F455359

General Info

Members Datasets Scaffolds Average Seq Length
499 281 485 140

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10263304|Ga0105240_102633042
Length 167
Sequence LSGEATTEYRHYWIPACAGMTSKSEYTMPRADFYLIDKPRFREQPLLLVCELVKRAFAAQQPTLILTRDHAQAEAIDELLWAFDEDAFIPHQLAGDDDDAGTAVLIVPPGVDTPDRPLVINLREGCASGQFQRVLEVVPADEAERTGSRERWSEYKRRGFELHKNDM

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
3 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
4 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
5 2734482264 Dyella sp. AD052 Isolate Unclassified
6 2738543009 Luteibacter sp. OK325 Isolate Unclassified
7 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
8 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
9 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
10 2919085039 Luteibacter sp. 1214 Isolate Unclassified
11 2919404418 Luteibacter sp. 3190 Isolate Unclassified
12 2941471342 Luteibacter sp. 621 Isolate Unclassified
13 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
14 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
104 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
109 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
182 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
183 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
184 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
189 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
279 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
280 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
281 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0.8
Isolates 2.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 0
Rhizoplane 2
Rhizosphere 81.16
Stem 0
Stem Tuber 0
Unclassified 10.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10031451 3300001989 Bacteria 1834
2 JGI24735J21928_10104510 3300002067 Bacteria 814
3 JGI24738J21930_10002028 3300002075 Bacteria 5432
4 JGI25156J39149_1003962 3300002705 Bacteria 4678
5 JGI25157J39369_1000231 3300002741 Bacteria 43846
6 JGI25157J39369_1003218 3300002741 Bacteria 3449
7 JGI25163J39215_1000591 3300002771 Bacteria 10190
8 JGI25164J39214_1000229 3300002772 Bacteria 43811
9 JGI25151J46595_10000048 3300003187 Bacteria 166842
10 JGI25165J46597_1000063 3300003214 Bacteria 205051
11 Ga0006562J51391_1037139 3300003578 Bacteria 13287
12 Ga0006562J51391_1037142 3300003578 Bacteria 12230
13 Ga0055538_1000399 3300003751 Bacteria 17488
14 Ga0055535_1000068 3300003761 Bacteria 115329
15 Ga0055542_1000090 3300003762 Bacteria 122550
16 Ga0055529_1000084 3300003763 Bacteria 143720
17 Ga0055529_1008925 3300003763 Bacteria 1326
18 Ga0055526_1000005 3300003771 Bacteria 344542
19 Ga0065165_1000405 3300005262 Bacteria 69154
20 Ga0070658_10003129 3300005327 Bacteria 13660
21 Ga0070658_10776506 3300005327 Bacteria 832
22 Ga0070676_10229181 3300005328 Bacteria 1231
23 Ga0070676_11162702 3300005328 Bacteria 585
24 Ga0070683_100009389 3300005329 Bacteria 8365
25 Ga0070683_101051933 3300005329 Bacteria 782
26 Ga0070670_100030184 3300005331 Bacteria 4669
27 Ga0070670_100832267 3300005331 Bacteria 834
28 Ga0070666_10000010 3300005335 Bacteria 264789
29 Ga0070666_10009766 3300005335 Bacteria 5998
30 Ga0070666_10130229 3300005335 Bacteria 1748
31 Ga0070666_10592139 3300005335 Bacteria 809
32 Ga0070682_100269304 3300005337 Bacteria 1236
33 Ga0068868_100411065 3300005338 Bacteria 1170
34 Ga0068868_101063192 3300005338 Bacteria 743
35 Ga0068868_101691458 3300005338 Bacteria 596
36 Ga0070689_100374982 3300005340 Bacteria 1198
37 Ga0070687_100793539 3300005343 Bacteria 670
38 Ga0070661_100043094 3300005344 Bacteria 3296
39 Ga0070661_100059304 3300005344 Bacteria 2806
40 Ga0070661_101026305 3300005344 Bacteria 685
41 Ga0070669_100043121 3300005353 Bacteria 3284
42 Ga0070669_100351410 3300005353 Bacteria 1197
43 Ga0070669_101754762 3300005353 Bacteria 541
44 Ga0070671_100142214 3300005355 Bacteria 2025
45 Ga0070674_100077765 3300005356 Bacteria 2363
46 Ga0070688_100603109 3300005365 Bacteria 841
47 Ga0070667_100030034 3300005367 Bacteria 4533
48 Ga0070667_100569759 3300005367 Bacteria 1042
49 Ga0070667_100746510 3300005367 Bacteria 907
50 Ga0070708_101419323 3300005445 Bacteria 647
51 Ga0070663_100466944 3300005455 Bacteria 1043
52 Ga0070663_100529108 3300005455 Bacteria 982
53 Ga0070681_10720395 3300005458 Bacteria 914
54 Ga0068867_100018425 3300005459 Bacteria 4962
55 Ga0070685_10002722 3300005466 Bacteria 9055
56 Ga0070685_10497195 3300005466 Bacteria 862
57 Ga0070684_100548772 3300005535 Bacteria 1072
58 Ga0070684_100885801 3300005535 Bacteria 836
59 Ga0068853_100009166 3300005539 Bacteria 7972
60 Ga0068853_100038729 3300005539 Bacteria 4062
61 Ga0068853_100063863 3300005539 Bacteria 3190
62 Ga0068853_100704291 3300005539 Bacteria 963
63 Ga0070672_100023622 3300005543 Bacteria 4535
64 Ga0070696_100007990 3300005546 Bacteria 7064
65 Ga0070693_100083515 3300005547 Bacteria 1909
66 Ga0070665_100018056 3300005548 Bacteria 7080
67 Ga0068855_100031911 3300005563 Bacteria 6288
68 Ga0068855_100090012 3300005563 Bacteria 3542
69 Ga0068855_100235164 3300005563 Bacteria 2049
70 Ga0068855_100503727 3300005563 Bacteria 1315
71 Ga0070664_100099568 3300005564 Bacteria 2527
72 Ga0068857_101533451 3300005577 Bacteria 650
73 Ga0068854_100136240 3300005578 Bacteria 1880
74 Ga0068854_100418379 3300005578 Bacteria 1113
75 Ga0068854_100483548 3300005578 Bacteria 1040
76 Ga0068854_100560470 3300005578 Bacteria 970
77 Ga0068856_100123182 3300005614 Bacteria 2595
78 Ga0068856_100250708 3300005614 Bacteria 1785
79 Ga0068856_101450455 3300005614 Bacteria 700
80 Ga0068852_100030539 3300005616 Bacteria 4437
81 Ga0068852_101033354 3300005616 Bacteria 841
82 Ga0068859_100216447 3300005617 Bacteria 2003
83 Ga0068859_101663637 3300005617 Bacteria 705
84 Ga0068859_102143091 3300005617 Bacteria 617
85 Ga0068864_100253558 3300005618 Bacteria 1634
86 Ga0068866_10283677 3300005718 Bacteria 1027
87 Ga0068851_10113023 3300005834 Bacteria 1452
88 Ga0068851_10222117 3300005834 Bacteria 1062
89 Ga0068851_10541244 3300005834 Bacteria 703
90 Ga0068863_100182168 3300005841 Bacteria 2016
91 Ga0068858_100143154 3300005842 Bacteria 2245
92 Ga0068858_100917176 3300005842 Bacteria 857
93 Ga0068860_100035575 3300005843 Bacteria 4776
94 Ga0068860_100071262 3300005843 Bacteria 3303
95 Ga0068860_100297550 3300005843 Bacteria 1580
96 Ga0068862_102352450 3300005844 Bacteria 544
97 Ga0075369_10069715 3300006186 Bacteria 1546
98 Ga0075366_10784052 3300006195 Bacteria 593
99 Ga0097621_100541453 3300006237 Bacteria 1059
100 Ga0068865_101392412 3300006881 Bacteria 626
101 Ga0097620_100216452 3300006931 Bacteria 2003
102 Ga0097620_101663678 3300006931 Bacteria 705
103 Ga0097620_102142474 3300006931 Bacteria 617
104 Ga0105250_10425649 3300009092 Bacteria 592
105 Ga0105240_10001018 3300009093 Bacteria 49968
106 Ga0105240_10087817 3300009093 Bacteria 3807
107 Ga0105240_10263304 3300009093 Bacteria 1988
108 Ga0105247_10001112 3300009101 Bacteria 20035
109 Ga0105243_11190053 3300009148 Bacteria 775
110 Ga0105243_11191082 3300009148 Bacteria 774
111 Ga0105241_10019696 3300009174 Bacteria 4979
112 Ga0105241_10038788 3300009174 Bacteria 3592
113 Ga0105241_10500597 3300009174 Bacteria 1083
114 Ga0105242_10182749 3300009176 Bacteria 1851
115 Ga0105237_10002033 3300009545 Bacteria 25718
116 Ga0105237_10043540 3300009545 Bacteria 4521
117 Ga0105237_10092667 3300009545 Bacteria 3011
118 Ga0105237_10152140 3300009545 Bacteria 2310
119 Ga0105238_10000044 3300009551 Bacteria 151485
120 Ga0105238_10010487 3300009551 Bacteria 9301
121 Ga0105238_10090236 3300009551 Bacteria 3052
122 Ga0105238_10092536 3300009551 Bacteria 3012
123 Ga0105238_10163017 3300009551 Bacteria 2205
124 Ga0105238_10536271 3300009551 Bacteria 1174
125 Ga0105249_10278869 3300009553 Bacteria 1668
126 Ga0105249_10499394 3300009553 Bacteria 1262
127 Ga0105239_10007944 3300010375 Bacteria 12127
128 Ga0105239_10008836 3300010375 Bacteria 11404
129 Ga0105239_10093812 3300010375 Bacteria 3314
130 Ga0105239_10117133 3300010375 Bacteria 2957
131 Ga0105239_10366505 3300010375 Bacteria 1628
132 Ga0105239_11746963 3300010375 Bacteria 720
133 Ga0105246_11570581 3300011119 Bacteria 621
134 Ga0157316_1056975 3300012510 Bacteria 555
135 Ga0157373_10195058 3300013100 Bacteria 1427
136 Ga0157371_10041200 3300013102 Bacteria 3296
137 Ga0157371_10074037 3300013102 Bacteria 2412
138 Ga0157370_10016512 3300013104 Bacteria 7470
139 Ga0157370_10046842 3300013104 Bacteria 4145
140 Ga0157370_10068476 3300013104 Bacteria 3354
141 Ga0157370_10186143 3300013104 Bacteria 1928
142 Ga0157370_10470394 3300013104 Bacteria 1155
143 Ga0157370_10531759 3300013104 Bacteria 1078
144 Ga0157369_10000001 3300013105 Bacteria 554908
145 Ga0157369_10005167 3300013105 Bacteria 15276
146 Ga0157369_10037014 3300013105 Bacteria 5345
147 Ga0157369_10188313 3300013105 Bacteria 2169
148 Ga0157369_10403657 3300013105 Bacteria 1418
149 Ga0157369_10500760 3300013105 Bacteria 1257
150 Ga0157378_10759466 3300013297 Bacteria 993
151 Ga0157378_10782093 3300013297 Bacteria 979
152 Ga0163162_10002334 3300013306 Bacteria 17809
153 Ga0163162_10399835 3300013306 Bacteria 1506
154 Ga0163162_10751278 3300013306 Bacteria 1094
155 Ga0157372_10000334 3300013307 Bacteria 51813
156 Ga0157372_10210999 3300013307 Bacteria 2250
157 Ga0157372_10301766 3300013307 Bacteria 1863
158 Ga0157372_10767188 3300013307 Bacteria 1121
159 Ga0157372_11166972 3300013307 Bacteria 890
160 Ga0157375_10129893 3300013308 Bacteria 2638
161 Ga0163163_10092207 3300014325 Bacteria 3044
162 Ga0157380_10198376 3300014326 Bacteria 1778
163 Ga0157380_10829666 3300014326 Bacteria 944
164 Ga0182008_10110894 3300014497 Bacteria 1360
165 Ga0182008_10398013 3300014497 Bacteria 739
166 Ga0157376_10016913 3300014969 Bacteria 5550
167 Ga0157376_10831081 3300014969 Bacteria 938
168 Ga0182006_1000031 3300015261 Bacteria 240055
169 Ga0182006_1001647 3300015261 Bacteria 13162
170 Ga0182007_10006478 3300015262 Bacteria 5022
171 Ga0182005_1000095 3300015265 Bacteria 66965
172 Ga0182005_1000424 3300015265 Bacteria 22547
173 Ga0182005_1002838 3300015265 Bacteria 6036
174 Ga0182005_1103700 3300015265 Bacteria 799
175 Ga0183369_1003 3300015685 Bacteria 726443
176 Ga0183361_11119 3300016635 Bacteria 1341
177 Ga0163161_10069048 3300017792 Bacteria 2583
178 Ga0163161_11065228 3300017792 Bacteria 693
179 Ga0206356_11785061 3300020070 Bacteria 1667
180 Ga0206354_10206202 3300020081 Bacteria 934
181 Ga0209435_103848 3300025206 Bacteria 1704
182 Ga0209760_100228 3300025207 Bacteria 24212
183 Ga0209784_100042 3300025224 Bacteria 218070
184 Ga0209672_109894 3300025228 Bacteria 1316
185 Ga0207427_100096 3300025231 Bacteria 123398
186 Ga0209437_100074 3300025233 Bacteria 300858
187 Ga0209258_100136 3300025242 Bacteria 169078
188 Ga0209646_1001322 3300025246 Bacteria 6902
189 Ga0209646_1004454 3300025246 Bacteria 2550
190 Ga0209026_1000072 3300025250 Bacteria 205447
191 Ga0209026_1002819 3300025250 Bacteria 6159
192 Ga0209148_1000036 3300025254 Bacteria 530505
193 Ga0209759_1000833 3300025256 Bacteria 24296
194 Ga0209759_1011879 3300025256 Bacteria 2443
195 Ga0209233_1000040 3300025261 Bacteria 530395
196 Ga0209455_1000071 3300025272 Bacteria 300858
197 Ga0209455_1001940 3300025272 Bacteria 8547
198 Ga0209758_1015808 3300025297 Bacteria 3880
199 Ga0209051_1005458 3300025303 Bacteria 7422
200 Ga0207656_10411464 3300025321 Bacteria 681
201 Ga0207696_1196624 3300025711 Bacteria 530
202 Ga0207710_10118242 3300025900 Bacteria 1264
203 Ga0207680_10000002 3300025903 Bacteria 1018646
204 Ga0207680_10004776 3300025903 Bacteria 6452
205 Ga0207680_10522032 3300025903 Bacteria 847
206 Ga0207680_10745781 3300025903 Bacteria 702
207 Ga0207647_10008613 3300025904 Bacteria 7300
208 Ga0207647_10025790 3300025904 Bacteria 3855
209 Ga0207647_10386502 3300025904 Bacteria 790
210 Ga0207645_10093054 3300025907 Bacteria 1939
211 Ga0207705_10003838 3300025909 Bacteria 11435
212 Ga0207705_10472434 3300025909 Bacteria 973
213 Ga0207654_10011245 3300025911 Bacteria 4562
214 Ga0207707_10257421 3300025912 Bacteria 1515
215 Ga0207707_10376058 3300025912 Bacteria 1222
216 Ga0207695_10000082 3300025913 Bacteria 284333
217 Ga0207695_10001153 3300025913 Bacteria 45794
218 Ga0207695_10001726 3300025913 Bacteria 34905
219 Ga0207695_10005034 3300025913 Bacteria 17748
220 Ga0207671_10002307 3300025914 Bacteria 20603
221 Ga0207671_10004076 3300025914 Bacteria 14148
222 Ga0207671_10014730 3300025914 Bacteria 6166
223 Ga0207671_10282053 3300025914 Bacteria 1310
224 Ga0207657_10011564 3300025919 Bacteria 8756
225 Ga0207657_10327967 3300025919 Bacteria 1209
226 Ga0207649_10003581 3300025920 Bacteria 8488
227 Ga0207649_10012978 3300025920 Bacteria 4643
228 Ga0207649_10296741 3300025920 Bacteria 1180
229 Ga0207649_10353327 3300025920 Bacteria 1088
230 Ga0207652_10010712 3300025921 Bacteria 7381
231 Ga0207694_10001235 3300025924 Bacteria 22135
232 Ga0207694_10003810 3300025924 Bacteria 11934
233 Ga0207694_10030528 3300025924 Bacteria 4116
234 Ga0207694_10065985 3300025924 Bacteria 2822
235 Ga0207694_10105266 3300025924 Bacteria 2239
236 Ga0207694_10117264 3300025924 Bacteria 2122
237 Ga0207694_10237322 3300025924 Bacteria 1490
238 Ga0207694_10357358 3300025924 Bacteria 1210
239 Ga0207659_10389562 3300025926 Bacteria 1163
240 Ga0207690_10574671 3300025932 Bacteria 918
241 Ga0207690_11177687 3300025932 Bacteria 640
242 Ga0207709_10689482 3300025935 Bacteria 816
243 Ga0207709_10794588 3300025935 Bacteria 763
244 Ga0207704_10994577 3300025938 Bacteria 709
245 Ga0207691_10001994 3300025940 Bacteria 19974
246 Ga0207711_11076299 3300025941 Bacteria 745
247 Ga0207661_10507298 3300025944 Bacteria 1102
248 Ga0207661_11623179 3300025944 Bacteria 591
249 Ga0207667_10003998 3300025949 Bacteria 18108
250 Ga0207667_10087611 3300025949 Bacteria 3220
251 Ga0207667_10335572 3300025949 Bacteria 1543
252 Ga0207667_11142678 3300025949 Bacteria 760
253 Ga0207651_10294064 3300025960 Bacteria 1348
254 Ga0207712_10165427 3300025961 Bacteria 1723
255 Ga0207712_10192322 3300025961 Bacteria 1611
256 Ga0207668_10278861 3300025972 Bacteria 1370
257 Ga0207668_10464936 3300025972 Bacteria 1082
258 Ga0207640_10087443 3300025981 Bacteria 2148
259 Ga0207640_10277611 3300025981 Bacteria 1314
260 Ga0207640_10398079 3300025981 Bacteria 1121
261 Ga0207658_10119117 3300025986 Bacteria 2101
262 Ga0207658_10226172 3300025986 Bacteria 1577
263 Ga0207658_10885597 3300025986 Bacteria 812
264 Ga0207677_10101390 3300026023 Bacteria 2119
265 Ga0207677_10978157 3300026023 Bacteria 766
266 Ga0207703_10346213 3300026035 Bacteria 1367
267 Ga0207703_10486925 3300026035 Bacteria 1156
268 Ga0207703_10643126 3300026035 Bacteria 1006
269 Ga0207703_11341185 3300026035 Bacteria 688
270 Ga0207639_10001104 3300026041 Bacteria 18320
271 Ga0207678_10019842 3300026067 Bacteria 5908
272 Ga0207678_10056061 3300026067 Bacteria 3394
273 Ga0207678_10387956 3300026067 Bacteria 1208
274 Ga0207702_10000107 3300026078 Bacteria 96024
275 Ga0207702_10118684 3300026078 Bacteria 2364
276 Ga0207641_10055796 3300026088 Bacteria 3355
277 Ga0207648_10050477 3300026089 Bacteria 3638
278 Ga0207674_10007061 3300026116 Bacteria 13127
279 Ga0207674_10656847 3300026116 Bacteria 1013
280 Ga0207683_10094771 3300026121 Bacteria 2661
281 Ga0207698_10320226 3300026142 Bacteria 1452
282 Ga0207698_10419223 3300026142 Bacteria 1284
283 Ga0207698_10511207 3300026142 Bacteria 1171
284 Ga0207698_10597034 3300026142 Bacteria 1088
285 Ga0209969_1004057 3300027360 Bacteria 2044
286 Ga0209995_1048973 3300027471 Bacteria 716
287 Ga0209982_1007389 3300027552 Bacteria 1606
288 Ga0209983_1002210 3300027665 Bacteria 4283
289 Ga0209971_1000293 3300027682 Bacteria 13984
290 Ga0209974_10045680 3300027876 Bacteria 1463
291 Ga0209974_10099113 3300027876 Bacteria 1017
292 Ga0268266_10000004 3300028379 Bacteria 1495817
293 Ga0268266_10336568 3300028379 Bacteria 1416
294 Ga0268265_10925974 3300028380 Bacteria 857
295 Ga0268265_12103843 3300028380 Bacteria 571
296 Ga0268264_10043071 3300028381 Bacteria 3739
297 Ga0268264_10260286 3300028381 Bacteria 1616
298 Ga0268264_10559883 3300028381 Bacteria 1122
299 Ga0307408_100579949 3300031548 Bacteria 994
300 Ga0316575_10112851 3300031665 Bacteria 1109
301 Ga0307413_10429579 3300031824 Bacteria 1043
302 Ga0307410_10962747 3300031852 Bacteria 734
303 Ga0307412_10001086 3300031911 Bacteria 15548
304 Ga0307412_11469493 3300031911 Bacteria 619
305 Ga0307416_100607213 3300032002 Bacteria 1174
306 Ga0307416_100683865 3300032002 Bacteria 1114
307 Ga0307414_10732301 3300032004 Bacteria 897
308 Ga0307414_12123653 3300032004 Bacteria 524
309 Ga0307415_100526341 3300032126 Bacteria 1039
310 Ga0307510_10003865 3300033180 Bacteria 17565
311 Ga0307510_10031101 3300033180 Bacteria 6036
312 Ga0373937_0773577 3300036401 Bacteria 908
313 Ga0395905_0123178 3300037471 Bacteria 2438
314 Ga0395905_0735092 3300037471 Bacteria 889
315 Ga0451793_1257150 3300041452 Bacteria 1131
316 Ga0451793_1706500 3300041452 Bacteria 5019
317 Ga0451806_638448 3300041462 Bacteria 755
318 Ga0451833_0373143 3300041491 Bacteria 866
319 Ga0451839_0100045 3300041496 Bacteria 506
320 Ga0451853_2562865 3300041512 Bacteria 840
321 Ga0439432_123890 3300042006 Bacteria 765
322 Ga0439449_0052953 3300042007 Bacteria 1500
323 Ga0450897_015413 3300042128 Bacteria 780
324 Ga0450899_043533 3300042135 Bacteria 565
325 Ga0451577_0287512 3300042876 Bacteria 1490
326 Ga0466972_0007808 3300044658 Bacteria 5368
327 Ga0466982_0000049 3300044672 Bacteria 36295
328 Ga0453684_0001318 3300044712 Bacteria 73362
329 Ga0466968_0018469 3300044735 Bacteria 2797
330 Ga0466970_0000107 3300044765 Bacteria 36696
331 Ga0466959_0001905 3300045049 Bacteria 13126
332 Ga0451576_0000628 3300045051 Bacteria 73375
333 Ga0451576_2239664 3300045051 Bacteria 561
334 Ga0466967_1957753 3300045976 Bacteria 583
335 Ga0495617_000120 3300046452 Bacteria 52244
336 Ga0495617_000348 3300046452 Bacteria 25506
337 Ga0495590_0033503 3300046457 Bacteria 1796
338 Ga0495638_0000498 3300046460 Bacteria 46678
339 Ga0495638_0006938 3300046460 Bacteria 8172
340 Ga0495638_0308317 3300046460 Bacteria 850
341 Ga0495650_0000703 3300046471 Bacteria 42860
342 Ga0495650_0001015 3300046471 Bacteria 31654
343 Ga0495605_0242540 3300046474 Bacteria 773
344 Ga0495584_0000688 3300046491 Bacteria 22464
345 Ga0495585_0000200 3300046492 Bacteria 62445
346 Ga0495585_0040680 3300046492 Bacteria 2609
347 Ga0495607_0000090 3300046501 Bacteria 94252
348 Ga0495607_0000244 3300046501 Bacteria 58158
349 Ga0495583_0005713 3300046506 Bacteria 8359
350 Ga0495606_0000218 3300046507 Bacteria 101645
351 Ga0495606_0001182 3300046507 Bacteria 36798
352 Ga0495606_0003799 3300046507 Bacteria 15691
353 Ga0495606_0046340 3300046507 Bacteria 2874
354 Ga0495606_0060559 3300046507 Bacteria 2424
355 Ga0495616_0000006 3300046513 Bacteria 234766
356 Ga0495616_0007706 3300046513 Bacteria 6435
357 Ga0495620_0000806 3300046515 Bacteria 19267
358 Ga0495620_0001426 3300046515 Bacteria 14315
359 Ga0495631_0000820 3300046518 Bacteria 19864
360 Ga0495631_0256275 3300046518 Bacteria 745
361 Ga0495632_0001202 3300046519 Bacteria 21984
362 Ga0495632_0005484 3300046519 Bacteria 8380
363 Ga0495632_0014200 3300046519 Bacteria 4515
364 Ga0495632_0323226 3300046519 Bacteria 681
365 Ga0495637_0004114 3300046520 Bacteria 7578
366 Ga0495648_0002324 3300046524 Bacteria 17692
367 Ga0495648_0291529 3300046524 Bacteria 768
368 Ga0495598_0049569 3300046537 Bacteria 1260
369 Ga0495609_0007830 3300046538 Bacteria 5287
370 Ga0495621_0053509 3300046539 Bacteria 1449
371 Ga0495622_0463564 3300046557 Bacteria 543
372 Ga0495668_0019485 3300046616 Bacteria 3909
373 Ga0495611_0000001 3300046648 Bacteria 2628469
374 Ga0495611_0000126 3300046648 Bacteria 53596
375 Ga0495625_0000200 3300046660 Bacteria 95445
376 Ga0495625_0012267 3300046660 Bacteria 6950
377 Ga0495625_0013566 3300046660 Bacteria 6538
378 Ga0495625_0084294 3300046660 Bacteria 2207
379 Ga0495659_0112645 3300046664 Bacteria 1064
380 Ga0495661_0004199 3300046665 Bacteria 10475
381 Ga0495658_0582675 3300046683 Bacteria 717
382 Ga0495670_0017452 3300046691 Bacteria 3532
383 Ga0495671_0000457 3300046692 Bacteria 32058
384 Ga0495649_0029432 3300046694 Bacteria 3037
385 Ga0495589_0000008 3300046794 Bacteria 266071
386 Ga0495660_0000129 3300046810 Bacteria 83044
387 Ga0495660_0000133 3300046810 Bacteria 81572
388 Ga0495672_0213061 3300047320 Bacteria 958
389 Ga0495683_0002369 3300047323 Bacteria 11433
390 Ga0495679_000004 3300047446 Bacteria 748056
391 Ga0495673_0000004 3300047469 Bacteria 1354526
392 Ga0495673_0000041 3300047469 Bacteria 296723
393 Ga0495673_0003178 3300047469 Bacteria 10979
394 Ga0495681_0055785 3300047470 Bacteria 1841
395 Ga0495686_0001461 3300047472 Bacteria 25728
396 Ga0495686_0002504 3300047472 Bacteria 17249
397 Ga0495686_0003220 3300047472 Bacteria 14363
398 Ga0495686_0036155 3300047472 Bacteria 3170
399 Ga0495615_0022747 3300048090 Bacteria 1429
400 Ga0496101_1228785 3300048904 Bacteria 587
401 Ga0496102_0468766 3300048905 Bacteria 1180
402 Ga0496104_0435350 3300048907 Bacteria 1223
403 Ga0496106_0001625 3300048909 Bacteria 16887
404 Ga0496107_1317127 3300048910 Bacteria 516
405 Ga0496109_0198204 3300048912 Bacteria 1888
406 Ga0496113_0068452 3300048916 Bacteria 2694
407 Ga0496116_0108572 3300048919 Bacteria 1638
408 Ga0496117_0011047 3300048920 Bacteria 8130
409 Ga0496117_0291626 3300048920 Bacteria 868
410 Ga0496117_0301581 3300048920 Bacteria 848
411 Ga0496118_0000184 3300048921 Bacteria 109873
412 Ga0496118_0009622 3300048921 Bacteria 9728
413 Ga0496118_0101045 3300048921 Bacteria 1949
414 Ga0496119_0018976 3300048922 Bacteria 5090
415 Ga0496120_0136130 3300048923 Bacteria 1252
416 Ga0496121_0001516 3300048924 Bacteria 38982
417 Ga0496121_0003543 3300048924 Bacteria 22104
418 Ga0496121_0013794 3300048924 Bacteria 8650
419 Ga0496121_0269998 3300048924 Bacteria 1169
420 Ga0496121_0308240 3300048924 Bacteria 1071
421 Ga0496121_0755599 3300048924 Bacteria 577
422 Ga0496122_0348472 3300048925 Bacteria 774
423 Ga0496123_0032853 3300048926 Bacteria 3746
424 Ga0496124_0000203 3300048927 Bacteria 117239
425 Ga0496124_0000410 3300048927 Bacteria 77367
426 Ga0496124_0146256 3300048927 Bacteria 1859
427 Ga0496124_0667825 3300048927 Bacteria 664
428 Ga0496125_0207659 3300048928 Bacteria 1275
429 Ga0496126_0032157 3300048929 Bacteria 4946
430 Ga0495678_000158 3300049459 Bacteria 81058
431 Ga0495682_0002070 3300049460 Bacteria 9803
432 Ga0495682_0002462 3300049460 Bacteria 8744
433 Ga0501031_0240247 3300049568 Bacteria 1178
434 Ga0501031_0540883 3300049568 Bacteria 750
435 Ga0501032_0050313 3300049569 Bacteria 2810
436 Ga0501032_0132666 3300049569 Bacteria 1642
437 Ga0501032_0244632 3300049569 Bacteria 1165
438 Ga0501032_0657790 3300049569 Bacteria 665
439 Ga0501032_0829507 3300049569 Bacteria 583
440 Ga0501033_0000430 3300049570 Bacteria 40189
441 Ga0501033_0074163 3300049570 Bacteria 2498
442 Ga0501034_0090605 3300049571 Bacteria 3056
443 Ga0501034_0901887 3300049571 Bacteria 772
444 Ga0501036_0348340 3300049572 Bacteria 1237
445 Ga0501036_0402219 3300049572 Bacteria 1142
446 Ga0501037_0557567 3300049573 Bacteria 773
447 Ga0501038_0047067 3300049574 Bacteria 3737
448 Ga0501038_0228688 3300049574 Bacteria 1481
449 Ga0501038_0408389 3300049574 Bacteria 1049
450 Ga0501038_0865300 3300049574 Bacteria 669
451 Ga0501039_0899479 3300049575 Bacteria 689
452 Ga0501042_0201658 3300049578 Bacteria 1434
453 Ga0501043_0069107 3300049579 Bacteria 2774
454 Ga0501043_0099531 3300049579 Bacteria 2285
455 Ga0501043_0122814 3300049579 Bacteria 2037
456 Ga0501043_0885757 3300049579 Bacteria 641
457 Ga0501046_0019926 3300049580 Bacteria 5554
458 Ga0501047_0099520 3300049581 Bacteria 2787
459 Ga0501047_0103246 3300049581 Bacteria 2731
460 Ga0501047_1075400 3300049581 Bacteria 618
461 Ga0501048_0139468 3300049582 Bacteria 1714
462 Ga0501070_0212318 3300049586 Bacteria 1588
463 Ga0501070_0387628 3300049586 Bacteria 1131
464 Ga0501070_0988530 3300049586 Bacteria 653
465 Ga0501073_0196943 3300049589 Bacteria 1393
466 Ga0501080_0154871 3300049742 Bacteria 2117
467 Ga0501035_0009267 3300049822 Bacteria 9153
468 Ga0501035_0020916 3300049822 Bacteria 6013
469 Ga0501035_0164942 3300049822 Bacteria 1916
470 Ga0501035_0279104 3300049822 Bacteria 1412
471 Ga0501035_0496002 3300049822 Bacteria 1005
472 Ga0501035_0724258 3300049822 Bacteria 800
473 Ga0501044_0136563 3300049823 Bacteria 2443
474 Ga0501044_0145462 3300049823 Bacteria 2356
475 Ga0501044_0191900 3300049823 Bacteria 2005
476 Ga0501044_0343291 3300049823 Bacteria 1414
477 Ga0501044_0455660 3300049823 Bacteria 1185
478 Ga0501044_0823967 3300049823 Bacteria 806
479 nmdc:mga0k408_857870_c1 3300050493 Bacteria 528
480 nmdc:mga0sz30_217682_c1 3300050516 Bacteria 849
481 Ga0500643_000140 3300053087 Bacteria 72592
482 Ga0500555_000251 3300053103 Bacteria 23542
483 Ga0500597_351409 3300053120 Bacteria 574
484 Ga0500652_289215 3300053131 Bacteria 637
485 Ga0500633_0008839 3300053160 Bacteria 2617

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100579949 Ga0307408_1005799492 127
2 3300031911 Ga0307412_11469493 Ga0307412_114694931 127
3 3300032002 Ga0307416_100607213 Ga0307416_1006072132 127
4 3300032126 Ga0307415_100526341 Ga0307415_1005263411 127
5 iso_pu_bacteria 2643221577 2643896955 135
6 iso_pu_bacteria 2894414249 2894415056 135
7 iso_pu_bacteria 2593339239 2595449923 136
8 iso_pu_bacteria 2687453130 2687581973 136
9 iso_pu_bacteria 2718218334 2721026178 136
10 iso_pu_bacteria 2734482264 2735833851 136
11 iso_pu_bacteria 2738543009 2739228838 136
12 iso_pu_bacteria 2842914999 2842918764 136
13 iso_pu_bacteria 2842918807 2842920218 136
14 iso_pu_bacteria 2919085039 2919087412 136
15 iso_pu_bacteria 2919404418 2919406469 136
16 iso_pu_bacteria 2941471342 2941474243 136
17 iso_pu_bacteria 2941489479 2941493453 136
18 iso_pu_bacteria 2953994433 2953995512 136
19 3300011119 Ga0105246_11570581 Ga0105246_115705812 139
20 3300015685 Ga0183369_1003 Ga0183369_1003264 139
21 3300016635 Ga0183361_11119 Ga0183361_111191 139
22 3300027360 Ga0209969_1004057 Ga0209969_10040572 139
23 3300027552 Ga0209982_1007389 Ga0209982_10073892 139
24 3300027665 Ga0209983_1002210 Ga0209983_10022104 139
25 3300027682 Ga0209971_1000293 Ga0209971_100029311 139
26 3300027876 Ga0209974_10045680 Ga0209974_100456802 139
27 3300027876 Ga0209974_10099113 Ga0209974_100991132 139
28 3300032004 Ga0307414_10732301 Ga0307414_107323011 139
29 3300042006 Ga0439432_123890 Ga0439432_123890_324_743 139
30 3300042876 Ga0451577_0287512 Ga0451577_0287512_357_785 139
31 3300044712 Ga0453684_0001318 Ga0453684_0001318_18275_18697 139
32 3300045051 Ga0451576_0000628 Ga0451576_0000628_18290_18712 139
33 3300049569 Ga0501032_0050313 Ga0501032_0050313_261_680 139
34 3300049569 Ga0501032_0132666 Ga0501032_0132666_1150_1569 139
35 3300049569 Ga0501032_0657790 Ga0501032_0657790_83_502 139
36 3300049574 Ga0501038_0228688 Ga0501038_0228688_446_865 139
37 3300049574 Ga0501038_0865300 Ga0501038_0865300_71_490 139
38 3300049580 Ga0501046_0019926 Ga0501046_0019926_3697_4116 139
39 3300049581 Ga0501047_0099520 Ga0501047_0099520_271_690 139
40 3300049822 Ga0501035_0496002 Ga0501035_0496002_462_881 139
41 3300049823 Ga0501044_0343291 Ga0501044_0343291_88_507 139
42 3300049823 Ga0501044_0455660 Ga0501044_0455660_538_957 139
43 3300001989 JGI24739J22299_10031451 JGI24739J22299_100314512 140
44 3300002067 JGI24735J21928_10104510 JGI24735J21928_101045102 140
45 3300002075 JGI24738J21930_10002028 JGI24738J21930_100020282 140
46 3300002705 JGI25156J39149_1003962 JGI25156J39149_10039622 140
47 3300002741 JGI25157J39369_1000231 JGI25157J39369_100023131 140
48 3300002741 JGI25157J39369_1003218 JGI25157J39369_10032182 140
49 3300002771 JGI25163J39215_1000591 JGI25163J39215_10005915 140
50 3300002772 JGI25164J39214_1000229 JGI25164J39214_10002296 140
51 3300003187 JGI25151J46595_10000048 JGI25151J46595_1000004857 140
52 3300003214 JGI25165J46597_1000063 JGI25165J46597_1000063186 140
53 3300003578 Ga0006562J51391_1037139 Ga0006562J51391_103713910 140
54 3300003578 Ga0006562J51391_1037142 Ga0006562J51391_10371422 140
55 3300003751 Ga0055538_1000399 Ga0055538_10003992 140
56 3300003761 Ga0055535_1000068 Ga0055535_10000686 140
57 3300003762 Ga0055542_1000090 Ga0055542_10000906 140
58 3300003763 Ga0055529_1000084 Ga0055529_10000846 140
59 3300003763 Ga0055529_1008925 Ga0055529_10089252 140
60 3300003771 Ga0055526_1000005 Ga0055526_100000577 140
61 3300005262 Ga0065165_1000405 Ga0065165_100040541 140
62 3300005327 Ga0070658_10003129 Ga0070658_100031298 140
63 3300005327 Ga0070658_10776506 Ga0070658_107765061 140
64 3300005328 Ga0070676_10229181 Ga0070676_102291811 140
65 3300005328 Ga0070676_11162702 Ga0070676_111627021 140
66 3300005329 Ga0070683_100009389 Ga0070683_1000093894 140
67 3300005329 Ga0070683_101051933 Ga0070683_1010519332 140
68 3300005331 Ga0070670_100030184 Ga0070670_1000301844 140
69 3300005331 Ga0070670_100832267 Ga0070670_1008322672 140
70 3300005335 Ga0070666_10000010 Ga0070666_1000001075 140
71 3300005335 Ga0070666_10009766 Ga0070666_100097663 140
72 3300005335 Ga0070666_10130229 Ga0070666_101302293 140
73 3300005335 Ga0070666_10592139 Ga0070666_105921391 140
74 3300005337 Ga0070682_100269304 Ga0070682_1002693042 140
75 3300005338 Ga0068868_100411065 Ga0068868_1004110652 140
76 3300005338 Ga0068868_101063192 Ga0068868_1010631922 140
77 3300005338 Ga0068868_101691458 Ga0068868_1016914581 140
78 3300005340 Ga0070689_100374982 Ga0070689_1003749822 140
79 3300005343 Ga0070687_100793539 Ga0070687_1007935391 140
80 3300005344 Ga0070661_100043094 Ga0070661_1000430942 140
81 3300005344 Ga0070661_100059304 Ga0070661_1000593042 140
82 3300005344 Ga0070661_101026305 Ga0070661_1010263051 140
83 3300005353 Ga0070669_100043121 Ga0070669_1000431212 140
84 3300005353 Ga0070669_100351410 Ga0070669_1003514102 140
85 3300005353 Ga0070669_101754762 Ga0070669_1017547621 140
86 3300005355 Ga0070671_100142214 Ga0070671_1001422142 140
87 3300005356 Ga0070674_100077765 Ga0070674_1000777652 140
88 3300005365 Ga0070688_100603109 Ga0070688_1006031092 140
89 3300005367 Ga0070667_100030034 Ga0070667_1000300344 140
90 3300005367 Ga0070667_100569759 Ga0070667_1005697591 140
91 3300005367 Ga0070667_100746510 Ga0070667_1007465101 140
92 3300005445 Ga0070708_101419323 Ga0070708_1014193231 140
93 3300005455 Ga0070663_100466944 Ga0070663_1004669441 140
94 3300005455 Ga0070663_100529108 Ga0070663_1005291081 140
95 3300005458 Ga0070681_10720395 Ga0070681_107203952 140
96 3300005459 Ga0068867_100018425 Ga0068867_1000184254 140
97 3300005466 Ga0070685_10002722 Ga0070685_100027224 140
98 3300005466 Ga0070685_10497195 Ga0070685_104971952 140
99 3300005535 Ga0070684_100548772 Ga0070684_1005487722 140
100 3300005535 Ga0070684_100885801 Ga0070684_1008858011 140
101 3300005539 Ga0068853_100009166 Ga0068853_10000916610 140
102 3300005539 Ga0068853_100038729 Ga0068853_1000387291 140
103 3300005539 Ga0068853_100063863 Ga0068853_1000638633 140
104 3300005539 Ga0068853_100704291 Ga0068853_1007042911 140
105 3300005543 Ga0070672_100023622 Ga0070672_1000236222 140
106 3300005546 Ga0070696_100007990 Ga0070696_1000079902 140
107 3300005547 Ga0070693_100083515 Ga0070693_1000835152 140
108 3300005548 Ga0070665_100018056 Ga0070665_1000180563 140
109 3300005563 Ga0068855_100031911 Ga0068855_1000319116 140
110 3300005563 Ga0068855_100090012 Ga0068855_1000900123 140
111 3300005563 Ga0068855_100235164 Ga0068855_1002351642 140
112 3300005563 Ga0068855_100503727 Ga0068855_1005037272 140
113 3300005564 Ga0070664_100099568 Ga0070664_1000995682 140
114 3300005577 Ga0068857_101533451 Ga0068857_1015334512 140
115 3300005578 Ga0068854_100136240 Ga0068854_1001362402 140
116 3300005578 Ga0068854_100418379 Ga0068854_1004183791 140
117 3300005578 Ga0068854_100483548 Ga0068854_1004835482 140
118 3300005578 Ga0068854_100560470 Ga0068854_1005604702 140
119 3300005614 Ga0068856_100123182 Ga0068856_1001231823 140
120 3300005614 Ga0068856_100250708 Ga0068856_1002507082 140
121 3300005614 Ga0068856_101450455 Ga0068856_1014504552 140
122 3300005616 Ga0068852_100030539 Ga0068852_1000305392 140
123 3300005616 Ga0068852_101033354 Ga0068852_1010333542 140
124 3300005617 Ga0068859_100216447 Ga0068859_1002164472 140
125 3300005617 Ga0068859_101663637 Ga0068859_1016636371 140
126 3300005617 Ga0068859_102143091 Ga0068859_1021430912 140
127 3300005618 Ga0068864_100253558 Ga0068864_1002535582 140
128 3300005718 Ga0068866_10283677 Ga0068866_102836771 140
129 3300005834 Ga0068851_10113023 Ga0068851_101130232 140
130 3300005834 Ga0068851_10222117 Ga0068851_102221172 140
131 3300005834 Ga0068851_10541244 Ga0068851_105412441 140
132 3300005841 Ga0068863_100182168 Ga0068863_1001821682 140
133 3300005842 Ga0068858_100143154 Ga0068858_1001431542 140
134 3300005842 Ga0068858_100917176 Ga0068858_1009171762 140
135 3300005843 Ga0068860_100035575 Ga0068860_1000355754 140
136 3300005843 Ga0068860_100071262 Ga0068860_1000712622 140
137 3300005843 Ga0068860_100297550 Ga0068860_1002975502 140
138 3300005844 Ga0068862_102352450 Ga0068862_1023524501 140
139 3300006186 Ga0075369_10069715 Ga0075369_100697151 140
140 3300006195 Ga0075366_10784052 Ga0075366_107840522 140
141 3300006237 Ga0097621_100541453 Ga0097621_1005414532 140
142 3300006881 Ga0068865_101392412 Ga0068865_1013924122 140
143 3300006931 Ga0097620_100216452 Ga0097620_1002164522 140
144 3300006931 Ga0097620_101663678 Ga0097620_1016636782 140
145 3300006931 Ga0097620_102142474 Ga0097620_1021424742 140
146 3300009092 Ga0105250_10425649 Ga0105250_104256492 140
147 3300009093 Ga0105240_10001018 Ga0105240_100010181 140
148 3300009093 Ga0105240_10087817 Ga0105240_100878172 140
149 3300009093 Ga0105240_10263304 Ga0105240_102633042 140
150 3300009101 Ga0105247_10001112 Ga0105247_1000111214 140
151 3300009148 Ga0105243_11190053 Ga0105243_111900532 140
152 3300009148 Ga0105243_11191082 Ga0105243_111910822 140
153 3300009174 Ga0105241_10019696 Ga0105241_100196962 140
154 3300009174 Ga0105241_10038788 Ga0105241_100387883 140
155 3300009174 Ga0105241_10500597 Ga0105241_105005971 140
156 3300009176 Ga0105242_10182749 Ga0105242_101827492 140
157 3300009545 Ga0105237_10002033 Ga0105237_1000203328 140
158 3300009545 Ga0105237_10043540 Ga0105237_100435404 140
159 3300009545 Ga0105237_10092667 Ga0105237_100926673 140
160 3300009545 Ga0105237_10152140 Ga0105237_101521402 140
161 3300009551 Ga0105238_10000044 Ga0105238_100000444 140
162 3300009551 Ga0105238_10010487 Ga0105238_100104876 140
163 3300009551 Ga0105238_10090236 Ga0105238_100902362 140
164 3300009551 Ga0105238_10092536 Ga0105238_100925362 140
165 3300009551 Ga0105238_10163017 Ga0105238_101630172 140
166 3300009551 Ga0105238_10536271 Ga0105238_105362711 140
167 3300009553 Ga0105249_10278869 Ga0105249_102788692 140
168 3300009553 Ga0105249_10499394 Ga0105249_104993942 140
169 3300010375 Ga0105239_10007944 Ga0105239_100079442 140
170 3300010375 Ga0105239_10008836 Ga0105239_100088363 140
171 3300010375 Ga0105239_10093812 Ga0105239_100938122 140
172 3300010375 Ga0105239_10117133 Ga0105239_101171332 140
173 3300010375 Ga0105239_10366505 Ga0105239_103665052 140
174 3300010375 Ga0105239_11746963 Ga0105239_117469632 140
175 3300012510 Ga0157316_1056975 Ga0157316_10569751 140
176 3300013100 Ga0157373_10195058 Ga0157373_101950582 140
177 3300013102 Ga0157371_10041200 Ga0157371_100412004 140
178 3300013102 Ga0157371_10074037 Ga0157371_100740372 140
179 3300013104 Ga0157370_10016512 Ga0157370_100165122 140
180 3300013104 Ga0157370_10046842 Ga0157370_100468426 140
181 3300013104 Ga0157370_10068476 Ga0157370_100684763 140
182 3300013104 Ga0157370_10186143 Ga0157370_101861432 140
183 3300013104 Ga0157370_10470394 Ga0157370_104703942 140
184 3300013104 Ga0157370_10531759 Ga0157370_105317591 140
185 3300013105 Ga0157369_10000001 Ga0157369_10000001330 140
186 3300013105 Ga0157369_10005167 Ga0157369_100051677 140
187 3300013105 Ga0157369_10037014 Ga0157369_100370144 140
188 3300013105 Ga0157369_10188313 Ga0157369_101883133 140
189 3300013105 Ga0157369_10403657 Ga0157369_104036572 140
190 3300013105 Ga0157369_10500760 Ga0157369_105007602 140
191 3300013297 Ga0157378_10759466 Ga0157378_107594662 140
192 3300013297 Ga0157378_10782093 Ga0157378_107820932 140
193 3300013306 Ga0163162_10002334 Ga0163162_100023349 140
194 3300013306 Ga0163162_10399835 Ga0163162_103998352 140
195 3300013306 Ga0163162_10751278 Ga0163162_107512782 140
196 3300013307 Ga0157372_10000334 Ga0157372_100003342 140
197 3300013307 Ga0157372_10210999 Ga0157372_102109992 140
198 3300013307 Ga0157372_10301766 Ga0157372_103017661 140
199 3300013307 Ga0157372_10767188 Ga0157372_107671882 140
200 3300013307 Ga0157372_11166972 Ga0157372_111669721 140
201 3300013308 Ga0157375_10129893 Ga0157375_101298932 140
202 3300014325 Ga0163163_10092207 Ga0163163_100922073 140
203 3300014326 Ga0157380_10198376 Ga0157380_101983762 140
204 3300014326 Ga0157380_10829666 Ga0157380_108296662 140
205 3300014497 Ga0182008_10110894 Ga0182008_101108942 140
206 3300014497 Ga0182008_10398013 Ga0182008_103980131 140
207 3300014969 Ga0157376_10016913 Ga0157376_100169134 140
208 3300014969 Ga0157376_10831081 Ga0157376_108310811 140
209 3300015261 Ga0182006_1000031 Ga0182006_1000031183 140
210 3300015261 Ga0182006_1001647 Ga0182006_10016473 140
211 3300015262 Ga0182007_10006478 Ga0182007_100064784 140
212 3300015265 Ga0182005_1000095 Ga0182005_10000953 140
213 3300015265 Ga0182005_1000424 Ga0182005_100042410 140
214 3300015265 Ga0182005_1002838 Ga0182005_10028382 140
215 3300015265 Ga0182005_1103700 Ga0182005_11037002 140
216 3300017792 Ga0163161_10069048 Ga0163161_100690482 140
217 3300017792 Ga0163161_11065228 Ga0163161_110652282 140
218 3300020070 Ga0206356_11785061 Ga0206356_117850612 140
219 3300020081 Ga0206354_10206202 Ga0206354_102062022 140
220 3300025206 Ga0209435_103848 Ga0209435_1038483 140
221 3300025207 Ga0209760_100228 Ga0209760_1002284 140
222 3300025224 Ga0209784_100042 Ga0209784_100042189 140
223 3300025228 Ga0209672_109894 Ga0209672_1098942 140
224 3300025231 Ga0207427_100096 Ga0207427_1000966 140
225 3300025233 Ga0209437_100074 Ga0209437_100074262 140
226 3300025242 Ga0209258_100136 Ga0209258_100136100 140
227 3300025246 Ga0209646_1001322 Ga0209646_10013225 140
228 3300025246 Ga0209646_1004454 Ga0209646_10044541 140
229 3300025250 Ga0209026_1000072 Ga0209026_10000726 140
230 3300025250 Ga0209026_1002819 Ga0209026_10028196 140
231 3300025254 Ga0209148_1000036 Ga0209148_1000036263 140
232 3300025256 Ga0209759_1000833 Ga0209759_100083314 140
233 3300025256 Ga0209759_1011879 Ga0209759_10118792 140
234 3300025261 Ga0209233_1000040 Ga0209233_1000040261 140
235 3300025272 Ga0209455_1000071 Ga0209455_1000071262 140
236 3300025272 Ga0209455_1001940 Ga0209455_10019402 140
237 3300025297 Ga0209758_1015808 Ga0209758_10158082 140
238 3300025303 Ga0209051_1005458 Ga0209051_10054586 140
239 3300025321 Ga0207656_10411464 Ga0207656_104114641 140
240 3300025711 Ga0207696_1196624 Ga0207696_11966241 140
241 3300025900 Ga0207710_10118242 Ga0207710_101182422 140
242 3300025903 Ga0207680_10000002 Ga0207680_10000002315 140
243 3300025903 Ga0207680_10004776 Ga0207680_100047764 140
244 3300025903 Ga0207680_10522032 Ga0207680_105220321 140
245 3300025903 Ga0207680_10745781 Ga0207680_107457811 140
246 3300025904 Ga0207647_10008613 Ga0207647_100086133 140
247 3300025904 Ga0207647_10025790 Ga0207647_100257902 140
248 3300025904 Ga0207647_10386502 Ga0207647_103865022 140
249 3300025907 Ga0207645_10093054 Ga0207645_100930542 140
250 3300025909 Ga0207705_10003838 Ga0207705_100038382 140
251 3300025909 Ga0207705_10472434 Ga0207705_104724341 140
252 3300025911 Ga0207654_10011245 Ga0207654_100112454 140
253 3300025912 Ga0207707_10257421 Ga0207707_102574212 140
254 3300025912 Ga0207707_10376058 Ga0207707_103760582 140
255 3300025913 Ga0207695_10000082 Ga0207695_10000082102 140
256 3300025913 Ga0207695_10001153 Ga0207695_1000115340 140
257 3300025913 Ga0207695_10001726 Ga0207695_1000172634 140
258 3300025913 Ga0207695_10005034 Ga0207695_1000503412 140
259 3300025914 Ga0207671_10002307 Ga0207671_1000230710 140
260 3300025914 Ga0207671_10004076 Ga0207671_100040762 140
261 3300025914 Ga0207671_10014730 Ga0207671_100147306 140
262 3300025914 Ga0207671_10282053 Ga0207671_102820534 140
263 3300025919 Ga0207657_10011564 Ga0207657_100115643 140
264 3300025919 Ga0207657_10327967 Ga0207657_103279672 140
265 3300025920 Ga0207649_10003581 Ga0207649_100035812 140
266 3300025920 Ga0207649_10012978 Ga0207649_100129783 140
267 3300025920 Ga0207649_10296741 Ga0207649_102967412 140
268 3300025920 Ga0207649_10353327 Ga0207649_103533272 140
269 3300025921 Ga0207652_10010712 Ga0207652_100107123 140
270 3300025924 Ga0207694_10001235 Ga0207694_1000123512 140
271 3300025924 Ga0207694_10003810 Ga0207694_100038109 140
272 3300025924 Ga0207694_10030528 Ga0207694_100305282 140
273 3300025924 Ga0207694_10065985 Ga0207694_100659854 140
274 3300025924 Ga0207694_10105266 Ga0207694_101052662 140
275 3300025924 Ga0207694_10117264 Ga0207694_101172642 140
276 3300025924 Ga0207694_10237322 Ga0207694_102373222 140
277 3300025924 Ga0207694_10357358 Ga0207694_103573582 140
278 3300025926 Ga0207659_10389562 Ga0207659_103895622 140
279 3300025932 Ga0207690_10574671 Ga0207690_105746712 140
280 3300025932 Ga0207690_11177687 Ga0207690_111776872 140
281 3300025935 Ga0207709_10689482 Ga0207709_106894822 140
282 3300025935 Ga0207709_10794588 Ga0207709_107945882 140
283 3300025938 Ga0207704_10994577 Ga0207704_109945771 140
284 3300025940 Ga0207691_10001994 Ga0207691_1000199415 140
285 3300025941 Ga0207711_11076299 Ga0207711_110762992 140
286 3300025944 Ga0207661_10507298 Ga0207661_105072982 140
287 3300025944 Ga0207661_11623179 Ga0207661_116231791 140
288 3300025949 Ga0207667_10003998 Ga0207667_1000399817 140
289 3300025949 Ga0207667_10087611 Ga0207667_100876113 140
290 3300025949 Ga0207667_10335572 Ga0207667_103355721 140
291 3300025949 Ga0207667_11142678 Ga0207667_111426782 140
292 3300025960 Ga0207651_10294064 Ga0207651_102940642 140
293 3300025961 Ga0207712_10165427 Ga0207712_101654272 140
294 3300025961 Ga0207712_10192322 Ga0207712_101923221 140
295 3300025972 Ga0207668_10278861 Ga0207668_102788613 140
296 3300025972 Ga0207668_10464936 Ga0207668_104649361 140
297 3300025981 Ga0207640_10087443 Ga0207640_100874432 140
298 3300025981 Ga0207640_10277611 Ga0207640_102776112 140
299 3300025981 Ga0207640_10398079 Ga0207640_103980792 140
300 3300025986 Ga0207658_10119117 Ga0207658_101191172 140
301 3300025986 Ga0207658_10226172 Ga0207658_102261722 140
302 3300025986 Ga0207658_10885597 Ga0207658_108855971 140
303 3300026023 Ga0207677_10101390 Ga0207677_101013902 140
304 3300026023 Ga0207677_10978157 Ga0207677_109781572 140
305 3300026035 Ga0207703_10346213 Ga0207703_103462132 140
306 3300026035 Ga0207703_10486925 Ga0207703_104869252 140
307 3300026035 Ga0207703_10643126 Ga0207703_106431262 140
308 3300026035 Ga0207703_11341185 Ga0207703_113411852 140
309 3300026041 Ga0207639_10001104 Ga0207639_1000110413 140
310 3300026067 Ga0207678_10019842 Ga0207678_100198422 140
311 3300026067 Ga0207678_10056061 Ga0207678_100560612 140
312 3300026067 Ga0207678_10387956 Ga0207678_103879562 140
313 3300026078 Ga0207702_10000107 Ga0207702_1000010758 140
314 3300026078 Ga0207702_10118684 Ga0207702_101186843 140
315 3300026088 Ga0207641_10055796 Ga0207641_100557962 140
316 3300026089 Ga0207648_10050477 Ga0207648_100504772 140
317 3300026116 Ga0207674_10007061 Ga0207674_1000706115 140
318 3300026116 Ga0207674_10656847 Ga0207674_106568472 140
319 3300026121 Ga0207683_10094771 Ga0207683_100947712 140
320 3300026142 Ga0207698_10320226 Ga0207698_103202262 140
321 3300026142 Ga0207698_10419223 Ga0207698_104192232 140
322 3300026142 Ga0207698_10511207 Ga0207698_105112072 140
323 3300026142 Ga0207698_10597034 Ga0207698_105970342 140
324 3300027471 Ga0209995_1048973 Ga0209995_10489732 140
325 3300028379 Ga0268266_10000004 Ga0268266_10000004313 140
326 3300028379 Ga0268266_10336568 Ga0268266_103365682 140
327 3300028380 Ga0268265_10925974 Ga0268265_109259742 140
328 3300028380 Ga0268265_12103843 Ga0268265_121038431 140
329 3300028381 Ga0268264_10043071 Ga0268264_100430713 140
330 3300028381 Ga0268264_10260286 Ga0268264_102602862 140
331 3300028381 Ga0268264_10559883 Ga0268264_105598832 140
332 3300031665 Ga0316575_10112851 Ga0316575_101128512 140
333 3300031824 Ga0307413_10429579 Ga0307413_104295792 140
334 3300031852 Ga0307410_10962747 Ga0307410_109627472 140
335 3300031911 Ga0307412_10001086 Ga0307412_100010862 140
336 3300032002 Ga0307416_100683865 Ga0307416_1006838652 140
337 3300032004 Ga0307414_12123653 Ga0307414_121236531 140
338 3300033180 Ga0307510_10003865 Ga0307510_100038655 140
339 3300033180 Ga0307510_10031101 Ga0307510_100311012 140
340 3300036401 Ga0373937_0773577 Ga0373937_0773577_329_754 140
341 3300037471 Ga0395905_0123178 Ga0395905_0123178_999_1421 140
342 3300037471 Ga0395905_0735092 Ga0395905_0735092_323_745 140
343 3300041452 Ga0451793_1257150 Ga0451793_1257150_608_1030 140
344 3300041452 Ga0451793_1706500 Ga0451793_1706500_4507_4929 140
345 3300041462 Ga0451806_638448 Ga0451806_638448_318_740 140
346 3300041491 Ga0451833_0373143 Ga0451833_0373143_188_610 140
347 3300041496 Ga0451839_0100045 Ga0451839_0100045_25_447 140
348 3300041512 Ga0451853_2562865 Ga0451853_2562865_192_614 140
349 3300042007 Ga0439449_0052953 Ga0439449_0052953_426_851 140
350 3300042128 Ga0450897_015413 Ga0450897_015413_204_626 140
351 3300042135 Ga0450899_043533 Ga0450899_043533_78_500 140
352 3300044658 Ga0466972_0007808 Ga0466972_0007808_4401_4823 140
353 3300044672 Ga0466982_0000049 Ga0466982_0000049_16595_17017 140
354 3300044735 Ga0466968_0018469 Ga0466968_0018469_526_948 140
355 3300044765 Ga0466970_0000107 Ga0466970_0000107_14908_15330 140
356 3300045049 Ga0466959_0001905 Ga0466959_0001905_5463_5885 140
357 3300045051 Ga0451576_2239664 Ga0451576_2239664_82_507 140
358 3300045976 Ga0466967_1957753 Ga0466967_1957753_101_523 140
359 3300046452 Ga0495617_000120 Ga0495617_000120_34570_34992 140
360 3300046452 Ga0495617_000348 Ga0495617_000348_21576_21998 140
361 3300046457 Ga0495590_0033503 Ga0495590_0033503_52_474 140
362 3300046460 Ga0495638_0000498 Ga0495638_0000498_35731_36153 140
363 3300046460 Ga0495638_0006938 Ga0495638_0006938_327_749 140
364 3300046460 Ga0495638_0308317 Ga0495638_0308317_292_714 140
365 3300046471 Ga0495650_0000703 Ga0495650_0000703_35907_36329 140
366 3300046471 Ga0495650_0001015 Ga0495650_0001015_15469_15891 140
367 3300046474 Ga0495605_0242540 Ga0495605_0242540_94_516 140
368 3300046491 Ga0495584_0000688 Ga0495584_0000688_14061_14483 140
369 3300046492 Ga0495585_0000200 Ga0495585_0000200_60434_60856 140
370 3300046492 Ga0495585_0040680 Ga0495585_0040680_393_815 140
371 3300046501 Ga0495607_0000090 Ga0495607_0000090_48056_48478 140
372 3300046501 Ga0495607_0000244 Ga0495607_0000244_21929_22351 140
373 3300046506 Ga0495583_0005713 Ga0495583_0005713_6832_7254 140
374 3300046507 Ga0495606_0000218 Ga0495606_0000218_63935_64357 140
375 3300046507 Ga0495606_0001182 Ga0495606_0001182_34822_35244 140
376 3300046507 Ga0495606_0003799 Ga0495606_0003799_206_628 140
377 3300046507 Ga0495606_0046340 Ga0495606_0046340_869_1291 140
378 3300046507 Ga0495606_0060559 Ga0495606_0060559_1271_1693 140
379 3300046513 Ga0495616_0000006 Ga0495616_0000006_198754_199176 140
380 3300046513 Ga0495616_0007706 Ga0495616_0007706_1453_1875 140
381 3300046515 Ga0495620_0000806 Ga0495620_0000806_1563_1985 140
382 3300046515 Ga0495620_0001426 Ga0495620_0001426_2816_3238 140
383 3300046518 Ga0495631_0000820 Ga0495631_0000820_17853_18275 140
384 3300046518 Ga0495631_0256275 Ga0495631_0256275_29_451 140
385 3300046519 Ga0495632_0001202 Ga0495632_0001202_19945_20367 140
386 3300046519 Ga0495632_0005484 Ga0495632_0005484_1577_1999 140
387 3300046519 Ga0495632_0014200 Ga0495632_0014200_1351_1773 140
388 3300046519 Ga0495632_0323226 Ga0495632_0323226_117_539 140
389 3300046520 Ga0495637_0004114 Ga0495637_0004114_6100_6522 140
390 3300046524 Ga0495648_0002324 Ga0495648_0002324_17194_17616 140
391 3300046524 Ga0495648_0291529 Ga0495648_0291529_313_735 140
392 3300046537 Ga0495598_0049569 Ga0495598_0049569_319_741 140
393 3300046538 Ga0495609_0007830 Ga0495609_0007830_3651_4073 140
394 3300046539 Ga0495621_0053509 Ga0495621_0053509_595_1017 140
395 3300046557 Ga0495622_0463564 Ga0495622_0463564_39_467 140
396 3300046616 Ga0495668_0019485 Ga0495668_0019485_1592_2014 140
397 3300046648 Ga0495611_0000001 Ga0495611_0000001_2551766_2552188 140
398 3300046648 Ga0495611_0000126 Ga0495611_0000126_17810_18232 140
399 3300046660 Ga0495625_0000200 Ga0495625_0000200_18945_19367 140
400 3300046660 Ga0495625_0012267 Ga0495625_0012267_1212_1634 140
401 3300046660 Ga0495625_0013566 Ga0495625_0013566_1830_2252 140
402 3300046660 Ga0495625_0084294 Ga0495625_0084294_217_639 140
403 3300046664 Ga0495659_0112645 Ga0495659_0112645_114_536 140
404 3300046665 Ga0495661_0004199 Ga0495661_0004199_271_693 140
405 3300046683 Ga0495658_0582675 Ga0495658_0582675_67_492 140
406 3300046691 Ga0495670_0017452 Ga0495670_0017452_1576_1998 140
407 3300046692 Ga0495671_0000457 Ga0495671_0000457_16964_17386 140
408 3300046694 Ga0495649_0029432 Ga0495649_0029432_295_717 140
409 3300046794 Ga0495589_0000008 Ga0495589_0000008_75967_76389 140
410 3300046810 Ga0495660_0000129 Ga0495660_0000129_62500_62922 140
411 3300046810 Ga0495660_0000133 Ga0495660_0000133_18743_19165 140
412 3300047320 Ga0495672_0213061 Ga0495672_0213061_477_902 140
413 3300047323 Ga0495683_0002369 Ga0495683_0002369_5075_5497 140
414 3300047446 Ga0495679_000004 Ga0495679_000004_671455_671877 140
415 3300047469 Ga0495673_0000004 Ga0495673_0000004_487969_488391 140
416 3300047469 Ga0495673_0000041 Ga0495673_0000041_100792_101214 140
417 3300047469 Ga0495673_0003178 Ga0495673_0003178_1705_2127 140
418 3300047470 Ga0495681_0055785 Ga0495681_0055785_178_600 140
419 3300047472 Ga0495686_0001461 Ga0495686_0001461_20836_21258 140
420 3300047472 Ga0495686_0002504 Ga0495686_0002504_15535_15957 140
421 3300047472 Ga0495686_0003220 Ga0495686_0003220_12387_12809 140
422 3300047472 Ga0495686_0036155 Ga0495686_0036155_77_499 140
423 3300048090 Ga0495615_0022747 Ga0495615_0022747_315_737 140
424 3300048904 Ga0496101_1228785 Ga0496101_1228785_143_565 140
425 3300048905 Ga0496102_0468766 Ga0496102_0468766_563_985 140
426 3300048907 Ga0496104_0435350 Ga0496104_0435350_758_1180 140
427 3300048909 Ga0496106_0001625 Ga0496106_0001625_166_588 140
428 3300048910 Ga0496107_1317127 Ga0496107_1317127_25_447 140
429 3300048912 Ga0496109_0198204 Ga0496109_0198204_126_548 140
430 3300048916 Ga0496113_0068452 Ga0496113_0068452_1853_2275 140
431 3300048919 Ga0496116_0108572 Ga0496116_0108572_708_1130 140
432 3300048920 Ga0496117_0011047 Ga0496117_0011047_7625_8047 140
433 3300048920 Ga0496117_0291626 Ga0496117_0291626_117_539 140
434 3300048920 Ga0496117_0301581 Ga0496117_0301581_238_660 140
435 3300048921 Ga0496118_0000184 Ga0496118_0000184_29411_29833 140
436 3300048921 Ga0496118_0009622 Ga0496118_0009622_3434_3856 140
437 3300048921 Ga0496118_0101045 Ga0496118_0101045_686_1108 140
438 3300048922 Ga0496119_0018976 Ga0496119_0018976_4584_5006 140
439 3300048923 Ga0496120_0136130 Ga0496120_0136130_141_563 140
440 3300048924 Ga0496121_0001516 Ga0496121_0001516_1552_1974 140
441 3300048924 Ga0496121_0003543 Ga0496121_0003543_20126_20548 140
442 3300048924 Ga0496121_0013794 Ga0496121_0013794_6925_7350 140
443 3300048924 Ga0496121_0269998 Ga0496121_0269998_94_516 140
444 3300048924 Ga0496121_0308240 Ga0496121_0308240_255_677 140
445 3300048924 Ga0496121_0755599 Ga0496121_0755599_44_466 140
446 3300048925 Ga0496122_0348472 Ga0496122_0348472_287_709 140
447 3300048926 Ga0496123_0032853 Ga0496123_0032853_3032_3454 140
448 3300048927 Ga0496124_0000203 Ga0496124_0000203_779_1201 140
449 3300048927 Ga0496124_0000410 Ga0496124_0000410_267_689 140
450 3300048927 Ga0496124_0146256 Ga0496124_0146256_191_613 140
451 3300048927 Ga0496124_0667825 Ga0496124_0667825_147_569 140
452 3300048928 Ga0496125_0207659 Ga0496125_0207659_155_577 140
453 3300048929 Ga0496126_0032157 Ga0496126_0032157_2422_2844 140
454 3300049459 Ga0495678_000158 Ga0495678_000158_64075_64497 140
455 3300049460 Ga0495682_0002070 Ga0495682_0002070_9153_9575 140
456 3300049460 Ga0495682_0002462 Ga0495682_0002462_3792_4214 140
457 3300049568 Ga0501031_0240247 Ga0501031_0240247_595_1017 140
458 3300049568 Ga0501031_0540883 Ga0501031_0540883_82_504 140
459 3300049569 Ga0501032_0244632 Ga0501032_0244632_104_526 140
460 3300049569 Ga0501032_0829507 Ga0501032_0829507_103_525 140
461 3300049570 Ga0501033_0000430 Ga0501033_0000430_32340_32762 140
462 3300049570 Ga0501033_0074163 Ga0501033_0074163_2041_2463 140
463 3300049571 Ga0501034_0090605 Ga0501034_0090605_84_506 140
464 3300049571 Ga0501034_0901887 Ga0501034_0901887_240_665 140
465 3300049572 Ga0501036_0348340 Ga0501036_0348340_665_1087 140
466 3300049572 Ga0501036_0402219 Ga0501036_0402219_74_496 140
467 3300049573 Ga0501037_0557567 Ga0501037_0557567_162_584 140
468 3300049574 Ga0501038_0047067 Ga0501038_0047067_3140_3562 140
469 3300049574 Ga0501038_0408389 Ga0501038_0408389_617_1039 140
470 3300049575 Ga0501039_0899479 Ga0501039_0899479_95_517 140
471 3300049578 Ga0501042_0201658 Ga0501042_0201658_109_531 140
472 3300049579 Ga0501043_0069107 Ga0501043_0069107_244_666 140
473 3300049579 Ga0501043_0099531 Ga0501043_0099531_319_741 140
474 3300049579 Ga0501043_0122814 Ga0501043_0122814_154_576 140
475 3300049579 Ga0501043_0885757 Ga0501043_0885757_34_465 140
476 3300049581 Ga0501047_0103246 Ga0501047_0103246_131_553 140
477 3300049581 Ga0501047_1075400 Ga0501047_1075400_54_485 140
478 3300049582 Ga0501048_0139468 Ga0501048_0139468_592_1014 140
479 3300049586 Ga0501070_0212318 Ga0501070_0212318_557_979 140
480 3300049586 Ga0501070_0387628 Ga0501070_0387628_73_495 140
481 3300049586 Ga0501070_0988530 Ga0501070_0988530_167_589 140
482 3300049589 Ga0501073_0196943 Ga0501073_0196943_876_1298 140
483 3300049742 Ga0501080_0154871 Ga0501080_0154871_1620_2042 140
484 3300049822 Ga0501035_0009267 Ga0501035_0009267_926_1348 140
485 3300049822 Ga0501035_0020916 Ga0501035_0020916_5173_5595 140
486 3300049822 Ga0501035_0164942 Ga0501035_0164942_896_1318 140
487 3300049822 Ga0501035_0279104 Ga0501035_0279104_74_496 140
488 3300049822 Ga0501035_0724258 Ga0501035_0724258_133_555 140
489 3300049823 Ga0501044_0136563 Ga0501044_0136563_265_687 140
490 3300049823 Ga0501044_0145462 Ga0501044_0145462_830_1252 140
491 3300049823 Ga0501044_0191900 Ga0501044_0191900_1130_1552 140
492 3300049823 Ga0501044_0823967 Ga0501044_0823967_128_550 140
493 3300050493 nmdc:mga0k408_857870_c1 nmdc:mga0k408_857870_c1_22_444 140
494 3300050516 nmdc:mga0sz30_217682_c1 nmdc:mga0sz30_217682_c1_281_703 140
495 3300053087 Ga0500643_000140 Ga0500643_000140_50385_50807 140
496 3300053103 Ga0500555_000251 Ga0500555_000251_1341_1763 140
497 3300053120 Ga0500597_351409 Ga0500597_351409_27_455 140
498 3300053131 Ga0500652_289215 Ga0500652_289215_194_616 140
499 3300053160 Ga0500633_0008839 Ga0500633_0008839_1670_2092 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04364

DNA_pol3_chi

DNA polymerase III chi subunit, HolC

28

163

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.9106 3 140
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.8921 3 140
4ern-assembly1.cif.gz_A crystal structure of the c-terminal domain of human xpb/ercc-3 excision repair protein at 1.80 a 0.7196 2 140
4c30-assembly1.cif.gz_A crystal structure of deinococcus radiodurans uvrd in complex with dna, form 2 0.7161 3 68
4ern-assembly1.cif.gz_A crystal structure of the c-terminal domain of human xpb/ercc-3 excision repair protein at 1.80 a 0.7105 2 140
ID Description Score Start End Superfamily
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.9004 1 140 3.40.50.10110
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.8944 1 140 3.40.50.10110
af_A0A140LFS6_48_320_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8104 16 82 3.40.50.300
af_Q12039_8_270_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7663 3 58 3.40.50.300
af_Q59MW2_423_606_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7481 15 140 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A534AFP5-F1-model_v4 DNA polymerase III subunit chi 0.9927 1 140 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-Q4VJV4-F1-model_v4 HolC 0.9801 17 128 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A1B3WB96-F1-model_v4 DNA polymerase III subunit chi 0.978 20 140 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-Q4VJV1-F1-model_v4 HolC 0.9736 23 128 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-T0YM01-F1-model_v4 DNA polymerase III chi subunit, HolC (EC 2.7.7.7) 0.9627 46 140 GO:0003677
GO:0003887
GO:0006260
GO:0032298

Feature Viewer

pLDDT pTM Quality
94 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map