045051 | Ga0451576_0228681 | Ga0451576_0228681_667_1065 | 132 |
| 453 | 3300045051 | Ga0451576_0530996 | Ga0451576_0530996_507_938 | 132 |
| 454 | 3300045051 | Ga0451576_2075084 | Ga0451576_2075084_97_495 | 132 |
| 455 | 3300045836 | Ga0466958_0187435 | Ga0466958_0187435_281_679 | 132 |
| 456 | 3300045836 | Ga0466958_0578952 | Ga0466958_0578952_162_560 | 132 |
| 457 | 3300045976 | Ga0466967_0154733 | Ga0466967_0154733_1020_1418 | 132 |
| 458 | 3300045976 | Ga0466967_0355207 | Ga0466967_0355207_862_1260 | 132 |
| 459 | 3300045976 | Ga0466967_0370892 | Ga0466967_0370892_117_515 | 132 |
| 460 | 3300046457 | Ga0495590_0123115 | Ga0495590_0123115_27_425 | 132 |
| 461 | 3300046472 | Ga0495580_0058661 | Ga0495580_0058661_1180_1590 | 132 |
| 462 | 3300046472 | Ga0495580_0141720 | Ga0495580_0141720_438_836 | 132 |
| 463 | 3300046516 | Ga0495628_1004218 | Ga0495628_1004218_141_563 | 132 |
| 464 | 3300046543 | Ga0495645_0858414 | Ga0495645_0858414_60_482 | 132 |
| 465 | 3300046559 | Ga0495667_0604608 | Ga0495667_0604608_263_661 | 132 |
| 466 | 3300046679 | Ga0495623_0439141 | Ga0495623_0439141_211_609 | 132 |
| 467 | 3300047319 | Ga0495674_1493393 | Ga0495674_1493393_43_465 | 132 |
| 468 | 3300048905 | Ga0496102_0144152 | Ga0496102_0144152_350_748 | 132 |
| 469 | 3300048905 | Ga0496102_1247825 | Ga0496102_1247825_225_623 | 132 |
| 470 | 3300048907 | Ga0496104_0085166 | Ga0496104_0085166_436_834 | 132 |
| 471 | 3300048907 | Ga0496104_0124899 | Ga0496104_0124899_879_1277 | 132 |
| 472 | 3300048907 | Ga0496104_0967714 | Ga0496104_0967714_165_563 | 132 |
| 473 | 3300048908 | Ga0496105_1057301 | Ga0496105_1057301_127_525 | 132 |
| 474 | 3300048915 | Ga0496112_0009029 | Ga0496112_0009029_7912_8310 | 132 |
| 475 | 3300048915 | Ga0496112_0046687 | Ga0496112_0046687_3274_3672 | 132 |
| 476 | 3300048915 | Ga0496112_0058269 | Ga0496112_0058269_613_1011 | 132 |
| 477 | 3300048915 | Ga0496112_0306799 | Ga0496112_0306799_760_1158 | 132 |
| 478 | 3300048916 | Ga0496113_0312706 | Ga0496113_0312706_157_555 | 132 |
| 479 | 3300048916 | Ga0496113_0449744 | Ga0496113_0449744_480_878 | 132 |
| 480 | 3300048918 | Ga0496115_0304666 | Ga0496115_0304666_198_596 | 132 |
| 481 | 3300049582 | Ga0501048_0351777 | Ga0501048_0351777_178_579 | 132 |
| 482 | 3300049586 | Ga0501070_0966888 | Ga0501070_0966888_187_588 | 132 |
| 483 | 3300049588 | Ga0501072_0563667 | Ga0501072_0563667_262_663 | 132 |
| 484 | 3300049707 | Ga0501234_072702 | Ga0501234_072702_61_459 | 132 |
| 485 | 3300049741 | Ga0501079_0303252 | Ga0501079_0303252_540_941 | 132 |
| 486 | 3300049824 | Ga0501045_0293538 | Ga0501045_0293538_144_545 | 132 |
| 487 | 3300050507 | nmdc:mga05p37_32056_c1 | nmdc:mga05p37_32056_c1_4358_4768 | 132 |
| 488 | 3300050507 | nmdc:mga05p37_516684_c1 | nmdc:mga05p37_516684_c1_182_580 | 132 |
| 489 | 3300050508 | nmdc:mga09592_736586_c1 | nmdc:mga09592_736586_c1_41_439 | 132 |
| 490 | 3300050510 | nmdc:mga06r32_128516_c1 | nmdc:mga06r32_128516_c1_339_737 | 132 |
| 491 | 3300050510 | nmdc:mga06r32_717384_c1 | nmdc:mga06r32_717384_c1_486_908 | 132 |
| 492 | 3300050511 | nmdc:mga08y16_1598894_c1 | nmdc:mga08y16_1598894_c1_112_510 | 132 |
| 493 | 3300050512 | nmdc:mga0n895_22419_c1 | nmdc:mga0n895_22419_c1_5022_5420 | 132 |
| 494 | 3300050513 | nmdc:mga0rr50_31610_c1 | nmdc:mga0rr50_31610_c1_1664_2062 | 132 |
| 495 | 3300050514 | nmdc:mga08x19_1029084_c1 | nmdc:mga08x19_1029084_c1_14_412 | 132 |
| 496 | 3300050514 | nmdc:mga08x19_493360_c1 | nmdc:mga08x19_493360_c1_14_412 | 132 |
| 497 | 3300053078 | Ga0495612_0272049 | Ga0495612_0272049_325_723 | 132 |
| 498 | 3300053087 | Ga0500643_039824 | Ga0500643_039824_973_1371 | 132 |
| 499 | 3300060353 | Ga0501082_1478201 | Ga0501082_1478201_127_534 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f7e-assembly1.cif.gz_B | msmeg_3380 f420 reductase | 0.8617 | 5 | 129 |
| 3f7e-assembly1.cif.gz_B | msmeg_3380 f420 reductase | 0.8428 | 5 | 129 |
| 6ymh-assembly1.cif.gz_AAA | x-ray structure of the k72i, y129f, r133l, h199a quadruple mutant of pnp-oxidase from e. coli in complex with plp | 0.809 | 16 | 130 |
| 1wv4-assembly1.cif.gz_B | x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form | 0.8063 | 16 | 132 |
| 3db0-assembly1.cif.gz_B | crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution | 0.7893 | 7 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f7eB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8589 | 5 | 129 | 2.30.110.10 |
| 3f7eB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8398 | 5 | 129 | 2.30.110.10 |
| 1wv4B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8063 | 16 | 132 | 2.30.110.10 |
| 2asfA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.771 | 6 | 132 | 2.30.110.10 |
| 2iabB01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.765 | 7 | 131 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F7MH41-F1-model_v4 | PPOX class F420-dependent enzyme | 0.9923 | 3 | 132 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A4P6JNM2-F1-model_v4 | PPOX class F420-dependent oxidoreductase | 0.9909 | 1 | 131 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A6L3AGA8-F1-model_v4 | PPOX class F420-dependent oxidoreductase | 0.9904 | 2 | 132 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A2V7FNH3-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase putative domain-containing protein | 0.9868 | 5 | 132 |
GO:0016491
GO:0071949 |
| AF-A0A1I5SCA5-F1-model_v4 | PPOX class probable F420-dependent enzyme | 0.9854 | 3 | 132 |
GO:0005829
GO:0016627 GO:0070967 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar