F455365

General Info

Members Datasets Scaffolds Average Seq Length
499 234 499 133

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10757446|Ga0105241_107574462
Length 159
Sequence VIAITPAPEAVSPVYNVSAWGSSKEKLMSQVIPDKFRDLFNKRSFASLSTLMPDGSPQVTPVWCDIEGDLVIVNTAKGRQKDKNMRRDPRVALAIIDPENPYRYLEIRGRIVETTENGAAEHIDKMAKKYLGADKYPYRQPNEVRVIYKILPESVSTMG

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
167 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 2.61
Rhizosphere 95.59
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1035938 3300000546 Unclassified 536
2 rootL2_10244063 3300003322 Bacteria 2377
3 rootH1_10286685 3300003323 Bacteria 1192
4 Ga0065712_10672436 3300005290 Unclassified 558
5 Ga0065712_10709284 3300005290 Bacteria 543
6 Ga0070683_100010905 3300005329 Bacteria 7825
7 Ga0070683_100062131 3300005329 Bacteria 3473
8 Ga0070690_100061631 3300005330 Unclassified 2417
9 Ga0070670_101521414 3300005331 Unclassified 614
10 Ga0070677_10776812 3300005333 Unclassified 545
11 Ga0068869_100057474 3300005334 Bacteria 2840
12 Ga0070666_10828958 3300005335 Unclassified 682
13 Ga0070680_100011744 3300005336 Bacteria 6791
14 Ga0070680_101668830 3300005336 Unclassified 552
15 Ga0068868_100192436 3300005338 Bacteria 1697
16 Ga0070660_100085113 3300005339 Bacteria 2486
17 Ga0070691_10431667 3300005341 Unclassified 749
18 Ga0070687_100441704 3300005343 Unclassified 863
19 Ga0070661_100042486 3300005344 Bacteria 3318
20 Ga0070661_100573881 3300005344 Unclassified 910
21 Ga0070661_100846808 3300005344 Unclassified 752
22 Ga0070669_100168297 3300005353 Unclassified 1707
23 Ga0070669_100704771 3300005353 Unclassified 853
24 Ga0070675_100900201 3300005354 Bacteria 811
25 Ga0070671_100105084 3300005355 Bacteria 2370
26 Ga0070671_101521302 3300005355 Unclassified 592
27 Ga0070673_100337224 3300005364 Bacteria 1335
28 Ga0070673_101417427 3300005364 Unclassified 654
29 Ga0070659_101919364 3300005366 Unclassified 531
30 Ga0070709_10104776 3300005434 Bacteria 1891
31 Ga0070709_10192991 3300005434 Unclassified 1438
32 Ga0070709_10196623 3300005434 Unclassified 1426
33 Ga0070714_100040115 3300005435 Bacteria 3946
34 Ga0070714_100048004 3300005435 Bacteria 3629
35 Ga0070714_100076987 3300005435 Bacteria 2897
36 Ga0070714_100192610 3300005435 Bacteria 1861
37 Ga0070714_100205874 3300005435 Bacteria 1802
38 Ga0070713_100002376 3300005436 Bacteria 12263
39 Ga0070713_100045022 3300005436 Unclassified 3614
40 Ga0070713_100058527 3300005436 Unclassified 3214
41 Ga0070713_100232336 3300005436 Bacteria 1677
42 Ga0070713_100403675 3300005436 Unclassified 1277
43 Ga0070711_100025331 3300005439 Bacteria 3881
44 Ga0070711_100122680 3300005439 Bacteria 1924
45 Ga0070711_100523138 3300005439 Unclassified 981
46 Ga0070711_101440437 3300005439 Unclassified 600
47 Ga0070705_100155178 3300005440 Archaea 1523
48 Ga0070705_100577133 3300005440 Unclassified 866
49 Ga0070694_100017333 3300005444 Archaea 4549
50 Ga0070694_101146934 3300005444 Unclassified 650
51 Ga0070708_100031279 3300005445 Bacteria 4606
52 Ga0070708_100070584 3300005445 Unclassified 3142
53 Ga0070708_101224516 3300005445 Bacteria 702
54 Ga0070678_100913915 3300005456 Unclassified 803
55 Ga0070681_10000858 3300005458 Bacteria 25550
56 Ga0070681_10017216 3300005458 Bacteria 7226
57 Ga0070681_10094586 3300005458 Bacteria 2937
58 Ga0068867_100010529 3300005459 Bacteria 6526
59 Ga0068867_100057107 3300005459 Bacteria 2890
60 Ga0070706_100001682 3300005467 Bacteria 23043
61 Ga0070706_100515412 3300005467 Unclassified 1112
62 Ga0070707_100000591 3300005468 Bacteria 36492
63 Ga0070707_100002000 3300005468 Bacteria 19516
64 Ga0070707_100854108 3300005468 Unclassified 874
65 Ga0070698_100000375 3300005471 Bacteria 46615
66 Ga0070698_100030629 3300005471 Bacteria 5578
67 Ga0070699_100002758 3300005518 Bacteria 15661
68 Ga0070699_100048157 3300005518 Bacteria 3688
69 Ga0070699_100488852 3300005518 Archaea 1117
70 Ga0070679_100656507 3300005530 Bacteria 991
71 Ga0070684_100128265 3300005535 Bacteria 2287
72 Ga0070684_100814590 3300005535 Unclassified 873
73 Ga0070697_100004133 3300005536 Bacteria 11125
74 Ga0070697_100004988 3300005536 Bacteria 10189
75 Ga0070697_100044629 3300005536 Archaea 3591
76 Ga0070697_100558820 3300005536 Unclassified 1004
77 Ga0070697_100795465 3300005536 Unclassified 837
78 Ga0068853_100037072 3300005539 Bacteria 4147
79 Ga0068853_100415506 3300005539 Bacteria 1261
80 Ga0070672_100719220 3300005543 Unclassified 875
81 Ga0070686_100367063 3300005544 Bacteria 1086
82 Ga0070695_100403472 3300005545 Unclassified 1037
83 Ga0070695_100413080 3300005545 Unclassified 1026
84 Ga0070696_100167807 3300005546 Bacteria 1621
85 Ga0070696_100305696 3300005546 Archaea 1219
86 Ga0070696_101215816 3300005546 Unclassified 637
87 Ga0070696_101995072 3300005546 Unclassified 504
88 Ga0070693_100005329 3300005547 Bacteria 6167
89 Ga0070693_100117236 3300005547 Bacteria 1647
90 Ga0070693_101220038 3300005547 Bacteria 578
91 Ga0070665_100231186 3300005548 Bacteria 1849
92 Ga0070704_100008254 3300005549 Archaea 6233
93 Ga0070704_100055269 3300005549 Bacteria 2814
94 Ga0068855_100038914 3300005563 Bacteria 5647
95 Ga0068855_100044583 3300005563 Bacteria 5249
96 Ga0068855_100113160 3300005563 Unclassified 3114
97 Ga0068855_100188121 3300005563 Bacteria 2331
98 Ga0068855_100208892 3300005563 Bacteria 2195
99 Ga0068855_101287772 3300005563 Unclassified 757
100 Ga0070664_100000655 3300005564 Bacteria 26466
101 Ga0070664_100161237 3300005564 Bacteria 1984
102 Ga0070664_100295899 3300005564 Bacteria 1462
103 Ga0070664_100759865 3300005564 Bacteria 905
104 Ga0068857_100001890 3300005577 Bacteria 16879
105 Ga0068857_100003336 3300005577 Bacteria 13363
106 Ga0068857_101230842 3300005577 Bacteria 725
107 Ga0068854_100038150 3300005578 Bacteria 3377
108 Ga0068854_100535342 3300005578 Bacteria 991
109 Ga0068856_100001186 3300005614 Bacteria 27468
110 Ga0068856_100013056 3300005614 Bacteria 8046
111 Ga0068856_100032697 3300005614 Bacteria 5094
112 Ga0068856_100038258 3300005614 Bacteria 4709
113 Ga0068856_100070817 3300005614 Unclassified 3450
114 Ga0070702_100228540 3300005615 Unclassified 1248
115 Ga0070702_100848396 3300005615 Unclassified 711
116 Ga0068852_100009585 3300005616 Bacteria 7196
117 Ga0068852_100203208 3300005616 Bacteria 1876
118 Ga0068859_100033660 3300005617 Bacteria 5145
119 Ga0068859_100041212 3300005617 Bacteria 4638
120 Ga0068864_100000347 3300005618 Bacteria 40801
121 Ga0068864_100004216 3300005618 Bacteria 11828
122 Ga0068864_101226741 3300005618 Unclassified 749
123 Ga0068866_10244525 3300005718 Unclassified 1094
124 Ga0068861_100451455 3300005719 Bacteria 1152
125 Ga0068861_100730398 3300005719 Unclassified 923
126 Ga0068851_10128176 3300005834 Unclassified 1370
127 Ga0068863_100184209 3300005841 Bacteria 2005
128 Ga0068863_100353500 3300005841 Bacteria 1431
129 Ga0068863_100414945 3300005841 Bacteria 1318
130 Ga0068858_100003905 3300005842 Bacteria 14724
131 Ga0068858_100006670 3300005842 Bacteria 11227
132 Ga0068858_100155750 3300005842 Bacteria 2150
133 Ga0068860_100021893 3300005843 Bacteria 6185
134 Ga0068860_100119519 3300005843 Bacteria 2523
135 Ga0068860_100318740 3300005843 Bacteria 1526
136 Ga0068860_100539901 3300005843 Bacteria 1167
137 Ga0068860_100575194 3300005843 Bacteria 1130
138 Ga0068862_100026666 3300005844 Bacteria 4858
139 Ga0068862_100207702 3300005844 Bacteria 1768
140 Ga0068862_100225783 3300005844 Bacteria 1697
141 Ga0081455_10019817 3300005937 Bacteria 6352
142 Ga0081455_10514430 3300005937 Unclassified 800
143 Ga0081540_1045540 3300005983 Bacteria 2226
144 Ga0070717_10038338 3300006028 Bacteria 3895
145 Ga0070717_10230632 3300006028 Unclassified 1630
146 Ga0070715_10627900 3300006163 Unclassified 633
147 Ga0070716_100137851 3300006173 Bacteria 1552
148 Ga0070716_100171015 3300006173 Bacteria 1418
149 Ga0070712_100010608 3300006175 Bacteria 5819
150 Ga0070712_100232026 3300006175 Unclassified 1466
151 Ga0070712_100655557 3300006175 Unclassified 892
152 Ga0097621_100000133 3300006237 Bacteria 43711
153 Ga0097621_100017370 3300006237 Bacteria 5461
154 Ga0097621_100020479 3300006237 Bacteria 5096
155 Ga0097621_100051862 3300006237 Bacteria 3339
156 Ga0068871_100000448 3300006358 Bacteria 28345
157 Ga0068871_100003253 3300006358 Bacteria 11143
158 Ga0068871_100066191 3300006358 Unclassified 2961
159 Ga0068871_100079138 3300006358 Bacteria 2719
160 Ga0068871_100113343 3300006358 Bacteria 2283
161 Ga0068871_100114893 3300006358 Bacteria 2268
162 Ga0068871_100678711 3300006358 Unclassified 942
163 Ga0075428_100000407 3300006844 Bacteria 42753
164 Ga0075428_100316630 3300006844 Bacteria 1677
165 Ga0075428_100438915 3300006844 Bacteria 1398
166 Ga0075430_100557526 3300006846 Bacteria 945
167 Ga0075431_100608694 3300006847 Bacteria 1076
168 Ga0075431_102144044 3300006847 Unclassified 513
169 Ga0075433_10363389 3300006852 Bacteria 1278
170 Ga0075434_100012876 3300006871 Bacteria 7945
171 Ga0075434_100901338 3300006871 Unclassified 899
172 Ga0075429_100440271 3300006880 Bacteria 1142
173 Ga0068865_100132421 3300006881 Bacteria 1870
174 Ga0068865_100293756 3300006881 Bacteria 1298
175 Ga0075436_100027872 3300006914 Unclassified 3888
176 Ga0075436_101272081 3300006914 Unclassified 556
177 Ga0097620_100033662 3300006931 Bacteria 5145
178 Ga0097620_100041212 3300006931 Bacteria 4638
179 Ga0075435_100076717 3300007076 Bacteria 2739
180 Ga0105240_10012666 3300009093 Bacteria 11625
181 Ga0105240_10053713 3300009093 Bacteria 5055
182 Ga0105240_10154863 3300009093 Bacteria 2727
183 Ga0105240_10163995 3300009093 Unclassified 2637
184 Ga0105240_10242833 3300009093 Bacteria 2087
185 Ga0111539_10012318 3300009094 Bacteria 10716
186 Ga0111539_12037365 3300009094 Unclassified 666
187 Ga0105245_10237128 3300009098 Unclassified 1767
188 Ga0105245_11248923 3300009098 Bacteria 791
189 Ga0105247_10018885 3300009101 Unclassified 4139
190 Ga0105247_10728515 3300009101 Unclassified 749
191 Ga0114129_10000472 3300009147 Bacteria 48405
192 Ga0114129_10166153 3300009147 Bacteria 3011
193 Ga0114129_10200534 3300009147 Bacteria 2703
194 Ga0114129_10208891 3300009147 Bacteria 2640
195 Ga0114129_10835578 3300009147 Bacteria 1172
196 Ga0114129_11371604 3300009147 Unclassified 873
197 Ga0105243_10114819 3300009148 Bacteria 2260
198 Ga0105241_10034189 3300009174 Bacteria 3818
199 Ga0105241_10041323 3300009174 Bacteria 3484
200 Ga0105241_10160210 3300009174 Bacteria 1849
201 Ga0105241_10176486 3300009174 Bacteria 1769
202 Ga0105241_10757446 3300009174 Unclassified 891
203 Ga0105242_10575640 3300009176 Bacteria 1084
204 Ga0105242_11493029 3300009176 Unclassified 706
205 Ga0105248_10026986 3300009177 Bacteria 6388
206 Ga0105248_10070839 3300009177 Bacteria 3915
207 Ga0105237_10049680 3300009545 Bacteria 4215
208 Ga0105237_10062101 3300009545 Bacteria 3735
209 Ga0105237_10300718 3300009545 Unclassified 1608
210 Ga0105237_10314293 3300009545 Bacteria 1570
211 Ga0105237_10571910 3300009545 Unclassified 1137
212 Ga0105237_10594889 3300009545 Bacteria 1113
213 Ga0105237_11154934 3300009545 Unclassified 781
214 Ga0105237_11187055 3300009545 Bacteria 770
215 Ga0105237_12591154 3300009545 Unclassified 518
216 Ga0105238_10000368 3300009551 Bacteria 48371
217 Ga0105238_10216908 3300009551 Bacteria 1889
218 Ga0105249_10140411 3300009553 Unclassified 2316
219 Ga0105239_10018608 3300010375 Bacteria 7673
220 Ga0105239_10428165 3300010375 Bacteria 1500
221 Ga0105239_10616543 3300010375 Bacteria 1238
222 Ga0105246_10063510 3300011119 Bacteria 2576
223 Ga0157373_10021467 3300013100 Bacteria 4690
224 Ga0157373_10140135 3300013100 Bacteria 1700
225 Ga0157373_10162511 3300013100 Bacteria 1571
226 Ga0157373_10174529 3300013100 Unclassified 1513
227 Ga0157373_10426942 3300013100 Unclassified 952
228 Ga0157371_10475769 3300013102 Unclassified 920
229 Ga0157371_10527787 3300013102 Unclassified 873
230 Ga0157370_10071517 3300013104 Bacteria 3273
231 Ga0157370_10314773 3300013104 Unclassified 1444
232 Ga0157369_10006808 3300013105 Bacteria 13181
233 Ga0157369_10026425 3300013105 Bacteria 6438
234 Ga0157369_10035928 3300013105 Bacteria 5431
235 Ga0157369_10083788 3300013105 Unclassified 3409
236 Ga0157369_10706963 3300013105 Unclassified 1038
237 Ga0157369_11685427 3300013105 Unclassified 644
238 Ga0157374_10000254 3300013296 Bacteria 49194
239 Ga0157374_10000302 3300013296 Bacteria 45742
240 Ga0157374_10001933 3300013296 Bacteria 17370
241 Ga0157374_10022733 3300013296 Bacteria 5598
242 Ga0157374_10151785 3300013296 Bacteria 2252
243 Ga0157378_10000055 3300013297 Bacteria 97875
244 Ga0157378_10000554 3300013297 Bacteria 35545
245 Ga0157378_10050680 3300013297 Bacteria 3694
246 Ga0157378_10197896 3300013297 Bacteria 1899
247 Ga0157378_10603933 3300013297 Unclassified 1109
248 Ga0163162_10312975 3300013306 Bacteria 1703
249 Ga0157372_10000661 3300013307 Bacteria 37855
250 Ga0157372_10001984 3300013307 Bacteria 22243
251 Ga0157372_10002739 3300013307 Bacteria 19040
252 Ga0157372_10030721 3300013307 Bacteria 5878
253 Ga0157372_10037604 3300013307 Bacteria 5341
254 Ga0157372_10070218 3300013307 Unclassified 3940
255 Ga0157372_10075292 3300013307 Bacteria 3809
256 Ga0157372_10333653 3300013307 Bacteria 1766
257 Ga0157372_11745418 3300013307 Unclassified 716
258 Ga0157372_11966979 3300013307 Unclassified 672
259 Ga0157375_10236237 3300013308 Bacteria 1987
260 Ga0163163_10678328 3300014325 Unclassified 1094
261 Ga0163163_10876256 3300014325 Bacteria 961
262 Ga0157380_10101877 3300014326 Bacteria 2393
263 Ga0157380_10411414 3300014326 Unclassified 1287
264 Ga0157380_11130282 3300014326 Bacteria 824
265 Ga0157377_10123562 3300014745 Bacteria 1572
266 Ga0157377_10370357 3300014745 Unclassified 967
267 Ga0157379_10037210 3300014968 Unclassified 4338
268 Ga0157376_10180109 3300014969 Bacteria 1931
269 Ga0157376_10626621 3300014969 Bacteria 1073
270 Ga0213873_10007662 3300021358 Unclassified 2172
271 Ga0213875_10118931 3300021388 Bacteria 1234
272 Ga0207697_10424993 3300025315 Unclassified 590
273 Ga0207656_10138394 3300025321 Unclassified 1146
274 Ga0207642_10444759 3300025899 Unclassified 784
275 Ga0207688_10402040 3300025901 Unclassified 849
276 Ga0207647_10000903 3300025904 Bacteria 22977
277 Ga0207647_10078719 3300025904 Unclassified 1980
278 Ga0207685_10148843 3300025905 Unclassified 1057
279 Ga0207699_10089305 3300025906 Bacteria 1931
280 Ga0207699_10139235 3300025906 Unclassified 1593
281 Ga0207645_10434367 3300025907 Unclassified 885
282 Ga0207684_10014797 3300025910 Bacteria 6718
283 Ga0207684_10392366 3300025910 Bacteria 1193
284 Ga0207684_10444213 3300025910 Unclassified 1114
285 Ga0207654_10008545 3300025911 Bacteria 5185
286 Ga0207654_10042499 3300025911 Bacteria 2573
287 Ga0207654_10833837 3300025911 Unclassified 667
288 Ga0207707_10010028 3300025912 Bacteria 8219
289 Ga0207707_10016930 3300025912 Bacteria 6350
290 Ga0207707_10566349 3300025912 Bacteria 964
291 Ga0207695_10023048 3300025913 Bacteria 7048
292 Ga0207695_10024582 3300025913 Bacteria 6771
293 Ga0207695_10096246 3300025913 Bacteria 2962
294 Ga0207695_10219021 3300025913 Unclassified 1811
295 Ga0207695_10545590 3300025913 Unclassified 1041
296 Ga0207695_10875569 3300025913 Bacteria 778
297 Ga0207671_10031806 3300025914 Bacteria 3931
298 Ga0207671_10051514 3300025914 Unclassified 3051
299 Ga0207671_10354978 3300025914 Bacteria 1163
300 Ga0207671_10456207 3300025914 Bacteria 1018
301 Ga0207671_10880263 3300025914 Unclassified 708
302 Ga0207671_11255758 3300025914 Bacteria 578
303 Ga0207671_11510401 3300025914 Unclassified 518
304 Ga0207693_10147969 3300025915 Bacteria 1847
305 Ga0207693_10494367 3300025915 Bacteria 955
306 Ga0207693_10778010 3300025915 Bacteria 738
307 Ga0207693_10857051 3300025915 Unclassified 698
308 Ga0207663_10463199 3300025916 Bacteria 979
309 Ga0207663_10838494 3300025916 Bacteria 733
310 Ga0207663_11021039 3300025916 Unclassified 664
311 Ga0207663_11403540 3300025916 Bacteria 562
312 Ga0207660_10037639 3300025917 Bacteria 3373
313 Ga0207657_10194614 3300025919 Bacteria 1634
314 Ga0207649_10085349 3300025920 Unclassified 2054
315 Ga0207649_11622856 3300025920 Unclassified 512
316 Ga0207652_10799491 3300025921 Bacteria 837
317 Ga0207652_11847023 3300025921 Unclassified 509
318 Ga0207646_10000742 3300025922 Bacteria 42389
319 Ga0207646_10001179 3300025922 Bacteria 32952
320 Ga0207681_10152384 3300025923 Bacteria 1734
321 Ga0207694_10001767 3300025924 Bacteria 18091
322 Ga0207694_10071998 3300025924 Bacteria 2702
323 Ga0207694_10302177 3300025924 Unclassified 1318
324 Ga0207650_11128038 3300025925 Unclassified 667
325 Ga0207687_11246365 3300025927 Unclassified 639
326 Ga0207700_10084080 3300025928 Unclassified 2493
327 Ga0207700_10124979 3300025928 Bacteria 2091
328 Ga0207700_10184344 3300025928 Bacteria 1750
329 Ga0207700_10688629 3300025928 Unclassified 912
330 Ga0207700_11823822 3300025928 Bacteria 534
331 Ga0207664_10025845 3300025929 Bacteria 4429
332 Ga0207664_10054863 3300025929 Bacteria 3159
333 Ga0207664_10122714 3300025929 Bacteria 2176
334 Ga0207664_10332556 3300025929 Unclassified 1342
335 Ga0207664_11111057 3300025929 Unclassified 706
336 Ga0207644_10125475 3300025931 Bacteria 1959
337 Ga0207706_10831108 3300025933 Unclassified 783
338 Ga0207686_10750670 3300025934 Unclassified 779
339 Ga0207704_10004764 3300025938 Bacteria 6227
340 Ga0207704_10159875 3300025938 Bacteria 1601
341 Ga0207665_10156576 3300025939 Unclassified 1636
342 Ga0207665_10307934 3300025939 Bacteria 1186
343 Ga0207665_10913377 3300025939 Bacteria 697
344 Ga0207691_10282607 3300025940 Bacteria 1428
345 Ga0207691_10691597 3300025940 Unclassified 860
346 Ga0207711_10062799 3300025941 Bacteria 3205
347 Ga0207711_11330862 3300025941 Unclassified 661
348 Ga0207689_10000788 3300025942 Bacteria 30435
349 Ga0207689_10338048 3300025942 Unclassified 1250
350 Ga0207661_10106361 3300025944 Bacteria 2365
351 Ga0207661_11031510 3300025944 Unclassified 757
352 Ga0207661_11038252 3300025944 Unclassified 755
353 Ga0207679_10062560 3300025945 Unclassified 2774
354 Ga0207679_10115941 3300025945 Bacteria 2123
355 Ga0207667_10010578 3300025949 Bacteria 10777
356 Ga0207667_10035751 3300025949 Bacteria 5328
357 Ga0207667_10043425 3300025949 Bacteria 4770
358 Ga0207667_10127389 3300025949 Unclassified 2623
359 Ga0207667_10205283 3300025949 Bacteria 2021
360 Ga0207667_10339051 3300025949 Bacteria 1534
361 Ga0207667_11135505 3300025949 Unclassified 763
362 Ga0207651_10319853 3300025960 Unclassified 1297
363 Ga0207651_10496908 3300025960 Bacteria 1054
364 Ga0207712_11524496 3300025961 Unclassified 599
365 Ga0207668_10892149 3300025972 Bacteria 791
366 Ga0207640_10037949 3300025981 Bacteria 3036
367 Ga0207640_10457662 3300025981 Unclassified 1053
368 Ga0207640_10492854 3300025981 Bacteria 1019
369 Ga0207640_10555446 3300025981 Bacteria 965
370 Ga0207658_10209729 3300025986 Bacteria 1632
371 Ga0207677_10085004 3300026023 Bacteria 2282
372 Ga0207677_11318499 3300026023 Unclassified 663
373 Ga0207703_10017439 3300026035 Bacteria 5604
374 Ga0207703_10025019 3300026035 Bacteria 4696
375 Ga0207703_10149566 3300026035 Bacteria 2035
376 Ga0207639_10029075 3300026041 Bacteria 4043
377 Ga0207639_10281803 3300026041 Bacteria 1462
378 Ga0207639_10389554 3300026041 Bacteria 1253
379 Ga0207708_11214608 3300026075 Unclassified 659
380 Ga0207702_10001337 3300026078 Bacteria 24659
381 Ga0207702_10002787 3300026078 Bacteria 16382
382 Ga0207702_10013220 3300026078 Bacteria 6864
383 Ga0207702_10429122 3300026078 Bacteria 1279
384 Ga0207702_10439410 3300026078 Bacteria 1264
385 Ga0207641_10337580 3300026088 Bacteria 1433
386 Ga0207641_10952717 3300026088 Unclassified 854
387 Ga0207648_10002663 3300026089 Bacteria 19026
388 Ga0207648_10050680 3300026089 Bacteria 3629
389 Ga0207676_10007557 3300026095 Bacteria 7711
390 Ga0207676_10041511 3300026095 Bacteria 3532
391 Ga0207674_10000514 3300026116 Bacteria 50775
392 Ga0207674_10002979 3300026116 Bacteria 21005
393 Ga0207674_11584276 3300026116 Unclassified 624
394 Ga0207675_100048527 3300026118 Bacteria 3963
395 Ga0207675_101241456 3300026118 Bacteria 766
396 Ga0207683_10344806 3300026121 Bacteria 1366
397 Ga0207683_11018176 3300026121 Unclassified 769
398 Ga0207698_10100327 3300026142 Unclassified 2397
399 Ga0207698_10778502 3300026142 Unclassified 957
400 Ga0207698_11098042 3300026142 Unclassified 808
401 Ga0207428_10010335 3300027907 Bacteria 8344
402 Ga0265354_1004140 3300028016 Bacteria 1548
403 Ga0265355_1002924 3300028036 Bacteria 1229
404 Ga0268266_10362459 3300028379 Bacteria 1364
405 Ga0268265_10100064 3300028380 Bacteria 2339
406 Ga0268264_10053356 3300028381 Unclassified 3372
407 Ga0268264_10075735 3300028381 Bacteria 2861
408 Ga0268264_10147562 3300028381 Bacteria 2105
409 Ga0265770_1006881 3300030878 Bacteria 1587
410 Ga0265765_1060876 3300030879 Bacteria 533
411 Ga0265760_10002657 3300031090 Bacteria 5230
412 Ga0265760_10003777 3300031090 Bacteria 4391
413 Ga0265760_10062877 3300031090 Bacteria 1130
414 Ga0265320_10291436 3300031240 Unclassified 722
415 Ga0307414_12295469 3300032004 Bacteria 504
416 Ga0373934_0137766 3300035086 Bacteria 997
417 Ga0373953_0302855 3300035117 Bacteria 698
418 Ga0373960_0101156 3300035121 Bacteria 934
419 Ga0373955_0112953 3300035172 Bacteria 1572
420 Ga0373931_0080917 3300035691 Bacteria 1792
421 Ga0373931_0137390 3300035691 Unclassified 1412
422 Ga0373931_0296946 3300035691 Bacteria 996
423 Ga0373927_0301073 3300035695 Bacteria 1055
424 Ga0373947_0073091 3300035725 Bacteria 2107
425 Ga0373937_1045288 3300036401 Unclassified 765
426 Ga0373925_0581965 3300037068 Unclassified 921
427 Ga0395901_0792401 3300038443 Unclassified 937
428 Ga0436365_0306336 3300039437 Unclassified 855
429 Ga0436363_0192214 3300039450 Unclassified 1233
430 Ga0436363_0951780 3300039450 Unclassified 944
431 Ga0436362_0814820 3300039453 Bacteria 4946
432 Ga0451839_0427549 3300041496 Unclassified 1098
433 Ga0453683_0018226 3300044673 Archaea 4508
434 Ga0466965_0171362 3300044683 Bacteria 1142
435 Ga0466966_0348016 3300044684 Unclassified 891
436 Ga0466961_0274994 3300044693 Bacteria 1031
437 Ga0466963_0040977 3300044694 Bacteria 3036
438 Ga0466963_0043209 3300044694 Unclassified 2962
439 Ga0466964_0048888 3300044706 Bacteria 1731
440 Ga0453684_0466643 3300044712 Bacteria 1403
441 Ga0466957_0101837 3300044842 Unclassified 1811
442 Ga0466959_0255632 3300045049 Bacteria 1207
443 Ga0451576_0151412 3300045051 Bacteria 2419
444 Ga0451576_0228681 3300045051 Bacteria 1942
445 Ga0451576_0530996 3300045051 Bacteria 1236
446 Ga0451576_2075084 3300045051 Unclassified 585
447 Ga0466958_0187435 3300045836 Bacteria 1314
448 Ga0466958_0578952 3300045836 Bacteria 730
449 Ga0466967_0154733 3300045976 Bacteria 2146
450 Ga0466967_0355207 3300045976 Bacteria 1419
451 Ga0466967_0370892 3300045976 Bacteria 1388
452 Ga0495590_0123115 3300046457 Unclassified 930
453 Ga0495580_0058661 3300046472 Unclassified 2706
454 Ga0495580_0141720 3300046472 Bacteria 1666
455 Ga0495628_1004218 3300046516 Bacteria 574
456 Ga0495645_0858414 3300046543 Bacteria 541
457 Ga0495667_0604608 3300046559 Bacteria 683
458 Ga0495623_0439141 3300046679 Unclassified 697
459 Ga0495674_1493393 3300047319 Bacteria 500
460 Ga0496102_0144152 3300048905 Bacteria 2234
461 Ga0496102_1247825 3300048905 Bacteria 662
462 Ga0496104_0085166 3300048907 Bacteria 3017
463 Ga0496104_0124899 3300048907 Bacteria 2471
464 Ga0496104_0967714 3300048907 Unclassified 755
465 Ga0496105_1057301 3300048908 Unclassified 604
466 Ga0496112_0009029 3300048915 Bacteria 8954
467 Ga0496112_0046687 3300048915 Unclassified 4249
468 Ga0496112_0058269 3300048915 Bacteria 3803
469 Ga0496112_0306799 3300048915 Bacteria 1532
470 Ga0496113_0312706 3300048916 Unclassified 1259
471 Ga0496113_0449744 3300048916 Bacteria 1035
472 Ga0496115_0304666 3300048918 Bacteria 1305
473 Ga0501048_0351777 3300049582 Bacteria 1051
474 Ga0501070_0966888 3300049586 Bacteria 662
475 Ga0501072_0563667 3300049588 Bacteria 899
476 Ga0501234_072702 3300049707 Unclassified 596
477 Ga0501079_0303252 3300049741 Unclassified 1250
478 Ga0501264_045693 3300049761 Unclassified 551
479 Ga0501045_0293538 3300049824 Bacteria 1210
480 nmdc:mga05p37_299_c2 3300050507 Bacteria 40446
481 nmdc:mga05p37_32056_c1 3300050507 Bacteria 6426
482 nmdc:mga05p37_516684_c1 3300050507 Bacteria 1367
483 nmdc:mga09592_394092_c1 3300050508 Bacteria 1197
484 nmdc:mga09592_736586_c1 3300050508 Bacteria 837
485 nmdc:mga0qj67_686477_c1 3300050509 Bacteria 815
486 nmdc:mga06r32_128516_c1 3300050510 Bacteria 2504
487 nmdc:mga06r32_568168_c1 3300050510 Bacteria 1107
488 nmdc:mga06r32_717384_c1 3300050510 Unclassified 965
489 nmdc:mga08y16_1598894_c1 3300050511 Bacteria 610
490 nmdc:mga08y16_2228_c1 3300050511 Bacteria 19862
491 nmdc:mga0n895_22419_c1 3300050512 Bacteria 5921
492 nmdc:mga0rr50_31610_c1 3300050513 Bacteria 3762
493 nmdc:mga08x19_1029084_c1 3300050514 Bacteria 585
494 nmdc:mga08x19_493360_c1 3300050514 Bacteria 864
495 nmdc:mga0a205_176028_c1 3300050515 Bacteria 2035
496 Ga0495612_0272049 3300053078 Bacteria 756
497 Ga0500643_039824 3300053087 Bacteria 1386
498 Ga0500650_0000152 3300053098 Bacteria 18057
499 Ga0501082_1478201 3300060353 Archaea 593

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10053713 Ga0105240_100537133 130
2 3300010375 Ga0105239_10428165 Ga0105239_104281652 130
3 3300025913 Ga0207695_10096246 Ga0207695_100962464 130
4 3300039450 Ga0436363_0192214 Ga0436363_0192214_57_449 130
5 3300005290 Ga0065712_10709284 Ga0065712_107092841 131
6 3300005353 Ga0070669_100704771 Ga0070669_1007047711 131
7 3300005471 Ga0070698_100030629 Ga0070698_1000306294 131
8 3300005536 Ga0070697_100558820 Ga0070697_1005588202 131
9 3300005546 Ga0070696_100167807 Ga0070696_1001678071 131
10 3300005719 Ga0068861_100451455 Ga0068861_1004514552 131
11 3300006844 Ga0075428_100000407 Ga0075428_10000040731 131
12 3300006846 Ga0075430_100557526 Ga0075430_1005575262 131
13 3300006847 Ga0075431_100608694 Ga0075431_1006086942 131
14 3300006852 Ga0075433_10363389 Ga0075433_103633892 131
15 3300006880 Ga0075429_100440271 Ga0075429_1004402712 131
16 3300009094 Ga0111539_10012318 Ga0111539_1001231812 131
17 3300009147 Ga0114129_10000472 Ga0114129_1000047231 131
18 3300014326 Ga0157380_10411414 Ga0157380_104114142 131
19 3300014326 Ga0157380_11130282 Ga0157380_111302822 131
20 3300025910 Ga0207684_10392366 Ga0207684_103923662 131
21 3300025949 Ga0207667_10043425 Ga0207667_100434254 131
22 3300026118 Ga0207675_101241456 Ga0207675_1012414562 131
23 3300027907 Ga0207428_10010335 Ga0207428_100103359 131
24 3300032004 Ga0307414_12295469 Ga0307414_122954692 131
25 3300044712 Ga0453684_0466643 Ga0453684_0466643_943_1389 131
26 3300045051 Ga0451576_0151412 Ga0451576_0151412_929_1375 131
27 3300049761 Ga0501264_045693 Ga0501264_045693_57_452 131
28 3300050507 nmdc:mga05p37_299_c2 nmdc:mga05p37_299_c2_6867_7265 131
29 3300050508 nmdc:mga09592_394092_c1 nmdc:mga09592_394092_c1_292_687 131
30 3300050509 nmdc:mga0qj67_686477_c1 nmdc:mga0qj67_686477_c1_185_580 131
31 3300050510 nmdc:mga06r32_568168_c1 nmdc:mga06r32_568168_c1_226_621 131
32 3300050511 nmdc:mga08y16_2228_c1 nmdc:mga08y16_2228_c1_1301_1696 131
33 3300050515 nmdc:mga0a205_176028_c1 nmdc:mga0a205_176028_c1_1334_1729 131
34 3300053098 Ga0500650_0000152 Ga0500650_0000152_8810_9205 131
35 3300000546 LJNas_1035938 LJNas_10359382 132
36 3300003322 rootL2_10244063 rootL2_102440633 132
37 3300003323 rootH1_10286685 rootH1_102866851 132
38 3300005290 Ga0065712_10672436 Ga0065712_106724361 132
39 3300005329 Ga0070683_100010905 Ga0070683_1000109053 132
40 3300005329 Ga0070683_100062131 Ga0070683_1000621312 132
41 3300005330 Ga0070690_100061631 Ga0070690_1000616312 132
42 3300005331 Ga0070670_101521414 Ga0070670_1015214141 132
43 3300005333 Ga0070677_10776812 Ga0070677_107768121 132
44 3300005334 Ga0068869_100057474 Ga0068869_1000574743 132
45 3300005335 Ga0070666_10828958 Ga0070666_108289582 132
46 3300005336 Ga0070680_100011744 Ga0070680_1000117444 132
47 3300005336 Ga0070680_101668830 Ga0070680_1016688301 132
48 3300005338 Ga0068868_100192436 Ga0068868_1001924362 132
49 3300005339 Ga0070660_100085113 Ga0070660_1000851131 132
50 3300005341 Ga0070691_10431667 Ga0070691_104316671 132
51 3300005343 Ga0070687_100441704 Ga0070687_1004417041 132
52 3300005344 Ga0070661_100042486 Ga0070661_1000424863 132
53 3300005344 Ga0070661_100573881 Ga0070661_1005738812 132
54 3300005344 Ga0070661_100846808 Ga0070661_1008468081 132
55 3300005353 Ga0070669_100168297 Ga0070669_1001682971 132
56 3300005354 Ga0070675_100900201 Ga0070675_1009002012 132
57 3300005355 Ga0070671_100105084 Ga0070671_1001050842 132
58 3300005355 Ga0070671_101521302 Ga0070671_1015213021 132
59 3300005364 Ga0070673_100337224 Ga0070673_1003372241 132
60 3300005364 Ga0070673_101417427 Ga0070673_1014174271 132
61 3300005366 Ga0070659_101919364 Ga0070659_1019193641 132
62 3300005434 Ga0070709_10104776 Ga0070709_101047762 132
63 3300005434 Ga0070709_10192991 Ga0070709_101929912 132
64 3300005434 Ga0070709_10196623 Ga0070709_101966233 132
65 3300005435 Ga0070714_100040115 Ga0070714_1000401152 132
66 3300005435 Ga0070714_100048004 Ga0070714_1000480042 132
67 3300005435 Ga0070714_100076987 Ga0070714_1000769872 132
68 3300005435 Ga0070714_100192610 Ga0070714_1001926102 132
69 3300005435 Ga0070714_100205874 Ga0070714_1002058742 132
70 3300005436 Ga0070713_100002376 Ga0070713_1000023768 132
71 3300005436 Ga0070713_100045022 Ga0070713_1000450222 132
72 3300005436 Ga0070713_100058527 Ga0070713_1000585273 132
73 3300005436 Ga0070713_100232336 Ga0070713_1002323361 132
74 3300005436 Ga0070713_100403675 Ga0070713_1004036752 132
75 3300005439 Ga0070711_100025331 Ga0070711_1000253313 132
76 3300005439 Ga0070711_100122680 Ga0070711_1001226802 132
77 3300005439 Ga0070711_100523138 Ga0070711_1005231382 132
78 3300005439 Ga0070711_101440437 Ga0070711_1014404371 132
79 3300005440 Ga0070705_100155178 Ga0070705_1001551783 132
80 3300005440 Ga0070705_100577133 Ga0070705_1005771332 132
81 3300005444 Ga0070694_100017333 Ga0070694_1000173336 132
82 3300005444 Ga0070694_101146934 Ga0070694_1011469341 132
83 3300005445 Ga0070708_100031279 Ga0070708_1000312791 132
84 3300005445 Ga0070708_100070584 Ga0070708_1000705843 132
85 3300005445 Ga0070708_101224516 Ga0070708_1012245161 132
86 3300005456 Ga0070678_100913915 Ga0070678_1009139151 132
87 3300005458 Ga0070681_10000858 Ga0070681_1000085814 132
88 3300005458 Ga0070681_10017216 Ga0070681_100172164 132
89 3300005458 Ga0070681_10094586 Ga0070681_100945864 132
90 3300005459 Ga0068867_100010529 Ga0068867_1000105294 132
91 3300005459 Ga0068867_100057107 Ga0068867_1000571073 132
92 3300005467 Ga0070706_100001682 Ga0070706_10000168213 132
93 3300005467 Ga0070706_100515412 Ga0070706_1005154121 132
94 3300005468 Ga0070707_100000591 Ga0070707_10000059113 132
95 3300005468 Ga0070707_100002000 Ga0070707_10000200019 132
96 3300005468 Ga0070707_100854108 Ga0070707_1008541081 132
97 3300005471 Ga0070698_100000375 Ga0070698_10000037531 132
98 3300005518 Ga0070699_100002758 Ga0070699_10000275815 132
99 3300005518 Ga0070699_100048157 Ga0070699_1000481574 132
100 3300005518 Ga0070699_100488852 Ga0070699_1004888521 132
101 3300005530 Ga0070679_100656507 Ga0070679_1006565072 132
102 3300005535 Ga0070684_100128265 Ga0070684_1001282652 132
103 3300005535 Ga0070684_100814590 Ga0070684_1008145902 132
104 3300005536 Ga0070697_100004133 Ga0070697_10000413311 132
105 3300005536 Ga0070697_100004988 Ga0070697_10000498811 132
106 3300005536 Ga0070697_100044629 Ga0070697_1000446294 132
107 3300005536 Ga0070697_100795465 Ga0070697_1007954651 132
108 3300005539 Ga0068853_100037072 Ga0068853_1000370722 132
109 3300005539 Ga0068853_100415506 Ga0068853_1004155062 132
110 3300005543 Ga0070672_100719220 Ga0070672_1007192202 132
111 3300005544 Ga0070686_100367063 Ga0070686_1003670632 132
112 3300005545 Ga0070695_100403472 Ga0070695_1004034721 132
113 3300005545 Ga0070695_100413080 Ga0070695_1004130801 132
114 3300005546 Ga0070696_100305696 Ga0070696_1003056962 132
115 3300005546 Ga0070696_101215816 Ga0070696_1012158161 132
116 3300005546 Ga0070696_101995072 Ga0070696_1019950722 132
117 3300005547 Ga0070693_100005329 Ga0070693_1000053296 132
118 3300005547 Ga0070693_100117236 Ga0070693_1001172362 132
119 3300005547 Ga0070693_101220038 Ga0070693_1012200381 132
120 3300005548 Ga0070665_100231186 Ga0070665_1002311862 132
121 3300005549 Ga0070704_100008254 Ga0070704_1000082543 132
122 3300005549 Ga0070704_100055269 Ga0070704_1000552692 132
123 3300005563 Ga0068855_100038914 Ga0068855_1000389143 132
124 3300005563 Ga0068855_100044583 Ga0068855_1000445832 132
125 3300005563 Ga0068855_100113160 Ga0068855_1001131602 132
126 3300005563 Ga0068855_100188121 Ga0068855_1001881212 132
127 3300005563 Ga0068855_100208892 Ga0068855_1002088923 132
128 3300005563 Ga0068855_101287772 Ga0068855_1012877721 132
129 3300005564 Ga0070664_100000655 Ga0070664_10000065529 132
130 3300005564 Ga0070664_100161237 Ga0070664_1001612372 132
131 3300005564 Ga0070664_100295899 Ga0070664_1002958993 132
132 3300005564 Ga0070664_100759865 Ga0070664_1007598652 132
133 3300005577 Ga0068857_100001890 Ga0068857_10000189015 132
134 3300005577 Ga0068857_100003336 Ga0068857_10000333613 132
135 3300005577 Ga0068857_101230842 Ga0068857_1012308421 132
136 3300005578 Ga0068854_100038150 Ga0068854_1000381502 132
137 3300005578 Ga0068854_100535342 Ga0068854_1005353422 132
138 3300005614 Ga0068856_100001186 Ga0068856_10000118623 132
139 3300005614 Ga0068856_100013056 Ga0068856_1000130568 132
140 3300005614 Ga0068856_100032697 Ga0068856_1000326972 132
141 3300005614 Ga0068856_100038258 Ga0068856_1000382585 132
142 3300005614 Ga0068856_100070817 Ga0068856_1000708172 132
143 3300005615 Ga0070702_100228540 Ga0070702_1002285401 132
144 3300005615 Ga0070702_100848396 Ga0070702_1008483961 132
145 3300005616 Ga0068852_100009585 Ga0068852_1000095854 132
146 3300005616 Ga0068852_100203208 Ga0068852_1002032082 132
147 3300005617 Ga0068859_100033660 Ga0068859_1000336604 132
148 3300005617 Ga0068859_100041212 Ga0068859_1000412124 132
149 3300005618 Ga0068864_100000347 Ga0068864_1000003475 132
150 3300005618 Ga0068864_100004216 Ga0068864_10000421611 132
151 3300005618 Ga0068864_101226741 Ga0068864_1012267412 132
152 3300005718 Ga0068866_10244525 Ga0068866_102445252 132
153 3300005719 Ga0068861_100730398 Ga0068861_1007303981 132
154 3300005834 Ga0068851_10128176 Ga0068851_101281762 132
155 3300005841 Ga0068863_100184209 Ga0068863_1001842092 132
156 3300005841 Ga0068863_100353500 Ga0068863_1003535002 132
157 3300005841 Ga0068863_100414945 Ga0068863_1004149452 132
158 3300005842 Ga0068858_100003905 Ga0068858_1000039059 132
159 3300005842 Ga0068858_100006670 Ga0068858_1000066708 132
160 3300005842 Ga0068858_100155750 Ga0068858_1001557501 132
161 3300005843 Ga0068860_100021893 Ga0068860_1000218936 132
162 3300005843 Ga0068860_100119519 Ga0068860_1001195193 132
163 3300005843 Ga0068860_100318740 Ga0068860_1003187401 132
164 3300005843 Ga0068860_100539901 Ga0068860_1005399012 132
165 3300005843 Ga0068860_100575194 Ga0068860_1005751942 132
166 3300005844 Ga0068862_100026666 Ga0068862_1000266663 132
167 3300005844 Ga0068862_100207702 Ga0068862_1002077022 132
168 3300005844 Ga0068862_100225783 Ga0068862_1002257832 132
169 3300005937 Ga0081455_10019817 Ga0081455_100198174 132
170 3300005937 Ga0081455_10514430 Ga0081455_105144302 132
171 3300005983 Ga0081540_1045540 Ga0081540_10455401 132
172 3300006028 Ga0070717_10038338 Ga0070717_100383383 132
173 3300006028 Ga0070717_10230632 Ga0070717_102306322 132
174 3300006163 Ga0070715_10627900 Ga0070715_106279001 132
175 3300006173 Ga0070716_100137851 Ga0070716_1001378512 132
176 3300006173 Ga0070716_100171015 Ga0070716_1001710152 132
177 3300006175 Ga0070712_100010608 Ga0070712_1000106082 132
178 3300006175 Ga0070712_100232026 Ga0070712_1002320261 132
179 3300006175 Ga0070712_100655557 Ga0070712_1006555572 132
180 3300006237 Ga0097621_100000133 Ga0097621_10000013316 132
181 3300006237 Ga0097621_100017370 Ga0097621_1000173702 132
182 3300006237 Ga0097621_100020479 Ga0097621_1000204793 132
183 3300006237 Ga0097621_100051862 Ga0097621_1000518624 132
184 3300006358 Ga0068871_100000448 Ga0068871_1000004486 132
185 3300006358 Ga0068871_100003253 Ga0068871_10000325310 132
186 3300006358 Ga0068871_100066191 Ga0068871_1000661914 132
187 3300006358 Ga0068871_100079138 Ga0068871_1000791383 132
188 3300006358 Ga0068871_100113343 Ga0068871_1001133432 132
189 3300006358 Ga0068871_100114893 Ga0068871_1001148934 132
190 3300006358 Ga0068871_100678711 Ga0068871_1006787112 132
191 3300006844 Ga0075428_100316630 Ga0075428_1003166302 132
192 3300006844 Ga0075428_100438915 Ga0075428_1004389151 132
193 3300006847 Ga0075431_102144044 Ga0075431_1021440442 132
194 3300006871 Ga0075434_100012876 Ga0075434_10001287611 132
195 3300006871 Ga0075434_100901338 Ga0075434_1009013382 132
196 3300006881 Ga0068865_100132421 Ga0068865_1001324213 132
197 3300006881 Ga0068865_100293756 Ga0068865_1002937562 132
198 3300006914 Ga0075436_100027872 Ga0075436_1000278725 132
199 3300006914 Ga0075436_101272081 Ga0075436_1012720811 132
200 3300006931 Ga0097620_100033662 Ga0097620_1000336623 132
201 3300006931 Ga0097620_100041212 Ga0097620_1000412121 132
202 3300007076 Ga0075435_100076717 Ga0075435_1000767172 132
203 3300009093 Ga0105240_10012666 Ga0105240_1001266612 132
204 3300009093 Ga0105240_10154863 Ga0105240_101548632 132
205 3300009093 Ga0105240_10163995 Ga0105240_101639952 132
206 3300009093 Ga0105240_10242833 Ga0105240_102428332 132
207 3300009094 Ga0111539_12037365 Ga0111539_120373651 132
208 3300009098 Ga0105245_10237128 Ga0105245_102371281 132
209 3300009098 Ga0105245_11248923 Ga0105245_112489231 132
210 3300009101 Ga0105247_10018885 Ga0105247_100188852 132
211 3300009101 Ga0105247_10728515 Ga0105247_107285151 132
212 3300009147 Ga0114129_10166153 Ga0114129_101661532 132
213 3300009147 Ga0114129_10200534 Ga0114129_102005341 132
214 3300009147 Ga0114129_10208891 Ga0114129_102088913 132
215 3300009147 Ga0114129_10835578 Ga0114129_108355782 132
216 3300009147 Ga0114129_11371604 Ga0114129_113716042 132
217 3300009148 Ga0105243_10114819 Ga0105243_101148192 132
218 3300009174 Ga0105241_10034189 Ga0105241_100341895 132
219 3300009174 Ga0105241_10041323 Ga0105241_100413232 132
220 3300009174 Ga0105241_10160210 Ga0105241_101602103 132
221 3300009174 Ga0105241_10176486 Ga0105241_101764862 132
222 3300009174 Ga0105241_10757446 Ga0105241_107574462 132
223 3300009176 Ga0105242_10575640 Ga0105242_105756402 132
224 3300009176 Ga0105242_11493029 Ga0105242_114930291 132
225 3300009177 Ga0105248_10026986 Ga0105248_100269862 132
226 3300009177 Ga0105248_10070839 Ga0105248_100708391 132
227 3300009545 Ga0105237_10049680 Ga0105237_100496802 132
228 3300009545 Ga0105237_10062101 Ga0105237_100621012 132
229 3300009545 Ga0105237_10300718 Ga0105237_103007182 132
230 3300009545 Ga0105237_10314293 Ga0105237_103142932 132
231 3300009545 Ga0105237_10571910 Ga0105237_105719102 132
232 3300009545 Ga0105237_10594889 Ga0105237_105948892 132
233 3300009545 Ga0105237_11154934 Ga0105237_111549341 132
234 3300009545 Ga0105237_11187055 Ga0105237_111870552 132
235 3300009545 Ga0105237_12591154 Ga0105237_125911541 132
236 3300009551 Ga0105238_10000368 Ga0105238_1000036817 132
237 3300009551 Ga0105238_10216908 Ga0105238_102169082 132
238 3300009553 Ga0105249_10140411 Ga0105249_101404113 132
239 3300010375 Ga0105239_10018608 Ga0105239_100186085 132
240 3300010375 Ga0105239_10616543 Ga0105239_106165432 132
241 3300011119 Ga0105246_10063510 Ga0105246_100635102 132
242 3300013100 Ga0157373_10021467 Ga0157373_100214675 132
243 3300013100 Ga0157373_10140135 Ga0157373_101401352 132
244 3300013100 Ga0157373_10162511 Ga0157373_101625112 132
245 3300013100 Ga0157373_10174529 Ga0157373_101745293 132
246 3300013100 Ga0157373_10426942 Ga0157373_104269422 132
247 3300013102 Ga0157371_10475769 Ga0157371_104757692 132
248 3300013102 Ga0157371_10527787 Ga0157371_105277872 132
249 3300013104 Ga0157370_10071517 Ga0157370_100715171 132
250 3300013104 Ga0157370_10314773 Ga0157370_103147731 132
251 3300013105 Ga0157369_10006808 Ga0157369_1000680810 132
252 3300013105 Ga0157369_10026425 Ga0157369_100264252 132
253 3300013105 Ga0157369_10035928 Ga0157369_100359286 132
254 3300013105 Ga0157369_10083788 Ga0157369_100837882 132
255 3300013105 Ga0157369_10706963 Ga0157369_107069631 132
256 3300013105 Ga0157369_11685427 Ga0157369_116854271 132
257 3300013296 Ga0157374_10000254 Ga0157374_1000025418 132
258 3300013296 Ga0157374_10000302 Ga0157374_1000030236 132
259 3300013296 Ga0157374_10001933 Ga0157374_1000193312 132
260 3300013296 Ga0157374_10022733 Ga0157374_100227332 132
261 3300013296 Ga0157374_10151785 Ga0157374_101517851 132
262 3300013297 Ga0157378_10000055 Ga0157378_1000005571 132
263 3300013297 Ga0157378_10000554 Ga0157378_100005542 132
264 3300013297 Ga0157378_10050680 Ga0157378_100506802 132
265 3300013297 Ga0157378_10197896 Ga0157378_101978962 132
266 3300013297 Ga0157378_10603933 Ga0157378_106039332 132
267 3300013306 Ga0163162_10312975 Ga0163162_103129752 132
268 3300013307 Ga0157372_10000661 Ga0157372_1000066111 132
269 3300013307 Ga0157372_10001984 Ga0157372_100019842 132
270 3300013307 Ga0157372_10002739 Ga0157372_100027391 132
271 3300013307 Ga0157372_10030721 Ga0157372_100307214 132
272 3300013307 Ga0157372_10037604 Ga0157372_100376046 132
273 3300013307 Ga0157372_10070218 Ga0157372_100702182 132
274 3300013307 Ga0157372_10075292 Ga0157372_100752924 132
275 3300013307 Ga0157372_10333653 Ga0157372_103336532 132
276 3300013307 Ga0157372_11745418 Ga0157372_117454181 132
277 3300013307 Ga0157372_11966979 Ga0157372_119669791 132
278 3300013308 Ga0157375_10236237 Ga0157375_102362372 132
279 3300014325 Ga0163163_10678328 Ga0163163_106783281 132
280 3300014325 Ga0163163_10876256 Ga0163163_108762562 132
281 3300014326 Ga0157380_10101877 Ga0157380_101018773 132
282 3300014745 Ga0157377_10123562 Ga0157377_101235622 132
283 3300014745 Ga0157377_10370357 Ga0157377_103703572 132
284 3300014968 Ga0157379_10037210 Ga0157379_100372102 132
285 3300014969 Ga0157376_10180109 Ga0157376_101801091 132
286 3300014969 Ga0157376_10626621 Ga0157376_106266212 132
287 3300021358 Ga0213873_10007662 Ga0213873_100076622 132
288 3300021388 Ga0213875_10118931 Ga0213875_101189312 132
289 3300025315 Ga0207697_10424993 Ga0207697_104249932 132
290 3300025321 Ga0207656_10138394 Ga0207656_101383942 132
291 3300025899 Ga0207642_10444759 Ga0207642_104447591 132
292 3300025901 Ga0207688_10402040 Ga0207688_104020402 132
293 3300025904 Ga0207647_10000903 Ga0207647_1000090313 132
294 3300025904 Ga0207647_10078719 Ga0207647_100787193 132
295 3300025905 Ga0207685_10148843 Ga0207685_101488432 132
296 3300025906 Ga0207699_10089305 Ga0207699_100893052 132
297 3300025906 Ga0207699_10139235 Ga0207699_101392353 132
298 3300025907 Ga0207645_10434367 Ga0207645_104343672 132
299 3300025910 Ga0207684_10014797 Ga0207684_100147972 132
300 3300025910 Ga0207684_10444213 Ga0207684_104442131 132
301 3300025911 Ga0207654_10008545 Ga0207654_100085455 132
302 3300025911 Ga0207654_10042499 Ga0207654_100424992 132
303 3300025911 Ga0207654_10833837 Ga0207654_108338371 132
304 3300025912 Ga0207707_10010028 Ga0207707_100100283 132
305 3300025912 Ga0207707_10016930 Ga0207707_100169304 132
306 3300025912 Ga0207707_10566349 Ga0207707_105663492 132
307 3300025913 Ga0207695_10023048 Ga0207695_100230482 132
308 3300025913 Ga0207695_10024582 Ga0207695_100245825 132
309 3300025913 Ga0207695_10219021 Ga0207695_102190211 132
310 3300025913 Ga0207695_10545590 Ga0207695_105455902 132
311 3300025913 Ga0207695_10875569 Ga0207695_108755691 132
312 3300025914 Ga0207671_10031806 Ga0207671_100318062 132
313 3300025914 Ga0207671_10051514 Ga0207671_100515141 132
314 3300025914 Ga0207671_10354978 Ga0207671_103549782 132
315 3300025914 Ga0207671_10456207 Ga0207671_104562071 132
316 3300025914 Ga0207671_10880263 Ga0207671_108802632 132
317 3300025914 Ga0207671_11255758 Ga0207671_112557581 132
318 3300025914 Ga0207671_11510401 Ga0207671_115104012 132
319 3300025915 Ga0207693_10147969 Ga0207693_101479692 132
320 3300025915 Ga0207693_10494367 Ga0207693_104943672 132
321 3300025915 Ga0207693_10778010 Ga0207693_107780102 132
322 3300025915 Ga0207693_10857051 Ga0207693_108570512 132
323 3300025916 Ga0207663_10463199 Ga0207663_104631991 132
324 3300025916 Ga0207663_10838494 Ga0207663_108384942 132
325 3300025916 Ga0207663_11021039 Ga0207663_110210391 132
326 3300025916 Ga0207663_11403540 Ga0207663_114035401 132
327 3300025917 Ga0207660_10037639 Ga0207660_100376393 132
328 3300025919 Ga0207657_10194614 Ga0207657_101946142 132
329 3300025920 Ga0207649_10085349 Ga0207649_100853491 132
330 3300025920 Ga0207649_11622856 Ga0207649_116228561 132
331 3300025921 Ga0207652_10799491 Ga0207652_107994911 132
332 3300025921 Ga0207652_11847023 Ga0207652_118470231 132
333 3300025922 Ga0207646_10000742 Ga0207646_1000074213 132
334 3300025922 Ga0207646_10001179 Ga0207646_1000117911 132
335 3300025923 Ga0207681_10152384 Ga0207681_101523842 132
336 3300025924 Ga0207694_10001767 Ga0207694_100017673 132
337 3300025924 Ga0207694_10071998 Ga0207694_100719982 132
338 3300025924 Ga0207694_10302177 Ga0207694_103021772 132
339 3300025925 Ga0207650_11128038 Ga0207650_111280381 132
340 3300025927 Ga0207687_11246365 Ga0207687_112463651 132
341 3300025928 Ga0207700_10084080 Ga0207700_100840802 132
342 3300025928 Ga0207700_10124979 Ga0207700_101249793 132
343 3300025928 Ga0207700_10184344 Ga0207700_101843442 132
344 3300025928 Ga0207700_10688629 Ga0207700_106886291 132
345 3300025928 Ga0207700_11823822 Ga0207700_118238221 132
346 3300025929 Ga0207664_10025845 Ga0207664_100258453 132
347 3300025929 Ga0207664_10054863 Ga0207664_100548632 132
348 3300025929 Ga0207664_10122714 Ga0207664_101227142 132
349 3300025929 Ga0207664_10332556 Ga0207664_103325562 132
350 3300025929 Ga0207664_11111057 Ga0207664_111110571 132
351 3300025931 Ga0207644_10125475 Ga0207644_101254751 132
352 3300025933 Ga0207706_10831108 Ga0207706_108311082 132
353 3300025934 Ga0207686_10750670 Ga0207686_107506702 132
354 3300025938 Ga0207704_10004764 Ga0207704_100047646 132
355 3300025938 Ga0207704_10159875 Ga0207704_101598751 132
356 3300025939 Ga0207665_10156576 Ga0207665_101565761 132
357 3300025939 Ga0207665_10307934 Ga0207665_103079341 132
358 3300025939 Ga0207665_10913377 Ga0207665_109133771 132
359 3300025940 Ga0207691_10282607 Ga0207691_102826072 132
360 3300025940 Ga0207691_10691597 Ga0207691_106915972 132
361 3300025941 Ga0207711_10062799 Ga0207711_100627993 132
362 3300025941 Ga0207711_11330862 Ga0207711_113308621 132
363 3300025942 Ga0207689_10000788 Ga0207689_1000078810 132
364 3300025942 Ga0207689_10338048 Ga0207689_103380481 132
365 3300025944 Ga0207661_10106361 Ga0207661_101063612 132
366 3300025944 Ga0207661_11031510 Ga0207661_110315101 132
367 3300025944 Ga0207661_11038252 Ga0207661_110382522 132
368 3300025945 Ga0207679_10062560 Ga0207679_100625603 132
369 3300025945 Ga0207679_10115941 Ga0207679_101159413 132
370 3300025949 Ga0207667_10010578 Ga0207667_100105785 132
371 3300025949 Ga0207667_10035751 Ga0207667_100357515 132
372 3300025949 Ga0207667_10127389 Ga0207667_101273892 132
373 3300025949 Ga0207667_10205283 Ga0207667_102052833 132
374 3300025949 Ga0207667_10339051 Ga0207667_103390511 132
375 3300025949 Ga0207667_11135505 Ga0207667_111355051 132
376 3300025960 Ga0207651_10319853 Ga0207651_103198532 132
377 3300025960 Ga0207651_10496908 Ga0207651_104969082 132
378 3300025961 Ga0207712_11524496 Ga0207712_115244961 132
379 3300025972 Ga0207668_10892149 Ga0207668_108921492 132
380 3300025981 Ga0207640_10037949 Ga0207640_100379493 132
381 3300025981 Ga0207640_10457662 Ga0207640_104576622 132
382 3300025981 Ga0207640_10492854 Ga0207640_104928541 132
383 3300025981 Ga0207640_10555446 Ga0207640_105554462 132
384 3300025986 Ga0207658_10209729 Ga0207658_102097292 132
385 3300026023 Ga0207677_10085004 Ga0207677_100850041 132
386 3300026023 Ga0207677_11318499 Ga0207677_113184991 132
387 3300026035 Ga0207703_10017439 Ga0207703_100174392 132
388 3300026035 Ga0207703_10025019 Ga0207703_100250194 132
389 3300026035 Ga0207703_10149566 Ga0207703_101495663 132
390 3300026041 Ga0207639_10029075 Ga0207639_100290753 132
391 3300026041 Ga0207639_10281803 Ga0207639_102818032 132
392 3300026041 Ga0207639_10389554 Ga0207639_103895541 132
393 3300026075 Ga0207708_11214608 Ga0207708_112146081 132
394 3300026078 Ga0207702_10001337 Ga0207702_1000133724 132
395 3300026078 Ga0207702_10002787 Ga0207702_100027874 132
396 3300026078 Ga0207702_10013220 Ga0207702_100132205 132
397 3300026078 Ga0207702_10429122 Ga0207702_104291222 132
398 3300026078 Ga0207702_10439410 Ga0207702_104394102 132
399 3300026088 Ga0207641_10337580 Ga0207641_103375802 132
400 3300026088 Ga0207641_10952717 Ga0207641_109527172 132
401 3300026089 Ga0207648_10002663 Ga0207648_1000266314 132
402 3300026089 Ga0207648_10050680 Ga0207648_100506804 132
403 3300026095 Ga0207676_10007557 Ga0207676_100075577 132
404 3300026095 Ga0207676_10041511 Ga0207676_100415113 132
405 3300026116 Ga0207674_10000514 Ga0207674_1000051438 132
406 3300026116 Ga0207674_10002979 Ga0207674_1000297918 132
407 3300026116 Ga0207674_11584276 Ga0207674_115842761 132
408 3300026118 Ga0207675_100048527 Ga0207675_1000485274 132
409 3300026121 Ga0207683_10344806 Ga0207683_103448062 132
410 3300026121 Ga0207683_11018176 Ga0207683_110181761 132
411 3300026142 Ga0207698_10100327 Ga0207698_101003271 132
412 3300026142 Ga0207698_10778502 Ga0207698_107785022 132
413 3300026142 Ga0207698_11098042 Ga0207698_110980421 132
414 3300028016 Ga0265354_1004140 Ga0265354_10041402 132
415 3300028036 Ga0265355_1002924 Ga0265355_10029241 132
416 3300028379 Ga0268266_10362459 Ga0268266_103624592 132
417 3300028380 Ga0268265_10100064 Ga0268265_101000642 132
418 3300028381 Ga0268264_10053356 Ga0268264_100533562 132
419 3300028381 Ga0268264_10075735 Ga0268264_100757352 132
420 3300028381 Ga0268264_10147562 Ga0268264_101475623 132
421 3300030878 Ga0265770_1006881 Ga0265770_10068811 132
422 3300030879 Ga0265765_1060876 Ga0265765_10608761 132
423 3300031090 Ga0265760_10002657 Ga0265760_100026574 132
424 3300031090 Ga0265760_10003777 Ga0265760_100037774 132
425 3300031090 Ga0265760_10062877 Ga0265760_100628771 132
426 3300031240 Ga0265320_10291436 Ga0265320_102914362 132
427 3300035086 Ga0373934_0137766 Ga0373934_0137766_431_829 132
428 3300035117 Ga0373953_0302855 Ga0373953_0302855_169_567 132
429 3300035121 Ga0373960_0101156 Ga0373960_0101156_462_860 132
430 3300035172 Ga0373955_0112953 Ga0373955_0112953_451_849 132
431 3300035691 Ga0373931_0080917 Ga0373931_0080917_209_631 132
432 3300035691 Ga0373931_0137390 Ga0373931_0137390_449_880 132
433 3300035691 Ga0373931_0296946 Ga0373931_0296946_288_686 132
434 3300035695 Ga0373927_0301073 Ga0373927_0301073_192_590 132
435 3300035725 Ga0373947_0073091 Ga0373947_0073091_1263_1661 132
436 3300036401 Ga0373937_1045288 Ga0373937_1045288_174_572 132
437 3300037068 Ga0373925_0581965 Ga0373925_0581965_237_635 132
438 3300038443 Ga0395901_0792401 Ga0395901_0792401_228_626 132
439 3300039437 Ga0436365_0306336 Ga0436365_0306336_304_702 132
440 3300039450 Ga0436363_0951780 Ga0436363_0951780_378_776 132
441 3300039453 Ga0436362_0814820 Ga0436362_0814820_2334_2732 132
442 3300041496 Ga0451839_0427549 Ga0451839_0427549_399_797 132
443 3300044673 Ga0453683_0018226 Ga0453683_0018226_1968_2375 132
444 3300044683 Ga0466965_0171362 Ga0466965_0171362_199_597 132
445 3300044684 Ga0466966_0348016 Ga0466966_0348016_371_769 132
446 3300044693 Ga0466961_0274994 Ga0466961_0274994_592_990 132
447 3300044694 Ga0466963_0040977 Ga0466963_0040977_186_584 132
448 3300044694 Ga0466963_0043209 Ga0466963_0043209_1644_2042 132
449 3300044706 Ga0466964_0048888 Ga0466964_0048888_473_871 132
450 3300044842 Ga0466957_0101837 Ga0466957_0101837_165_563 132
451 3300045049 Ga0466959_0255632 Ga0466959_0255632_371_769 132
452 3300045051 Ga0451576_0228681 Ga0451576_0228681_667_1065 132
453 3300045051 Ga0451576_0530996 Ga0451576_0530996_507_938 132
454 3300045051 Ga0451576_2075084 Ga0451576_2075084_97_495 132
455 3300045836 Ga0466958_0187435 Ga0466958_0187435_281_679 132
456 3300045836 Ga0466958_0578952 Ga0466958_0578952_162_560 132
457 3300045976 Ga0466967_0154733 Ga0466967_0154733_1020_1418 132
458 3300045976 Ga0466967_0355207 Ga0466967_0355207_862_1260 132
459 3300045976 Ga0466967_0370892 Ga0466967_0370892_117_515 132
460 3300046457 Ga0495590_0123115 Ga0495590_0123115_27_425 132
461 3300046472 Ga0495580_0058661 Ga0495580_0058661_1180_1590 132
462 3300046472 Ga0495580_0141720 Ga0495580_0141720_438_836 132
463 3300046516 Ga0495628_1004218 Ga0495628_1004218_141_563 132
464 3300046543 Ga0495645_0858414 Ga0495645_0858414_60_482 132
465 3300046559 Ga0495667_0604608 Ga0495667_0604608_263_661 132
466 3300046679 Ga0495623_0439141 Ga0495623_0439141_211_609 132
467 3300047319 Ga0495674_1493393 Ga0495674_1493393_43_465 132
468 3300048905 Ga0496102_0144152 Ga0496102_0144152_350_748 132
469 3300048905 Ga0496102_1247825 Ga0496102_1247825_225_623 132
470 3300048907 Ga0496104_0085166 Ga0496104_0085166_436_834 132
471 3300048907 Ga0496104_0124899 Ga0496104_0124899_879_1277 132
472 3300048907 Ga0496104_0967714 Ga0496104_0967714_165_563 132
473 3300048908 Ga0496105_1057301 Ga0496105_1057301_127_525 132
474 3300048915 Ga0496112_0009029 Ga0496112_0009029_7912_8310 132
475 3300048915 Ga0496112_0046687 Ga0496112_0046687_3274_3672 132
476 3300048915 Ga0496112_0058269 Ga0496112_0058269_613_1011 132
477 3300048915 Ga0496112_0306799 Ga0496112_0306799_760_1158 132
478 3300048916 Ga0496113_0312706 Ga0496113_0312706_157_555 132
479 3300048916 Ga0496113_0449744 Ga0496113_0449744_480_878 132
480 3300048918 Ga0496115_0304666 Ga0496115_0304666_198_596 132
481 3300049582 Ga0501048_0351777 Ga0501048_0351777_178_579 132
482 3300049586 Ga0501070_0966888 Ga0501070_0966888_187_588 132
483 3300049588 Ga0501072_0563667 Ga0501072_0563667_262_663 132
484 3300049707 Ga0501234_072702 Ga0501234_072702_61_459 132
485 3300049741 Ga0501079_0303252 Ga0501079_0303252_540_941 132
486 3300049824 Ga0501045_0293538 Ga0501045_0293538_144_545 132
487 3300050507 nmdc:mga05p37_32056_c1 nmdc:mga05p37_32056_c1_4358_4768 132
488 3300050507 nmdc:mga05p37_516684_c1 nmdc:mga05p37_516684_c1_182_580 132
489 3300050508 nmdc:mga09592_736586_c1 nmdc:mga09592_736586_c1_41_439 132
490 3300050510 nmdc:mga06r32_128516_c1 nmdc:mga06r32_128516_c1_339_737 132
491 3300050510 nmdc:mga06r32_717384_c1 nmdc:mga06r32_717384_c1_486_908 132
492 3300050511 nmdc:mga08y16_1598894_c1 nmdc:mga08y16_1598894_c1_112_510 132
493 3300050512 nmdc:mga0n895_22419_c1 nmdc:mga0n895_22419_c1_5022_5420 132
494 3300050513 nmdc:mga0rr50_31610_c1 nmdc:mga0rr50_31610_c1_1664_2062 132
495 3300050514 nmdc:mga08x19_1029084_c1 nmdc:mga08x19_1029084_c1_14_412 132
496 3300050514 nmdc:mga08x19_493360_c1 nmdc:mga08x19_493360_c1_14_412 132
497 3300053078 Ga0495612_0272049 Ga0495612_0272049_325_723 132
498 3300053087 Ga0500643_039824 Ga0500643_039824_973_1371 132
499 3300060353 Ga0501082_1478201 Ga0501082_1478201_127_534 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

32

117

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8617 5 129
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8428 5 129
6ymh-assembly1.cif.gz_AAA x-ray structure of the k72i, y129f, r133l, h199a quadruple mutant of pnp-oxidase from e. coli in complex with plp 0.809 16 130
1wv4-assembly1.cif.gz_B x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.8063 16 132
3db0-assembly1.cif.gz_B crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution 0.7893 7 130
ID Description Score Start End Superfamily
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8589 5 129 2.30.110.10
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8398 5 129 2.30.110.10
1wv4B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8063 16 132 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.771 6 132 2.30.110.10
2iabB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.765 7 131 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1F7MH41-F1-model_v4 PPOX class F420-dependent enzyme 0.9923 3 132 GO:0005829
GO:0016627
GO:0070967
AF-A0A4P6JNM2-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9909 1 131 GO:0005829
GO:0016627
GO:0070967
AF-A0A6L3AGA8-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9904 2 132 GO:0005829
GO:0016627
GO:0070967
AF-A0A2V7FNH3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase putative domain-containing protein 0.9868 5 132 GO:0016491
GO:0071949
AF-A0A1I5SCA5-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9854 3 132 GO:0005829
GO:0016627
GO:0070967

Feature Viewer

pLDDT pTM Quality
96.55 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map