F455359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 499 | 281 | 485 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10263304|Ga0105240_102633042 |
| Length | 167 |
| Sequence | LSGEATTEYRHYWIPACAGMTSKSEYTMPRADFYLIDKPRFREQPLLLVCELVKRAFAAQQPTLILTRDHAQAEAIDELLWAFDEDAFIPHQLAGDDDDAGTAVLIVPPGVDTPDRPLVINLREGCASGQFQRVLEVVPADEAERTGSRERWSEYKRRGFELHKNDM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 2 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 3 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 4 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 5 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 6 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 7 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 8 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 9 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 10 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 11 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 12 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 13 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 14 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 19 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 20 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 21 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 25 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 104 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 184 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 185 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 186 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 187 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 188 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 189 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 192 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 251 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 252 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 276 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 277 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 278 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 279 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 280 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 281 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.39 |
| Metatranscriptomes | 0.8 |
| Isolates | 2.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.41 |
| Nodule | 0 |
| Rhizoplane | 2 |
| Rhizosphere | 81.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10031451 | 3300001989 | Bacteria | 1834 |
| 2 | JGI24735J21928_10104510 | 3300002067 | Bacteria | 814 |
| 3 | JGI24738J21930_10002028 | 3300002075 | Bacteria | 5432 |
| 4 | JGI25156J39149_1003962 | 3300002705 | Bacteria | 4678 |
| 5 | JGI25157J39369_1000231 | 3300002741 | Bacteria | 43846 |
| 6 | JGI25157J39369_1003218 | 3300002741 | Bacteria | 3449 |
| 7 | JGI25163J39215_1000591 | 3300002771 | Bacteria | 10190 |
| 8 | JGI25164J39214_1000229 | 3300002772 | Bacteria | 43811 |
| 9 | JGI25151J46595_10000048 | 3300003187 | Bacteria | 166842 |
| 10 | JGI25165J46597_1000063 | 3300003214 | Bacteria | 205051 |
| 11 | Ga0006562J51391_1037139 | 3300003578 | Bacteria | 13287 |
| 12 | Ga0006562J51391_1037142 | 3300003578 | Bacteria | 12230 |
| 13 | Ga0055538_1000399 | 3300003751 | Bacteria | 17488 |
| 14 | Ga0055535_1000068 | 3300003761 | Bacteria | 115329 |
| 15 | Ga0055542_1000090 | 3300003762 | Bacteria | 122550 |
| 16 | Ga0055529_1000084 | 3300003763 | Bacteria | 143720 |
| 17 | Ga0055529_1008925 | 3300003763 | Bacteria | 1326 |
| 18 | Ga0055526_1000005 | 3300003771 | Bacteria | 344542 |
| 19 | Ga0065165_1000405 | 3300005262 | Bacteria | 69154 |
| 20 | Ga0070658_10003129 | 3300005327 | Bacteria | 13660 |
| 21 | Ga0070658_10776506 | 3300005327 | Bacteria | 832 |
| 22 | Ga0070676_10229181 | 3300005328 | Bacteria | 1231 |
| 23 | Ga0070676_11162702 | 3300005328 | Bacteria | 585 |
| 24 | Ga0070683_100009389 | 3300005329 | Bacteria | 8365 |
| 25 | Ga0070683_101051933 | 3300005329 | Bacteria | 782 |
| 26 | Ga0070670_100030184 | 3300005331 | Bacteria | 4669 |
| 27 | Ga0070670_100832267 | 3300005331 | Bacteria | 834 |
| 28 | Ga0070666_10000010 | 3300005335 | Bacteria | 264789 |
| 29 | Ga0070666_10009766 | 3300005335 | Bacteria | 5998 |
| 30 | Ga0070666_10130229 | 3300005335 | Bacteria | 1748 |
| 31 | Ga0070666_10592139 | 3300005335 | Bacteria | 809 |
| 32 | Ga0070682_100269304 | 3300005337 | Bacteria | 1236 |
| 33 | Ga0068868_100411065 | 3300005338 | Bacteria | 1170 |
| 34 | Ga0068868_101063192 | 3300005338 | Bacteria | 743 |
| 35 | Ga0068868_101691458 | 3300005338 | Bacteria | 596 |
| 36 | Ga0070689_100374982 | 3300005340 | Bacteria | 1198 |
| 37 | Ga0070687_100793539 | 3300005343 | Bacteria | 670 |
| 38 | Ga0070661_100043094 | 3300005344 | Bacteria | 3296 |
| 39 | Ga0070661_100059304 | 3300005344 | Bacteria | 2806 |
| 40 | Ga0070661_101026305 | 3300005344 | Bacteria | 685 |
| 41 | Ga0070669_100043121 | 3300005353 | Bacteria | 3284 |
| 42 | Ga0070669_100351410 | 3300005353 | Bacteria | 1197 |
| 43 | Ga0070669_101754762 | 3300005353 | Bacteria | 541 |
| 44 | Ga0070671_100142214 | 3300005355 | Bacteria | 2025 |
| 45 | Ga0070674_100077765 | 3300005356 | Bacteria | 2363 |
| 46 | Ga0070688_100603109 | 3300005365 | Bacteria | 841 |
| 47 | Ga0070667_100030034 | 3300005367 | Bacteria | 4533 |
| 48 | Ga0070667_100569759 | 3300005367 | Bacteria | 1042 |
| 49 | Ga0070667_100746510 | 3300005367 | Bacteria | 907 |
| 50 | Ga0070708_101419323 | 3300005445 | Bacteria | 647 |
| 51 | Ga0070663_100466944 | 3300005455 | Bacteria | 1043 |
| 52 | Ga0070663_100529108 | 3300005455 | Bacteria | 982 |
| 53 | Ga0070681_10720395 | 3300005458 | Bacteria | 914 |
| 54 | Ga0068867_100018425 | 3300005459 | Bacteria | 4962 |
| 55 | Ga0070685_10002722 | 3300005466 | Bacteria | 9055 |
| 56 | Ga0070685_10497195 | 3300005466 | Bacteria | 862 |
| 57 | Ga0070684_100548772 | 3300005535 | Bacteria | 1072 |
| 58 | Ga0070684_100885801 | 3300005535 | Bacteria | 836 |
| 59 | Ga0068853_100009166 | 3300005539 | Bacteria | 7972 |
| 60 | Ga0068853_100038729 | 3300005539 | Bacteria | 4062 |
| 61 | Ga0068853_100063863 | 3300005539 | Bacteria | 3190 |
| 62 | Ga0068853_100704291 | 3300005539 | Bacteria | 963 |
| 63 | Ga0070672_100023622 | 3300005543 | Bacteria | 4535 |
| 64 | Ga0070696_100007990 | 3300005546 | Bacteria | 7064 |
| 65 | Ga0070693_100083515 | 3300005547 | Bacteria | 1909 |
| 66 | Ga0070665_100018056 | 3300005548 | Bacteria | 7080 |
| 67 | Ga0068855_100031911 | 3300005563 | Bacteria | 6288 |
| 68 | Ga0068855_100090012 | 3300005563 | Bacteria | 3542 |
| 69 | Ga0068855_100235164 | 3300005563 | Bacteria | 2049 |
| 70 | Ga0068855_100503727 | 3300005563 | Bacteria | 1315 |
| 71 | Ga0070664_100099568 | 3300005564 | Bacteria | 2527 |
| 72 | Ga0068857_101533451 | 3300005577 | Bacteria | 650 |
| 73 | Ga0068854_100136240 | 3300005578 | Bacteria | 1880 |
| 74 | Ga0068854_100418379 | 3300005578 | Bacteria | 1113 |
| 75 | Ga0068854_100483548 | 3300005578 | Bacteria | 1040 |
| 76 | Ga0068854_100560470 | 3300005578 | Bacteria | 970 |
| 77 | Ga0068856_100123182 | 3300005614 | Bacteria | 2595 |
| 78 | Ga0068856_100250708 | 3300005614 | Bacteria | 1785 |
| 79 | Ga0068856_101450455 | 3300005614 | Bacteria | 700 |
| 80 | Ga0068852_100030539 | 3300005616 | Bacteria | 4437 |
| 81 | Ga0068852_101033354 | 3300005616 | Bacteria | 841 |
| 82 | Ga0068859_100216447 | 3300005617 | Bacteria | 2003 |
| 83 | Ga0068859_101663637 | 3300005617 | Bacteria | 705 |
| 84 | Ga0068859_102143091 | 3300005617 | Bacteria | 617 |
| 85 | Ga0068864_100253558 | 3300005618 | Bacteria | 1634 |
| 86 | Ga0068866_10283677 | 3300005718 | Bacteria | 1027 |
| 87 | Ga0068851_10113023 | 3300005834 | Bacteria | 1452 |
| 88 | Ga0068851_10222117 | 3300005834 | Bacteria | 1062 |
| 89 | Ga0068851_10541244 | 3300005834 | Bacteria | 703 |
| 90 | Ga0068863_100182168 | 3300005841 | Bacteria | 2016 |
| 91 | Ga0068858_100143154 | 3300005842 | Bacteria | 2245 |
| 92 | Ga0068858_100917176 | 3300005842 | Bacteria | 857 |
| 93 | Ga0068860_100035575 | 3300005843 | Bacteria | 4776 |
| 94 | Ga0068860_100071262 | 3300005843 | Bacteria | 3303 |
| 95 | Ga0068860_100297550 | 3300005843 | Bacteria | 1580 |
| 96 | Ga0068862_102352450 | 3300005844 | Bacteria | 544 |
| 97 | Ga0075369_10069715 | 3300006186 | Bacteria | 1546 |
| 98 | Ga0075366_10784052 | 3300006195 | Bacteria | 593 |
| 99 | Ga0097621_100541453 | 3300006237 | Bacteria | 1059 |
| 100 | Ga0068865_101392412 | 3300006881 | Bacteria | 626 |
| 101 | Ga0097620_100216452 | 3300006931 | Bacteria | 2003 |
| 102 | Ga0097620_101663678 | 3300006931 | Bacteria | 705 |
| 103 | Ga0097620_102142474 | 3300006931 | Bacteria | 617 |
| 104 | Ga0105250_10425649 | 3300009092 | Bacteria | 592 |
| 105 | Ga0105240_10001018 | 3300009093 | Bacteria | 49968 |
| 106 | Ga0105240_10087817 | 3300009093 | Bacteria | 3807 |
| 107 | Ga0105240_10263304 | 3300009093 | Bacteria | 1988 |
| 108 | Ga0105247_10001112 | 3300009101 | Bacteria | 20035 |
| 109 | Ga0105243_11190053 | 3300009148 | Bacteria | 775 |
| 110 | Ga0105243_11191082 | 3300009148 | Bacteria | 774 |
| 111 | Ga0105241_10019696 | 3300009174 | Bacteria | 4979 |
| 112 | Ga0105241_10038788 | 3300009174 | Bacteria | 3592 |
| 113 | Ga0105241_10500597 | 3300009174 | Bacteria | 1083 |
| 114 | Ga0105242_10182749 | 3300009176 | Bacteria | 1851 |
| 115 | Ga0105237_10002033 | 3300009545 | Bacteria | 25718 |
| 116 | Ga0105237_10043540 | 3300009545 | Bacteria | 4521 |
| 117 | Ga0105237_10092667 | 3300009545 | Bacteria | 3011 |
| 118 | Ga0105237_10152140 | 3300009545 | Bacteria | 2310 |
| 119 | Ga0105238_10000044 | 3300009551 | Bacteria | 151485 |
| 120 | Ga0105238_10010487 | 3300009551 | Bacteria | 9301 |
| 121 | Ga0105238_10090236 | 3300009551 | Bacteria | 3052 |
| 122 | Ga0105238_10092536 | 3300009551 | Bacteria | 3012 |
| 123 | Ga0105238_10163017 | 3300009551 | Bacteria | 2205 |
| 124 | Ga0105238_10536271 | 3300009551 | Bacteria | 1174 |
| 125 | Ga0105249_10278869 | 3300009553 | Bacteria | 1668 |
| 126 | Ga0105249_10499394 | 3300009553 | Bacteria | 1262 |
| 127 | Ga0105239_10007944 | 3300010375 | Bacteria | 12127 |
| 128 | Ga0105239_10008836 | 3300010375 | Bacteria | 11404 |
| 129 | Ga0105239_10093812 | 3300010375 | Bacteria | 3314 |
| 130 | Ga0105239_10117133 | 3300010375 | Bacteria | 2957 |
| 131 | Ga0105239_10366505 | 3300010375 | Bacteria | 1628 |
| 132 | Ga0105239_11746963 | 3300010375 | Bacteria | 720 |
| 133 | Ga0105246_11570581 | 3300011119 | Bacteria | 621 |
| 134 | Ga0157316_1056975 | 3300012510 | Bacteria | 555 |
| 135 | Ga0157373_10195058 | 3300013100 | Bacteria | 1427 |
| 136 | Ga0157371_10041200 | 3300013102 | Bacteria | 3296 |
| 137 | Ga0157371_10074037 | 3300013102 | Bacteria | 2412 |
| 138 | Ga0157370_10016512 | 3300013104 | Bacteria | 7470 |
| 139 | Ga0157370_10046842 | 3300013104 | Bacteria | 4145 |
| 140 | Ga0157370_10068476 | 3300013104 | Bacteria | 3354 |
| 141 | Ga0157370_10186143 | 3300013104 | Bacteria | 1928 |
| 142 | Ga0157370_10470394 | 3300013104 | Bacteria | 1155 |
| 143 | Ga0157370_10531759 | 3300013104 | Bacteria | 1078 |
| 144 | Ga0157369_10000001 | 3300013105 | Bacteria | 554908 |
| 145 | Ga0157369_10005167 | 3300013105 | Bacteria | 15276 |
| 146 | Ga0157369_10037014 | 3300013105 | Bacteria | 5345 |
| 147 | Ga0157369_10188313 | 3300013105 | Bacteria | 2169 |
| 148 | Ga0157369_10403657 | 3300013105 | Bacteria | 1418 |
| 149 | Ga0157369_10500760 | 3300013105 | Bacteria | 1257 |
| 150 | Ga0157378_10759466 | 3300013297 | Bacteria | 993 |
| 151 | Ga0157378_10782093 | 3300013297 | Bacteria | 979 |
| 152 | Ga0163162_10002334 | 3300013306 | Bacteria | 17809 |
| 153 | Ga0163162_10399835 | 3300013306 | Bacteria | 1506 |
| 154 | Ga0163162_10751278 | 3300013306 | Bacteria | 1094 |
| 155 | Ga0157372_10000334 | 3300013307 | Bacteria | 51813 |
| 156 | Ga0157372_10210999 | 3300013307 | Bacteria | 2250 |
| 157 | Ga0157372_10301766 | 3300013307 | Bacteria | 1863 |
| 158 | Ga0157372_10767188 | 3300013307 | Bacteria | 1121 |
| 159 | Ga0157372_11166972 | 3300013307 | Bacteria | 890 |
| 160 | Ga0157375_10129893 | 3300013308 | Bacteria | 2638 |
| 161 | Ga0163163_10092207 | 3300014325 | Bacteria | 3044 |
| 162 | Ga0157380_10198376 | 3300014326 | Bacteria | 1778 |
| 163 | Ga0157380_10829666 | 3300014326 | Bacteria | 944 |
| 164 | Ga0182008_10110894 | 3300014497 | Bacteria | 1360 |
| 165 | Ga0182008_10398013 | 3300014497 | Bacteria | 739 |
| 166 | Ga0157376_10016913 | 3300014969 | Bacteria | 5550 |
| 167 | Ga0157376_10831081 | 3300014969 | Bacteria | 938 |
| 168 | Ga0182006_1000031 | 3300015261 | Bacteria | 240055 |
| 169 | Ga0182006_1001647 | 3300015261 | Bacteria | 13162 |
| 170 | Ga0182007_10006478 | 3300015262 | Bacteria | 5022 |
| 171 | Ga0182005_1000095 | 3300015265 | Bacteria | 66965 |
| 172 | Ga0182005_1000424 | 3300015265 | Bacteria | 22547 |
| 173 | Ga0182005_1002838 | 3300015265 | Bacteria | 6036 |
| 174 | Ga0182005_1103700 | 3300015265 | Bacteria | 799 |
| 175 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 176 | Ga0183361_11119 | 3300016635 | Bacteria | 1341 |
| 177 | Ga0163161_10069048 | 3300017792 | Bacteria | 2583 |
| 178 | Ga0163161_11065228 | 3300017792 | Bacteria | 693 |
| 179 | Ga0206356_11785061 | 3300020070 | Bacteria | 1667 |
| 180 | Ga0206354_10206202 | 3300020081 | Bacteria | 934 |
| 181 | Ga0209435_103848 | 3300025206 | Bacteria | 1704 |
| 182 | Ga0209760_100228 | 3300025207 | Bacteria | 24212 |
| 183 | Ga0209784_100042 | 3300025224 | Bacteria | 218070 |
| 184 | Ga0209672_109894 | 3300025228 | Bacteria | 1316 |
| 185 | Ga0207427_100096 | 3300025231 | Bacteria | 123398 |
| 186 | Ga0209437_100074 | 3300025233 | Bacteria | 300858 |
| 187 | Ga0209258_100136 | 3300025242 | Bacteria | 169078 |
| 188 | Ga0209646_1001322 | 3300025246 | Bacteria | 6902 |
| 189 | Ga0209646_1004454 | 3300025246 | Bacteria | 2550 |
| 190 | Ga0209026_1000072 | 3300025250 | Bacteria | 205447 |
| 191 | Ga0209026_1002819 | 3300025250 | Bacteria | 6159 |
| 192 | Ga0209148_1000036 | 3300025254 | Bacteria | 530505 |
| 193 | Ga0209759_1000833 | 3300025256 | Bacteria | 24296 |
| 194 | Ga0209759_1011879 | 3300025256 | Bacteria | 2443 |
| 195 | Ga0209233_1000040 | 3300025261 | Bacteria | 530395 |
| 196 | Ga0209455_1000071 | 3300025272 | Bacteria | 300858 |
| 197 | Ga0209455_1001940 | 3300025272 | Bacteria | 8547 |
| 198 | Ga0209758_1015808 | 3300025297 | Bacteria | 3880 |
| 199 | Ga0209051_1005458 | 3300025303 | Bacteria | 7422 |
| 200 | Ga0207656_10411464 | 3300025321 | Bacteria | 681 |
| 201 | Ga0207696_1196624 | 3300025711 | Bacteria | 530 |
| 202 | Ga0207710_10118242 | 3300025900 | Bacteria | 1264 |
| 203 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 204 | Ga0207680_10004776 | 3300025903 | Bacteria | 6452 |
| 205 | Ga0207680_10522032 | 3300025903 | Bacteria | 847 |
| 206 | Ga0207680_10745781 | 3300025903 | Bacteria | 702 |
| 207 | Ga0207647_10008613 | 3300025904 | Bacteria | 7300 |
| 208 | Ga0207647_10025790 | 3300025904 | Bacteria | 3855 |
| 209 | Ga0207647_10386502 | 3300025904 | Bacteria | 790 |
| 210 | Ga0207645_10093054 | 3300025907 | Bacteria | 1939 |
| 211 | Ga0207705_10003838 | 3300025909 | Bacteria | 11435 |
| 212 | Ga0207705_10472434 | 3300025909 | Bacteria | 973 |
| 213 | Ga0207654_10011245 | 3300025911 | Bacteria | 4562 |
| 214 | Ga0207707_10257421 | 3300025912 | Bacteria | 1515 |
| 215 | Ga0207707_10376058 | 3300025912 | Bacteria | 1222 |
| 216 | Ga0207695_10000082 | 3300025913 | Bacteria | 284333 |
| 217 | Ga0207695_10001153 | 3300025913 | Bacteria | 45794 |
| 218 | Ga0207695_10001726 | 3300025913 | Bacteria | 34905 |
| 219 | Ga0207695_10005034 | 3300025913 | Bacteria | 17748 |
| 220 | Ga0207671_10002307 | 3300025914 | Bacteria | 20603 |
| 221 | Ga0207671_10004076 | 3300025914 | Bacteria | 14148 |
| 222 | Ga0207671_10014730 | 3300025914 | Bacteria | 6166 |
| 223 | Ga0207671_10282053 | 3300025914 | Bacteria | 1310 |
| 224 | Ga0207657_10011564 | 3300025919 | Bacteria | 8756 |
| 225 | Ga0207657_10327967 | 3300025919 | Bacteria | 1209 |
| 226 | Ga0207649_10003581 | 3300025920 | Bacteria | 8488 |
| 227 | Ga0207649_10012978 | 3300025920 | Bacteria | 4643 |
| 228 | Ga0207649_10296741 | 3300025920 | Bacteria | 1180 |
| 229 | Ga0207649_10353327 | 3300025920 | Bacteria | 1088 |
| 230 | Ga0207652_10010712 | 3300025921 | Bacteria | 7381 |
| 231 | Ga0207694_10001235 | 3300025924 | Bacteria | 22135 |
| 232 | Ga0207694_10003810 | 3300025924 | Bacteria | 11934 |
| 233 | Ga0207694_10030528 | 3300025924 | Bacteria | 4116 |
| 234 | Ga0207694_10065985 | 3300025924 | Bacteria | 2822 |
| 235 | Ga0207694_10105266 | 3300025924 | Bacteria | 2239 |
| 236 | Ga0207694_10117264 | 3300025924 | Bacteria | 2122 |
| 237 | Ga0207694_10237322 | 3300025924 | Bacteria | 1490 |
| 238 | Ga0207694_10357358 | 3300025924 | Bacteria | 1210 |
| 239 | Ga0207659_10389562 | 3300025926 | Bacteria | 1163 |
| 240 | Ga0207690_10574671 | 3300025932 | Bacteria | 918 |
| 241 | Ga0207690_11177687 | 3300025932 | Bacteria | 640 |
| 242 | Ga0207709_10689482 | 3300025935 | Bacteria | 816 |
| 243 | Ga0207709_10794588 | 3300025935 | Bacteria | 763 |
| 244 | Ga0207704_10994577 | 3300025938 | Bacteria | 709 |
| 245 | Ga0207691_10001994 | 3300025940 | Bacteria | 19974 |
| 246 | Ga0207711_11076299 | 3300025941 | Bacteria | 745 |
| 247 | Ga0207661_10507298 | 3300025944 | Bacteria | 1102 |
| 248 | Ga0207661_11623179 | 3300025944 | Bacteria | 591 |
| 249 | Ga0207667_10003998 | 3300025949 | Bacteria | 18108 |
| 250 | Ga0207667_10087611 | 3300025949 | Bacteria | 3220 |
| 251 | Ga0207667_10335572 | 3300025949 | Bacteria | 1543 |
| 252 | Ga0207667_11142678 | 3300025949 | Bacteria | 760 |
| 253 | Ga0207651_10294064 | 3300025960 | Bacteria | 1348 |
| 254 | Ga0207712_10165427 | 3300025961 | Bacteria | 1723 |
| 255 | Ga0207712_10192322 | 3300025961 | Bacteria | 1611 |
| 256 | Ga0207668_10278861 | 3300025972 | Bacteria | 1370 |
| 257 | Ga0207668_10464936 | 3300025972 | Bacteria | 1082 |
| 258 | Ga0207640_10087443 | 3300025981 | Bacteria | 2148 |
| 259 | Ga0207640_10277611 | 3300025981 | Bacteria | 1314 |
| 260 | Ga0207640_10398079 | 3300025981 | Bacteria | 1121 |
| 261 | Ga0207658_10119117 | 3300025986 | Bacteria | 2101 |
| 262 | Ga0207658_10226172 | 3300025986 | Bacteria | 1577 |
| 263 | Ga0207658_10885597 | 3300025986 | Bacteria | 812 |
| 264 | Ga0207677_10101390 | 3300026023 | Bacteria | 2119 |
| 265 | Ga0207677_10978157 | 3300026023 | Bacteria | 766 |
| 266 | Ga0207703_10346213 | 3300026035 | Bacteria | 1367 |
| 267 | Ga0207703_10486925 | 3300026035 | Bacteria | 1156 |
| 268 | Ga0207703_10643126 | 3300026035 | Bacteria | 1006 |
| 269 | Ga0207703_11341185 | 3300026035 | Bacteria | 688 |
| 270 | Ga0207639_10001104 | 3300026041 | Bacteria | 18320 |
| 271 | Ga0207678_10019842 | 3300026067 | Bacteria | 5908 |
| 272 | Ga0207678_10056061 | 3300026067 | Bacteria | 3394 |
| 273 | Ga0207678_10387956 | 3300026067 | Bacteria | 1208 |
| 274 | Ga0207702_10000107 | 3300026078 | Bacteria | 96024 |
| 275 | Ga0207702_10118684 | 3300026078 | Bacteria | 2364 |
| 276 | Ga0207641_10055796 | 3300026088 | Bacteria | 3355 |
| 277 | Ga0207648_10050477 | 3300026089 | Bacteria | 3638 |
| 278 | Ga0207674_10007061 | 3300026116 | Bacteria | 13127 |
| 279 | Ga0207674_10656847 | 3300026116 | Bacteria | 1013 |
| 280 | Ga0207683_10094771 | 3300026121 | Bacteria | 2661 |
| 281 | Ga0207698_10320226 | 3300026142 | Bacteria | 1452 |
| 282 | Ga0207698_10419223 | 3300026142 | Bacteria | 1284 |
| 283 | Ga0207698_10511207 | 3300026142 | Bacteria | 1171 |
| 284 | Ga0207698_10597034 | 3300026142 | Bacteria | 1088 |
| 285 | Ga0209969_1004057 | 3300027360 | Bacteria | 2044 |
| 286 | Ga0209995_1048973 | 3300027471 | Bacteria | 716 |
| 287 | Ga0209982_1007389 | 3300027552 | Bacteria | 1606 |
| 288 | Ga0209983_1002210 | 3300027665 | Bacteria | 4283 |
| 289 | Ga0209971_1000293 | 3300027682 | Bacteria | 13984 |
| 290 | Ga0209974_10045680 | 3300027876 | Bacteria | 1463 |
| 291 | Ga0209974_10099113 | 3300027876 | Bacteria | 1017 |
| 292 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 293 | Ga0268266_10336568 | 3300028379 | Bacteria | 1416 |
| 294 | Ga0268265_10925974 | 3300028380 | Bacteria | 857 |
| 295 | Ga0268265_12103843 | 3300028380 | Bacteria | 571 |
| 296 | Ga0268264_10043071 | 3300028381 | Bacteria | 3739 |
| 297 | Ga0268264_10260286 | 3300028381 | Bacteria | 1616 |
| 298 | Ga0268264_10559883 | 3300028381 | Bacteria | 1122 |
| 299 | Ga0307408_100579949 | 3300031548 | Bacteria | 994 |
| 300 | Ga0316575_10112851 | 3300031665 | Bacteria | 1109 |
| 301 | Ga0307413_10429579 | 3300031824 | Bacteria | 1043 |
| 302 | Ga0307410_10962747 | 3300031852 | Bacteria | 734 |
| 303 | Ga0307412_10001086 | 3300031911 | Bacteria | 15548 |
| 304 | Ga0307412_11469493 | 3300031911 | Bacteria | 619 |
| 305 | Ga0307416_100607213 | 3300032002 | Bacteria | 1174 |
| 306 | Ga0307416_100683865 | 3300032002 | Bacteria | 1114 |
| 307 | Ga0307414_10732301 | 3300032004 | Bacteria | 897 |
| 308 | Ga0307414_12123653 | 3300032004 | Bacteria | 524 |
| 309 | Ga0307415_100526341 | 3300032126 | Bacteria | 1039 |
| 310 | Ga0307510_10003865 | 3300033180 | Bacteria | 17565 |
| 311 | Ga0307510_10031101 | 3300033180 | Bacteria | 6036 |
| 312 | Ga0373937_0773577 | 3300036401 | Bacteria | 908 |
| 313 | Ga0395905_0123178 | 3300037471 | Bacteria | 2438 |
| 314 | Ga0395905_0735092 | 3300037471 | Bacteria | 889 |
| 315 | Ga0451793_1257150 | 3300041452 | Bacteria | 1131 |
| 316 | Ga0451793_1706500 | 3300041452 | Bacteria | 5019 |
| 317 | Ga0451806_638448 | 3300041462 | Bacteria | 755 |
| 318 | Ga0451833_0373143 | 3300041491 | Bacteria | 866 |
| 319 | Ga0451839_0100045 | 3300041496 | Bacteria | 506 |
| 320 | Ga0451853_2562865 | 3300041512 | Bacteria | 840 |
| 321 | Ga0439432_123890 | 3300042006 | Bacteria | 765 |
| 322 | Ga0439449_0052953 | 3300042007 | Bacteria | 1500 |
| 323 | Ga0450897_015413 | 3300042128 | Bacteria | 780 |
| 324 | Ga0450899_043533 | 3300042135 | Bacteria | 565 |
| 325 | Ga0451577_0287512 | 3300042876 | Bacteria | 1490 |
| 326 | Ga0466972_0007808 | 3300044658 | Bacteria | 5368 |
| 327 | Ga0466982_0000049 | 3300044672 | Bacteria | 36295 |
| 328 | Ga0453684_0001318 | 3300044712 | Bacteria | 73362 |
| 329 | Ga0466968_0018469 | 3300044735 | Bacteria | 2797 |
| 330 | Ga0466970_0000107 | 3300044765 | Bacteria | 36696 |
| 331 | Ga0466959_0001905 | 3300045049 | Bacteria | 13126 |
| 332 | Ga0451576_0000628 | 3300045051 | Bacteria | 73375 |
| 333 | Ga0451576_2239664 | 3300045051 | Bacteria | 561 |
| 334 | Ga0466967_1957753 | 3300045976 | Bacteria | 583 |
| 335 | Ga0495617_000120 | 3300046452 | Bacteria | 52244 |
| 336 | Ga0495617_000348 | 3300046452 | Bacteria | 25506 |
| 337 | Ga0495590_0033503 | 3300046457 | Bacteria | 1796 |
| 338 | Ga0495638_0000498 | 3300046460 | Bacteria | 46678 |
| 339 | Ga0495638_0006938 | 3300046460 | Bacteria | 8172 |
| 340 | Ga0495638_0308317 | 3300046460 | Bacteria | 850 |
| 341 | Ga0495650_0000703 | 3300046471 | Bacteria | 42860 |
| 342 | Ga0495650_0001015 | 3300046471 | Bacteria | 31654 |
| 343 | Ga0495605_0242540 | 3300046474 | Bacteria | 773 |
| 344 | Ga0495584_0000688 | 3300046491 | Bacteria | 22464 |
| 345 | Ga0495585_0000200 | 3300046492 | Bacteria | 62445 |
| 346 | Ga0495585_0040680 | 3300046492 | Bacteria | 2609 |
| 347 | Ga0495607_0000090 | 3300046501 | Bacteria | 94252 |
| 348 | Ga0495607_0000244 | 3300046501 | Bacteria | 58158 |
| 349 | Ga0495583_0005713 | 3300046506 | Bacteria | 8359 |
| 350 | Ga0495606_0000218 | 3300046507 | Bacteria | 101645 |
| 351 | Ga0495606_0001182 | 3300046507 | Bacteria | 36798 |
| 352 | Ga0495606_0003799 | 3300046507 | Bacteria | 15691 |
| 353 | Ga0495606_0046340 | 3300046507 | Bacteria | 2874 |
| 354 | Ga0495606_0060559 | 3300046507 | Bacteria | 2424 |
| 355 | Ga0495616_0000006 | 3300046513 | Bacteria | 234766 |
| 356 | Ga0495616_0007706 | 3300046513 | Bacteria | 6435 |
| 357 | Ga0495620_0000806 | 3300046515 | Bacteria | 19267 |
| 358 | Ga0495620_0001426 | 3300046515 | Bacteria | 14315 |
| 359 | Ga0495631_0000820 | 3300046518 | Bacteria | 19864 |
| 360 | Ga0495631_0256275 | 3300046518 | Bacteria | 745 |
| 361 | Ga0495632_0001202 | 3300046519 | Bacteria | 21984 |
| 362 | Ga0495632_0005484 | 3300046519 | Bacteria | 8380 |
| 363 | Ga0495632_0014200 | 3300046519 | Bacteria | 4515 |
| 364 | Ga0495632_0323226 | 3300046519 | Bacteria | 681 |
| 365 | Ga0495637_0004114 | 3300046520 | Bacteria | 7578 |
| 366 | Ga0495648_0002324 | 3300046524 | Bacteria | 17692 |
| 367 | Ga0495648_0291529 | 3300046524 | Bacteria | 768 |
| 368 | Ga0495598_0049569 | 3300046537 | Bacteria | 1260 |
| 369 | Ga0495609_0007830 | 3300046538 | Bacteria | 5287 |
| 370 | Ga0495621_0053509 | 3300046539 | Bacteria | 1449 |
| 371 | Ga0495622_0463564 | 3300046557 | Bacteria | 543 |
| 372 | Ga0495668_0019485 | 3300046616 | Bacteria | 3909 |
| 373 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 374 | Ga0495611_0000126 | 3300046648 | Bacteria | 53596 |
| 375 | Ga0495625_0000200 | 3300046660 | Bacteria | 95445 |
| 376 | Ga0495625_0012267 | 3300046660 | Bacteria | 6950 |
| 377 | Ga0495625_0013566 | 3300046660 | Bacteria | 6538 |
| 378 | Ga0495625_0084294 | 3300046660 | Bacteria | 2207 |
| 379 | Ga0495659_0112645 | 3300046664 | Bacteria | 1064 |
| 380 | Ga0495661_0004199 | 3300046665 | Bacteria | 10475 |
| 381 | Ga0495658_0582675 | 3300046683 | Bacteria | 717 |
| 382 | Ga0495670_0017452 | 3300046691 | Bacteria | 3532 |
| 383 | Ga0495671_0000457 | 3300046692 | Bacteria | 32058 |
| 384 | Ga0495649_0029432 | 3300046694 | Bacteria | 3037 |
| 385 | Ga0495589_0000008 | 3300046794 | Bacteria | 266071 |
| 386 | Ga0495660_0000129 | 3300046810 | Bacteria | 83044 |
| 387 | Ga0495660_0000133 | 3300046810 | Bacteria | 81572 |
| 388 | Ga0495672_0213061 | 3300047320 | Bacteria | 958 |
| 389 | Ga0495683_0002369 | 3300047323 | Bacteria | 11433 |
| 390 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 391 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 392 | Ga0495673_0000041 | 3300047469 | Bacteria | 296723 |
| 393 | Ga0495673_0003178 | 3300047469 | Bacteria | 10979 |
| 394 | Ga0495681_0055785 | 3300047470 | Bacteria | 1841 |
| 395 | Ga0495686_0001461 | 3300047472 | Bacteria | 25728 |
| 396 | Ga0495686_0002504 | 3300047472 | Bacteria | 17249 |
| 397 | Ga0495686_0003220 | 3300047472 | Bacteria | 14363 |
| 398 | Ga0495686_0036155 | 3300047472 | Bacteria | 3170 |
| 399 | Ga0495615_0022747 | 3300048090 | Bacteria | 1429 |
| 400 | Ga0496101_1228785 | 3300048904 | Bacteria | 587 |
| 401 | Ga0496102_0468766 | 3300048905 | Bacteria | 1180 |
| 402 | Ga0496104_0435350 | 3300048907 | Bacteria | 1223 |
| 403 | Ga0496106_0001625 | 3300048909 | Bacteria | 16887 |
| 404 | Ga0496107_1317127 | 3300048910 | Bacteria | 516 |
| 405 | Ga0496109_0198204 | 3300048912 | Bacteria | 1888 |
| 406 | Ga0496113_0068452 | 3300048916 | Bacteria | 2694 |
| 407 | Ga0496116_0108572 | 3300048919 | Bacteria | 1638 |
| 408 | Ga0496117_0011047 | 3300048920 | Bacteria | 8130 |
| 409 | Ga0496117_0291626 | 3300048920 | Bacteria | 868 |
| 410 | Ga0496117_0301581 | 3300048920 | Bacteria | 848 |
| 411 | Ga0496118_0000184 | 3300048921 | Bacteria | 109873 |
| 412 | Ga0496118_0009622 | 3300048921 | Bacteria | 9728 |
| 413 | Ga0496118_0101045 | 3300048921 | Bacteria | 1949 |
| 414 | Ga0496119_0018976 | 3300048922 | Bacteria | 5090 |
| 415 | Ga0496120_0136130 | 3300048923 | Bacteria | 1252 |
| 416 | Ga0496121_0001516 | 3300048924 | Bacteria | 38982 |
| 417 | Ga0496121_0003543 | 3300048924 | Bacteria | 22104 |
| 418 | Ga0496121_0013794 | 3300048924 | Bacteria | 8650 |
| 419 | Ga0496121_0269998 | 3300048924 | Bacteria | 1169 |
| 420 | Ga0496121_0308240 | 3300048924 | Bacteria | 1071 |
| 421 | Ga0496121_0755599 | 3300048924 | Bacteria | 577 |
| 422 | Ga0496122_0348472 | 3300048925 | Bacteria | 774 |
| 423 | Ga0496123_0032853 | 3300048926 | Bacteria | 3746 |
| 424 | Ga0496124_0000203 | 3300048927 | Bacteria | 117239 |
| 425 | Ga0496124_0000410 | 3300048927 | Bacteria | 77367 |
| 426 | Ga0496124_0146256 | 3300048927 | Bacteria | 1859 |
| 427 | Ga0496124_0667825 | 3300048927 | Bacteria | 664 |
| 428 | Ga0496125_0207659 | 3300048928 | Bacteria | 1275 |
| 429 | Ga0496126_0032157 | 3300048929 | Bacteria | 4946 |
| 430 | Ga0495678_000158 | 3300049459 | Bacteria | 81058 |
| 431 | Ga0495682_0002070 | 3300049460 | Bacteria | 9803 |
| 432 | Ga0495682_0002462 | 3300049460 | Bacteria | 8744 |
| 433 | Ga0501031_0240247 | 3300049568 | Bacteria | 1178 |
| 434 | Ga0501031_0540883 | 3300049568 | Bacteria | 750 |
| 435 | Ga0501032_0050313 | 3300049569 | Bacteria | 2810 |
| 436 | Ga0501032_0132666 | 3300049569 | Bacteria | 1642 |
| 437 | Ga0501032_0244632 | 3300049569 | Bacteria | 1165 |
| 438 | Ga0501032_0657790 | 3300049569 | Bacteria | 665 |
| 439 | Ga0501032_0829507 | 3300049569 | Bacteria | 583 |
| 440 | Ga0501033_0000430 | 3300049570 | Bacteria | 40189 |
| 441 | Ga0501033_0074163 | 3300049570 | Bacteria | 2498 |
| 442 | Ga0501034_0090605 | 3300049571 | Bacteria | 3056 |
| 443 | Ga0501034_0901887 | 3300049571 | Bacteria | 772 |
| 444 | Ga0501036_0348340 | 3300049572 | Bacteria | 1237 |
| 445 | Ga0501036_0402219 | 3300049572 | Bacteria | 1142 |
| 446 | Ga0501037_0557567 | 3300049573 | Bacteria | 773 |
| 447 | Ga0501038_0047067 | 3300049574 | Bacteria | 3737 |
| 448 | Ga0501038_0228688 | 3300049574 | Bacteria | 1481 |
| 449 | Ga0501038_0408389 | 3300049574 | Bacteria | 1049 |
| 450 | Ga0501038_0865300 | 3300049574 | Bacteria | 669 |
| 451 | Ga0501039_0899479 | 3300049575 | Bacteria | 689 |
| 452 | Ga0501042_0201658 | 3300049578 | Bacteria | 1434 |
| 453 | Ga0501043_0069107 | 3300049579 | Bacteria | 2774 |
| 454 | Ga0501043_0099531 | 3300049579 | Bacteria | 2285 |
| 455 | Ga0501043_0122814 | 3300049579 | Bacteria | 2037 |
| 456 | Ga0501043_0885757 | 3300049579 | Bacteria | 641 |
| 457 | Ga0501046_0019926 | 3300049580 | Bacteria | 5554 |
| 458 | Ga0501047_0099520 | 3300049581 | Bacteria | 2787 |
| 459 | Ga0501047_0103246 | 3300049581 | Bacteria | 2731 |
| 460 | Ga0501047_1075400 | 3300049581 | Bacteria | 618 |
| 461 | Ga0501048_0139468 | 3300049582 | Bacteria | 1714 |
| 462 | Ga0501070_0212318 | 3300049586 | Bacteria | 1588 |
| 463 | Ga0501070_0387628 | 3300049586 | Bacteria | 1131 |
| 464 | Ga0501070_0988530 | 3300049586 | Bacteria | 653 |
| 465 | Ga0501073_0196943 | 3300049589 | Bacteria | 1393 |
| 466 | Ga0501080_0154871 | 3300049742 | Bacteria | 2117 |
| 467 | Ga0501035_0009267 | 3300049822 | Bacteria | 9153 |
| 468 | Ga0501035_0020916 | 3300049822 | Bacteria | 6013 |
| 469 | Ga0501035_0164942 | 3300049822 | Bacteria | 1916 |
| 470 | Ga0501035_0279104 | 3300049822 | Bacteria | 1412 |
| 471 | Ga0501035_0496002 | 3300049822 | Bacteria | 1005 |
| 472 | Ga0501035_0724258 | 3300049822 | Bacteria | 800 |
| 473 | Ga0501044_0136563 | 3300049823 | Bacteria | 2443 |
| 474 | Ga0501044_0145462 | 3300049823 | Bacteria | 2356 |
| 475 | Ga0501044_0191900 | 3300049823 | Bacteria | 2005 |
| 476 | Ga0501044_0343291 | 3300049823 | Bacteria | 1414 |
| 477 | Ga0501044_0455660 | 3300049823 | Bacteria | 1185 |
| 478 | Ga0501044_0823967 | 3300049823 | Bacteria | 806 |
| 479 | nmdc:mga0k408_857870_c1 | 3300050493 | Bacteria | 528 |
| 480 | nmdc:mga0sz30_217682_c1 | 3300050516 | Bacteria | 849 |
| 481 | Ga0500643_000140 | 3300053087 | Bacteria | 72592 |
| 482 | Ga0500555_000251 | 3300053103 | Bacteria | 23542 |
| 483 | Ga0500597_351409 | 3300053120 | Bacteria | 574 |
| 484 | Ga0500652_289215 | 3300053131 | Bacteria | 637 |
| 485 | Ga0500633_0008839 | 3300053160 | Bacteria | 2617 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100579949 | Ga0307408_1005799492 | 127 |
| 2 | 3300031911 | Ga0307412_11469493 | Ga0307412_114694931 | 127 |
| 3 | 3300032002 | Ga0307416_100607213 | Ga0307416_1006072132 | 127 |
| 4 | 3300032126 | Ga0307415_100526341 | Ga0307415_1005263411 | 127 |
| 5 | iso_pu_bacteria | 2643221577 | 2643896955 | 135 |
| 6 | iso_pu_bacteria | 2894414249 | 2894415056 | 135 |
| 7 | iso_pu_bacteria | 2593339239 | 2595449923 | 136 |
| 8 | iso_pu_bacteria | 2687453130 | 2687581973 | 136 |
| 9 | iso_pu_bacteria | 2718218334 | 2721026178 | 136 |
| 10 | iso_pu_bacteria | 2734482264 | 2735833851 | 136 |
| 11 | iso_pu_bacteria | 2738543009 | 2739228838 | 136 |
| 12 | iso_pu_bacteria | 2842914999 | 2842918764 | 136 |
| 13 | iso_pu_bacteria | 2842918807 | 2842920218 | 136 |
| 14 | iso_pu_bacteria | 2919085039 | 2919087412 | 136 |
| 15 | iso_pu_bacteria | 2919404418 | 2919406469 | 136 |
| 16 | iso_pu_bacteria | 2941471342 | 2941474243 | 136 |
| 17 | iso_pu_bacteria | 2941489479 | 2941493453 | 136 |
| 18 | iso_pu_bacteria | 2953994433 | 2953995512 | 136 |
| 19 | 3300011119 | Ga0105246_11570581 | Ga0105246_115705812 | 139 |
| 20 | 3300015685 | Ga0183369_1003 | Ga0183369_1003264 | 139 |
| 21 | 3300016635 | Ga0183361_11119 | Ga0183361_111191 | 139 |
| 22 | 3300027360 | Ga0209969_1004057 | Ga0209969_10040572 | 139 |
| 23 | 3300027552 | Ga0209982_1007389 | Ga0209982_10073892 | 139 |
| 24 | 3300027665 | Ga0209983_1002210 | Ga0209983_10022104 | 139 |
| 25 | 3300027682 | Ga0209971_1000293 | Ga0209971_100029311 | 139 |
| 26 | 3300027876 | Ga0209974_10045680 | Ga0209974_100456802 | 139 |
| 27 | 3300027876 | Ga0209974_10099113 | Ga0209974_100991132 | 139 |
| 28 | 3300032004 | Ga0307414_10732301 | Ga0307414_107323011 | 139 |
| 29 | 3300042006 | Ga0439432_123890 | Ga0439432_123890_324_743 | 139 |
| 30 | 3300042876 | Ga0451577_0287512 | Ga0451577_0287512_357_785 | 139 |
| 31 | 3300044712 | Ga0453684_0001318 | Ga0453684_0001318_18275_18697 | 139 |
| 32 | 3300045051 | Ga0451576_0000628 | Ga0451576_0000628_18290_18712 | 139 |
| 33 | 3300049569 | Ga0501032_0050313 | Ga0501032_0050313_261_680 | 139 |
| 34 | 3300049569 | Ga0501032_0132666 | Ga0501032_0132666_1150_1569 | 139 |
| 35 | 3300049569 | Ga0501032_0657790 | Ga0501032_0657790_83_502 | 139 |
| 36 | 3300049574 | Ga0501038_0228688 | Ga0501038_0228688_446_865 | 139 |
| 37 | 3300049574 | Ga0501038_0865300 | Ga0501038_0865300_71_490 | 139 |
| 38 | 3300049580 | Ga0501046_0019926 | Ga0501046_0019926_3697_4116 | 139 |
| 39 | 3300049581 | Ga0501047_0099520 | Ga0501047_0099520_271_690 | 139 |
| 40 | 3300049822 | Ga0501035_0496002 | Ga0501035_0496002_462_881 | 139 |
| 41 | 3300049823 | Ga0501044_0343291 | Ga0501044_0343291_88_507 | 139 |
| 42 | 3300049823 | Ga0501044_0455660 | Ga0501044_0455660_538_957 | 139 |
| 43 | 3300001989 | JGI24739J22299_10031451 | JGI24739J22299_100314512 | 140 |
| 44 | 3300002067 | JGI24735J21928_10104510 | JGI24735J21928_101045102 | 140 |
| 45 | 3300002075 | JGI24738J21930_10002028 | JGI24738J21930_100020282 | 140 |
| 46 | 3300002705 | JGI25156J39149_1003962 | JGI25156J39149_10039622 | 140 |
| 47 | 3300002741 | JGI25157J39369_1000231 | JGI25157J39369_100023131 | 140 |
| 48 | 3300002741 | JGI25157J39369_1003218 | JGI25157J39369_10032182 | 140 |
| 49 | 3300002771 | JGI25163J39215_1000591 | JGI25163J39215_10005915 | 140 |
| 50 | 3300002772 | JGI25164J39214_1000229 | JGI25164J39214_10002296 | 140 |
| 51 | 3300003187 | JGI25151J46595_10000048 | JGI25151J46595_1000004857 | 140 |
| 52 | 3300003214 | JGI25165J46597_1000063 | JGI25165J46597_1000063186 | 140 |
| 53 | 3300003578 | Ga0006562J51391_1037139 | Ga0006562J51391_103713910 | 140 |
| 54 | 3300003578 | Ga0006562J51391_1037142 | Ga0006562J51391_10371422 | 140 |
| 55 | 3300003751 | Ga0055538_1000399 | Ga0055538_10003992 | 140 |
| 56 | 3300003761 | Ga0055535_1000068 | Ga0055535_10000686 | 140 |
| 57 | 3300003762 | Ga0055542_1000090 | Ga0055542_10000906 | 140 |
| 58 | 3300003763 | Ga0055529_1000084 | Ga0055529_10000846 | 140 |
| 59 | 3300003763 | Ga0055529_1008925 | Ga0055529_10089252 | 140 |
| 60 | 3300003771 | Ga0055526_1000005 | Ga0055526_100000577 | 140 |
| 61 | 3300005262 | Ga0065165_1000405 | Ga0065165_100040541 | 140 |
| 62 | 3300005327 | Ga0070658_10003129 | Ga0070658_100031298 | 140 |
| 63 | 3300005327 | Ga0070658_10776506 | Ga0070658_107765061 | 140 |
| 64 | 3300005328 | Ga0070676_10229181 | Ga0070676_102291811 | 140 |
| 65 | 3300005328 | Ga0070676_11162702 | Ga0070676_111627021 | 140 |
| 66 | 3300005329 | Ga0070683_100009389 | Ga0070683_1000093894 | 140 |
| 67 | 3300005329 | Ga0070683_101051933 | Ga0070683_1010519332 | 140 |
| 68 | 3300005331 | Ga0070670_100030184 | Ga0070670_1000301844 | 140 |
| 69 | 3300005331 | Ga0070670_100832267 | Ga0070670_1008322672 | 140 |
| 70 | 3300005335 | Ga0070666_10000010 | Ga0070666_1000001075 | 140 |
| 71 | 3300005335 | Ga0070666_10009766 | Ga0070666_100097663 | 140 |
| 72 | 3300005335 | Ga0070666_10130229 | Ga0070666_101302293 | 140 |
| 73 | 3300005335 | Ga0070666_10592139 | Ga0070666_105921391 | 140 |
| 74 | 3300005337 | Ga0070682_100269304 | Ga0070682_1002693042 | 140 |
| 75 | 3300005338 | Ga0068868_100411065 | Ga0068868_1004110652 | 140 |
| 76 | 3300005338 | Ga0068868_101063192 | Ga0068868_1010631922 | 140 |
| 77 | 3300005338 | Ga0068868_101691458 | Ga0068868_1016914581 | 140 |
| 78 | 3300005340 | Ga0070689_100374982 | Ga0070689_1003749822 | 140 |
| 79 | 3300005343 | Ga0070687_100793539 | Ga0070687_1007935391 | 140 |
| 80 | 3300005344 | Ga0070661_100043094 | Ga0070661_1000430942 | 140 |
| 81 | 3300005344 | Ga0070661_100059304 | Ga0070661_1000593042 | 140 |
| 82 | 3300005344 | Ga0070661_101026305 | Ga0070661_1010263051 | 140 |
| 83 | 3300005353 | Ga0070669_100043121 | Ga0070669_1000431212 | 140 |
| 84 | 3300005353 | Ga0070669_100351410 | Ga0070669_1003514102 | 140 |
| 85 | 3300005353 | Ga0070669_101754762 | Ga0070669_1017547621 | 140 |
| 86 | 3300005355 | Ga0070671_100142214 | Ga0070671_1001422142 | 140 |
| 87 | 3300005356 | Ga0070674_100077765 | Ga0070674_1000777652 | 140 |
| 88 | 3300005365 | Ga0070688_100603109 | Ga0070688_1006031092 | 140 |
| 89 | 3300005367 | Ga0070667_100030034 | Ga0070667_1000300344 | 140 |
| 90 | 3300005367 | Ga0070667_100569759 | Ga0070667_1005697591 | 140 |
| 91 | 3300005367 | Ga0070667_100746510 | Ga0070667_1007465101 | 140 |
| 92 | 3300005445 | Ga0070708_101419323 | Ga0070708_1014193231 | 140 |
| 93 | 3300005455 | Ga0070663_100466944 | Ga0070663_1004669441 | 140 |
| 94 | 3300005455 | Ga0070663_100529108 | Ga0070663_1005291081 | 140 |
| 95 | 3300005458 | Ga0070681_10720395 | Ga0070681_107203952 | 140 |
| 96 | 3300005459 | Ga0068867_100018425 | Ga0068867_1000184254 | 140 |
| 97 | 3300005466 | Ga0070685_10002722 | Ga0070685_100027224 | 140 |
| 98 | 3300005466 | Ga0070685_10497195 | Ga0070685_104971952 | 140 |
| 99 | 3300005535 | Ga0070684_100548772 | Ga0070684_1005487722 | 140 |
| 100 | 3300005535 | Ga0070684_100885801 | Ga0070684_1008858011 | 140 |
| 101 | 3300005539 | Ga0068853_100009166 | Ga0068853_10000916610 | 140 |
| 102 | 3300005539 | Ga0068853_100038729 | Ga0068853_1000387291 | 140 |
| 103 | 3300005539 | Ga0068853_100063863 | Ga0068853_1000638633 | 140 |
| 104 | 3300005539 | Ga0068853_100704291 | Ga0068853_1007042911 | 140 |
| 105 | 3300005543 | Ga0070672_100023622 | Ga0070672_1000236222 | 140 |
| 106 | 3300005546 | Ga0070696_100007990 | Ga0070696_1000079902 | 140 |
| 107 | 3300005547 | Ga0070693_100083515 | Ga0070693_1000835152 | 140 |
| 108 | 3300005548 | Ga0070665_100018056 | Ga0070665_1000180563 | 140 |
| 109 | 3300005563 | Ga0068855_100031911 | Ga0068855_1000319116 | 140 |
| 110 | 3300005563 | Ga0068855_100090012 | Ga0068855_1000900123 | 140 |
| 111 | 3300005563 | Ga0068855_100235164 | Ga0068855_1002351642 | 140 |
| 112 | 3300005563 | Ga0068855_100503727 | Ga0068855_1005037272 | 140 |
| 113 | 3300005564 | Ga0070664_100099568 | Ga0070664_1000995682 | 140 |
| 114 | 3300005577 | Ga0068857_101533451 | Ga0068857_1015334512 | 140 |
| 115 | 3300005578 | Ga0068854_100136240 | Ga0068854_1001362402 | 140 |
| 116 | 3300005578 | Ga0068854_100418379 | Ga0068854_1004183791 | 140 |
| 117 | 3300005578 | Ga0068854_100483548 | Ga0068854_1004835482 | 140 |
| 118 | 3300005578 | Ga0068854_100560470 | Ga0068854_1005604702 | 140 |
| 119 | 3300005614 | Ga0068856_100123182 | Ga0068856_1001231823 | 140 |
| 120 | 3300005614 | Ga0068856_100250708 | Ga0068856_1002507082 | 140 |
| 121 | 3300005614 | Ga0068856_101450455 | Ga0068856_1014504552 | 140 |
| 122 | 3300005616 | Ga0068852_100030539 | Ga0068852_1000305392 | 140 |
| 123 | 3300005616 | Ga0068852_101033354 | Ga0068852_1010333542 | 140 |
| 124 | 3300005617 | Ga0068859_100216447 | Ga0068859_1002164472 | 140 |
| 125 | 3300005617 | Ga0068859_101663637 | Ga0068859_1016636371 | 140 |
| 126 | 3300005617 | Ga0068859_102143091 | Ga0068859_1021430912 | 140 |
| 127 | 3300005618 | Ga0068864_100253558 | Ga0068864_1002535582 | 140 |
| 128 | 3300005718 | Ga0068866_10283677 | Ga0068866_102836771 | 140 |
| 129 | 3300005834 | Ga0068851_10113023 | Ga0068851_101130232 | 140 |
| 130 | 3300005834 | Ga0068851_10222117 | Ga0068851_102221172 | 140 |
| 131 | 3300005834 | Ga0068851_10541244 | Ga0068851_105412441 | 140 |
| 132 | 3300005841 | Ga0068863_100182168 | Ga0068863_1001821682 | 140 |
| 133 | 3300005842 | Ga0068858_100143154 | Ga0068858_1001431542 | 140 |
| 134 | 3300005842 | Ga0068858_100917176 | Ga0068858_1009171762 | 140 |
| 135 | 3300005843 | Ga0068860_100035575 | Ga0068860_1000355754 | 140 |
| 136 | 3300005843 | Ga0068860_100071262 | Ga0068860_1000712622 | 140 |
| 137 | 3300005843 | Ga0068860_100297550 | Ga0068860_1002975502 | 140 |
| 138 | 3300005844 | Ga0068862_102352450 | Ga0068862_1023524501 | 140 |
| 139 | 3300006186 | Ga0075369_10069715 | Ga0075369_100697151 | 140 |
| 140 | 3300006195 | Ga0075366_10784052 | Ga0075366_107840522 | 140 |
| 141 | 3300006237 | Ga0097621_100541453 | Ga0097621_1005414532 | 140 |
| 142 | 3300006881 | Ga0068865_101392412 | Ga0068865_1013924122 | 140 |
| 143 | 3300006931 | Ga0097620_100216452 | Ga0097620_1002164522 | 140 |
| 144 | 3300006931 | Ga0097620_101663678 | Ga0097620_1016636782 | 140 |
| 145 | 3300006931 | Ga0097620_102142474 | Ga0097620_1021424742 | 140 |
| 146 | 3300009092 | Ga0105250_10425649 | Ga0105250_104256492 | 140 |
| 147 | 3300009093 | Ga0105240_10001018 | Ga0105240_100010181 | 140 |
| 148 | 3300009093 | Ga0105240_10087817 | Ga0105240_100878172 | 140 |
| 149 | 3300009093 | Ga0105240_10263304 | Ga0105240_102633042 | 140 |
| 150 | 3300009101 | Ga0105247_10001112 | Ga0105247_1000111214 | 140 |
| 151 | 3300009148 | Ga0105243_11190053 | Ga0105243_111900532 | 140 |
| 152 | 3300009148 | Ga0105243_11191082 | Ga0105243_111910822 | 140 |
| 153 | 3300009174 | Ga0105241_10019696 | Ga0105241_100196962 | 140 |
| 154 | 3300009174 | Ga0105241_10038788 | Ga0105241_100387883 | 140 |
| 155 | 3300009174 | Ga0105241_10500597 | Ga0105241_105005971 | 140 |
| 156 | 3300009176 | Ga0105242_10182749 | Ga0105242_101827492 | 140 |
| 157 | 3300009545 | Ga0105237_10002033 | Ga0105237_1000203328 | 140 |
| 158 | 3300009545 | Ga0105237_10043540 | Ga0105237_100435404 | 140 |
| 159 | 3300009545 | Ga0105237_10092667 | Ga0105237_100926673 | 140 |
| 160 | 3300009545 | Ga0105237_10152140 | Ga0105237_101521402 | 140 |
| 161 | 3300009551 | Ga0105238_10000044 | Ga0105238_100000444 | 140 |
| 162 | 3300009551 | Ga0105238_10010487 | Ga0105238_100104876 | 140 |
| 163 | 3300009551 | Ga0105238_10090236 | Ga0105238_100902362 | 140 |
| 164 | 3300009551 | Ga0105238_10092536 | Ga0105238_100925362 | 140 |
| 165 | 3300009551 | Ga0105238_10163017 | Ga0105238_101630172 | 140 |
| 166 | 3300009551 | Ga0105238_10536271 | Ga0105238_105362711 | 140 |
| 167 | 3300009553 | Ga0105249_10278869 | Ga0105249_102788692 | 140 |
| 168 | 3300009553 | Ga0105249_10499394 | Ga0105249_104993942 | 140 |
| 169 | 3300010375 | Ga0105239_10007944 | Ga0105239_100079442 | 140 |
| 170 | 3300010375 | Ga0105239_10008836 | Ga0105239_100088363 | 140 |
| 171 | 3300010375 | Ga0105239_10093812 | Ga0105239_100938122 | 140 |
| 172 | 3300010375 | Ga0105239_10117133 | Ga0105239_101171332 | 140 |
| 173 | 3300010375 | Ga0105239_10366505 | Ga0105239_103665052 | 140 |
| 174 | 3300010375 | Ga0105239_11746963 | Ga0105239_117469632 | 140 |
| 175 | 3300012510 | Ga0157316_1056975 | Ga0157316_10569751 | 140 |
| 176 | 3300013100 | Ga0157373_10195058 | Ga0157373_101950582 | 140 |
| 177 | 3300013102 | Ga0157371_10041200 | Ga0157371_100412004 | 140 |
| 178 | 3300013102 | Ga0157371_10074037 | Ga0157371_100740372 | 140 |
| 179 | 3300013104 | Ga0157370_10016512 | Ga0157370_100165122 | 140 |
| 180 | 3300013104 | Ga0157370_10046842 | Ga0157370_100468426 | 140 |
| 181 | 3300013104 | Ga0157370_10068476 | Ga0157370_100684763 | 140 |
| 182 | 3300013104 | Ga0157370_10186143 | Ga0157370_101861432 | 140 |
| 183 | 3300013104 | Ga0157370_10470394 | Ga0157370_104703942 | 140 |
| 184 | 3300013104 | Ga0157370_10531759 | Ga0157370_105317591 | 140 |
| 185 | 3300013105 | Ga0157369_10000001 | Ga0157369_10000001330 | 140 |
| 186 | 3300013105 | Ga0157369_10005167 | Ga0157369_100051677 | 140 |
| 187 | 3300013105 | Ga0157369_10037014 | Ga0157369_100370144 | 140 |
| 188 | 3300013105 | Ga0157369_10188313 | Ga0157369_101883133 | 140 |
| 189 | 3300013105 | Ga0157369_10403657 | Ga0157369_104036572 | 140 |
| 190 | 3300013105 | Ga0157369_10500760 | Ga0157369_105007602 | 140 |
| 191 | 3300013297 | Ga0157378_10759466 | Ga0157378_107594662 | 140 |
| 192 | 3300013297 | Ga0157378_10782093 | Ga0157378_107820932 | 140 |
| 193 | 3300013306 | Ga0163162_10002334 | Ga0163162_100023349 | 140 |
| 194 | 3300013306 | Ga0163162_10399835 | Ga0163162_103998352 | 140 |
| 195 | 3300013306 | Ga0163162_10751278 | Ga0163162_107512782 | 140 |
| 196 | 3300013307 | Ga0157372_10000334 | Ga0157372_100003342 | 140 |
| 197 | 3300013307 | Ga0157372_10210999 | Ga0157372_102109992 | 140 |
| 198 | 3300013307 | Ga0157372_10301766 | Ga0157372_103017661 | 140 |
| 199 | 3300013307 | Ga0157372_10767188 | Ga0157372_107671882 | 140 |
| 200 | 3300013307 | Ga0157372_11166972 | Ga0157372_111669721 | 140 |
| 201 | 3300013308 | Ga0157375_10129893 | Ga0157375_101298932 | 140 |
| 202 | 3300014325 | Ga0163163_10092207 | Ga0163163_100922073 | 140 |
| 203 | 3300014326 | Ga0157380_10198376 | Ga0157380_101983762 | 140 |
| 204 | 3300014326 | Ga0157380_10829666 | Ga0157380_108296662 | 140 |
| 205 | 3300014497 | Ga0182008_10110894 | Ga0182008_101108942 | 140 |
| 206 | 3300014497 | Ga0182008_10398013 | Ga0182008_103980131 | 140 |
| 207 | 3300014969 | Ga0157376_10016913 | Ga0157376_100169134 | 140 |
| 208 | 3300014969 | Ga0157376_10831081 | Ga0157376_108310811 | 140 |
| 209 | 3300015261 | Ga0182006_1000031 | Ga0182006_1000031183 | 140 |
| 210 | 3300015261 | Ga0182006_1001647 | Ga0182006_10016473 | 140 |
| 211 | 3300015262 | Ga0182007_10006478 | Ga0182007_100064784 | 140 |
| 212 | 3300015265 | Ga0182005_1000095 | Ga0182005_10000953 | 140 |
| 213 | 3300015265 | Ga0182005_1000424 | Ga0182005_100042410 | 140 |
| 214 | 3300015265 | Ga0182005_1002838 | Ga0182005_10028382 | 140 |
| 215 | 3300015265 | Ga0182005_1103700 | Ga0182005_11037002 | 140 |
| 216 | 3300017792 | Ga0163161_10069048 | Ga0163161_100690482 | 140 |
| 217 | 3300017792 | Ga0163161_11065228 | Ga0163161_110652282 | 140 |
| 218 | 3300020070 | Ga0206356_11785061 | Ga0206356_117850612 | 140 |
| 219 | 3300020081 | Ga0206354_10206202 | Ga0206354_102062022 | 140 |
| 220 | 3300025206 | Ga0209435_103848 | Ga0209435_1038483 | 140 |
| 221 | 3300025207 | Ga0209760_100228 | Ga0209760_1002284 | 140 |
| 222 | 3300025224 | Ga0209784_100042 | Ga0209784_100042189 | 140 |
| 223 | 3300025228 | Ga0209672_109894 | Ga0209672_1098942 | 140 |
| 224 | 3300025231 | Ga0207427_100096 | Ga0207427_1000966 | 140 |
| 225 | 3300025233 | Ga0209437_100074 | Ga0209437_100074262 | 140 |
| 226 | 3300025242 | Ga0209258_100136 | Ga0209258_100136100 | 140 |
| 227 | 3300025246 | Ga0209646_1001322 | Ga0209646_10013225 | 140 |
| 228 | 3300025246 | Ga0209646_1004454 | Ga0209646_10044541 | 140 |
| 229 | 3300025250 | Ga0209026_1000072 | Ga0209026_10000726 | 140 |
| 230 | 3300025250 | Ga0209026_1002819 | Ga0209026_10028196 | 140 |
| 231 | 3300025254 | Ga0209148_1000036 | Ga0209148_1000036263 | 140 |
| 232 | 3300025256 | Ga0209759_1000833 | Ga0209759_100083314 | 140 |
| 233 | 3300025256 | Ga0209759_1011879 | Ga0209759_10118792 | 140 |
| 234 | 3300025261 | Ga0209233_1000040 | Ga0209233_1000040261 | 140 |
| 235 | 3300025272 | Ga0209455_1000071 | Ga0209455_1000071262 | 140 |
| 236 | 3300025272 | Ga0209455_1001940 | Ga0209455_10019402 | 140 |
| 237 | 3300025297 | Ga0209758_1015808 | Ga0209758_10158082 | 140 |
| 238 | 3300025303 | Ga0209051_1005458 | Ga0209051_10054586 | 140 |
| 239 | 3300025321 | Ga0207656_10411464 | Ga0207656_104114641 | 140 |
| 240 | 3300025711 | Ga0207696_1196624 | Ga0207696_11966241 | 140 |
| 241 | 3300025900 | Ga0207710_10118242 | Ga0207710_101182422 | 140 |
| 242 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002315 | 140 |
| 243 | 3300025903 | Ga0207680_10004776 | Ga0207680_100047764 | 140 |
| 244 | 3300025903 | Ga0207680_10522032 | Ga0207680_105220321 | 140 |
| 245 | 3300025903 | Ga0207680_10745781 | Ga0207680_107457811 | 140 |
| 246 | 3300025904 | Ga0207647_10008613 | Ga0207647_100086133 | 140 |
| 247 | 3300025904 | Ga0207647_10025790 | Ga0207647_100257902 | 140 |
| 248 | 3300025904 | Ga0207647_10386502 | Ga0207647_103865022 | 140 |
| 249 | 3300025907 | Ga0207645_10093054 | Ga0207645_100930542 | 140 |
| 250 | 3300025909 | Ga0207705_10003838 | Ga0207705_100038382 | 140 |
| 251 | 3300025909 | Ga0207705_10472434 | Ga0207705_104724341 | 140 |
| 252 | 3300025911 | Ga0207654_10011245 | Ga0207654_100112454 | 140 |
| 253 | 3300025912 | Ga0207707_10257421 | Ga0207707_102574212 | 140 |
| 254 | 3300025912 | Ga0207707_10376058 | Ga0207707_103760582 | 140 |
| 255 | 3300025913 | Ga0207695_10000082 | Ga0207695_10000082102 | 140 |
| 256 | 3300025913 | Ga0207695_10001153 | Ga0207695_1000115340 | 140 |
| 257 | 3300025913 | Ga0207695_10001726 | Ga0207695_1000172634 | 140 |
| 258 | 3300025913 | Ga0207695_10005034 | Ga0207695_1000503412 | 140 |
| 259 | 3300025914 | Ga0207671_10002307 | Ga0207671_1000230710 | 140 |
| 260 | 3300025914 | Ga0207671_10004076 | Ga0207671_100040762 | 140 |
| 261 | 3300025914 | Ga0207671_10014730 | Ga0207671_100147306 | 140 |
| 262 | 3300025914 | Ga0207671_10282053 | Ga0207671_102820534 | 140 |
| 263 | 3300025919 | Ga0207657_10011564 | Ga0207657_100115643 | 140 |
| 264 | 3300025919 | Ga0207657_10327967 | Ga0207657_103279672 | 140 |
| 265 | 3300025920 | Ga0207649_10003581 | Ga0207649_100035812 | 140 |
| 266 | 3300025920 | Ga0207649_10012978 | Ga0207649_100129783 | 140 |
| 267 | 3300025920 | Ga0207649_10296741 | Ga0207649_102967412 | 140 |
| 268 | 3300025920 | Ga0207649_10353327 | Ga0207649_103533272 | 140 |
| 269 | 3300025921 | Ga0207652_10010712 | Ga0207652_100107123 | 140 |
| 270 | 3300025924 | Ga0207694_10001235 | Ga0207694_1000123512 | 140 |
| 271 | 3300025924 | Ga0207694_10003810 | Ga0207694_100038109 | 140 |
| 272 | 3300025924 | Ga0207694_10030528 | Ga0207694_100305282 | 140 |
| 273 | 3300025924 | Ga0207694_10065985 | Ga0207694_100659854 | 140 |
| 274 | 3300025924 | Ga0207694_10105266 | Ga0207694_101052662 | 140 |
| 275 | 3300025924 | Ga0207694_10117264 | Ga0207694_101172642 | 140 |
| 276 | 3300025924 | Ga0207694_10237322 | Ga0207694_102373222 | 140 |
| 277 | 3300025924 | Ga0207694_10357358 | Ga0207694_103573582 | 140 |
| 278 | 3300025926 | Ga0207659_10389562 | Ga0207659_103895622 | 140 |
| 279 | 3300025932 | Ga0207690_10574671 | Ga0207690_105746712 | 140 |
| 280 | 3300025932 | Ga0207690_11177687 | Ga0207690_111776872 | 140 |
| 281 | 3300025935 | Ga0207709_10689482 | Ga0207709_106894822 | 140 |
| 282 | 3300025935 | Ga0207709_10794588 | Ga0207709_107945882 | 140 |
| 283 | 3300025938 | Ga0207704_10994577 | Ga0207704_109945771 | 140 |
| 284 | 3300025940 | Ga0207691_10001994 | Ga0207691_1000199415 | 140 |
| 285 | 3300025941 | Ga0207711_11076299 | Ga0207711_110762992 | 140 |
| 286 | 3300025944 | Ga0207661_10507298 | Ga0207661_105072982 | 140 |
| 287 | 3300025944 | Ga0207661_11623179 | Ga0207661_116231791 | 140 |
| 288 | 3300025949 | Ga0207667_10003998 | Ga0207667_1000399817 | 140 |
| 289 | 3300025949 | Ga0207667_10087611 | Ga0207667_100876113 | 140 |
| 290 | 3300025949 | Ga0207667_10335572 | Ga0207667_103355721 | 140 |
| 291 | 3300025949 | Ga0207667_11142678 | Ga0207667_111426782 | 140 |
| 292 | 3300025960 | Ga0207651_10294064 | Ga0207651_102940642 | 140 |
| 293 | 3300025961 | Ga0207712_10165427 | Ga0207712_101654272 | 140 |
| 294 | 3300025961 | Ga0207712_10192322 | Ga0207712_101923221 | 140 |
| 295 | 3300025972 | Ga0207668_10278861 | Ga0207668_102788613 | 140 |
| 296 | 3300025972 | Ga0207668_10464936 | Ga0207668_104649361 | 140 |
| 297 | 3300025981 | Ga0207640_10087443 | Ga0207640_100874432 | 140 |
| 298 | 3300025981 | Ga0207640_10277611 | Ga0207640_102776112 | 140 |
| 299 | 3300025981 | Ga0207640_10398079 | Ga0207640_103980792 | 140 |
| 300 | 3300025986 | Ga0207658_10119117 | Ga0207658_101191172 | 140 |
| 301 | 3300025986 | Ga0207658_10226172 | Ga0207658_102261722 | 140 |
| 302 | 3300025986 | Ga0207658_10885597 | Ga0207658_108855971 | 140 |
| 303 | 3300026023 | Ga0207677_10101390 | Ga0207677_101013902 | 140 |
| 304 | 3300026023 | Ga0207677_10978157 | Ga0207677_109781572 | 140 |
| 305 | 3300026035 | Ga0207703_10346213 | Ga0207703_103462132 | 140 |
| 306 | 3300026035 | Ga0207703_10486925 | Ga0207703_104869252 | 140 |
| 307 | 3300026035 | Ga0207703_10643126 | Ga0207703_106431262 | 140 |
| 308 | 3300026035 | Ga0207703_11341185 | Ga0207703_113411852 | 140 |
| 309 | 3300026041 | Ga0207639_10001104 | Ga0207639_1000110413 | 140 |
| 310 | 3300026067 | Ga0207678_10019842 | Ga0207678_100198422 | 140 |
| 311 | 3300026067 | Ga0207678_10056061 | Ga0207678_100560612 | 140 |
| 312 | 3300026067 | Ga0207678_10387956 | Ga0207678_103879562 | 140 |
| 313 | 3300026078 | Ga0207702_10000107 | Ga0207702_1000010758 | 140 |
| 314 | 3300026078 | Ga0207702_10118684 | Ga0207702_101186843 | 140 |
| 315 | 3300026088 | Ga0207641_10055796 | Ga0207641_100557962 | 140 |
| 316 | 3300026089 | Ga0207648_10050477 | Ga0207648_100504772 | 140 |
| 317 | 3300026116 | Ga0207674_10007061 | Ga0207674_1000706115 | 140 |
| 318 | 3300026116 | Ga0207674_10656847 | Ga0207674_106568472 | 140 |
| 319 | 3300026121 | Ga0207683_10094771 | Ga0207683_100947712 | 140 |
| 320 | 3300026142 | Ga0207698_10320226 | Ga0207698_103202262 | 140 |
| 321 | 3300026142 | Ga0207698_10419223 | Ga0207698_104192232 | 140 |
| 322 | 3300026142 | Ga0207698_10511207 | Ga0207698_105112072 | 140 |
| 323 | 3300026142 | Ga0207698_10597034 | Ga0207698_105970342 | 140 |
| 324 | 3300027471 | Ga0209995_1048973 | Ga0209995_10489732 | 140 |
| 325 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004313 | 140 |
| 326 | 3300028379 | Ga0268266_10336568 | Ga0268266_103365682 | 140 |
| 327 | 3300028380 | Ga0268265_10925974 | Ga0268265_109259742 | 140 |
| 328 | 3300028380 | Ga0268265_12103843 | Ga0268265_121038431 | 140 |
| 329 | 3300028381 | Ga0268264_10043071 | Ga0268264_100430713 | 140 |
| 330 | 3300028381 | Ga0268264_10260286 | Ga0268264_102602862 | 140 |
| 331 | 3300028381 | Ga0268264_10559883 | Ga0268264_105598832 | 140 |
| 332 | 3300031665 | Ga0316575_10112851 | Ga0316575_101128512 | 140 |
| 333 | 3300031824 | Ga0307413_10429579 | Ga0307413_104295792 | 140 |
| 334 | 3300031852 | Ga0307410_10962747 | Ga0307410_109627472 | 140 |
| 335 | 3300031911 | Ga0307412_10001086 | Ga0307412_100010862 | 140 |
| 336 | 3300032002 | Ga0307416_100683865 | Ga0307416_1006838652 | 140 |
| 337 | 3300032004 | Ga0307414_12123653 | Ga0307414_121236531 | 140 |
| 338 | 3300033180 | Ga0307510_10003865 | Ga0307510_100038655 | 140 |
| 339 | 3300033180 | Ga0307510_10031101 | Ga0307510_100311012 | 140 |
| 340 | 3300036401 | Ga0373937_0773577 | Ga0373937_0773577_329_754 | 140 |
| 341 | 3300037471 | Ga0395905_0123178 | Ga0395905_0123178_999_1421 | 140 |
| 342 | 3300037471 | Ga0395905_0735092 | Ga0395905_0735092_323_745 | 140 |
| 343 | 3300041452 | Ga0451793_1257150 | Ga0451793_1257150_608_1030 | 140 |
| 344 | 3300041452 | Ga0451793_1706500 | Ga0451793_1706500_4507_4929 | 140 |
| 345 | 3300041462 | Ga0451806_638448 | Ga0451806_638448_318_740 | 140 |
| 346 | 3300041491 | Ga0451833_0373143 | Ga0451833_0373143_188_610 | 140 |
| 347 | 3300041496 | Ga0451839_0100045 | Ga0451839_0100045_25_447 | 140 |
| 348 | 3300041512 | Ga0451853_2562865 | Ga0451853_2562865_192_614 | 140 |
| 349 | 3300042007 | Ga0439449_0052953 | Ga0439449_0052953_426_851 | 140 |
| 350 | 3300042128 | Ga0450897_015413 | Ga0450897_015413_204_626 | 140 |
| 351 | 3300042135 | Ga0450899_043533 | Ga0450899_043533_78_500 | 140 |
| 352 | 3300044658 | Ga0466972_0007808 | Ga0466972_0007808_4401_4823 | 140 |
| 353 | 3300044672 | Ga0466982_0000049 | Ga0466982_0000049_16595_17017 | 140 |
| 354 | 3300044735 | Ga0466968_0018469 | Ga0466968_0018469_526_948 | 140 |
| 355 | 3300044765 | Ga0466970_0000107 | Ga0466970_0000107_14908_15330 | 140 |
| 356 | 3300045049 | Ga0466959_0001905 | Ga0466959_0001905_5463_5885 | 140 |
| 357 | 3300045051 | Ga0451576_2239664 | Ga0451576_2239664_82_507 | 140 |
| 358 | 3300045976 | Ga0466967_1957753 | Ga0466967_1957753_101_523 | 140 |
| 359 | 3300046452 | Ga0495617_000120 | Ga0495617_000120_34570_34992 | 140 |
| 360 | 3300046452 | Ga0495617_000348 | Ga0495617_000348_21576_21998 | 140 |
| 361 | 3300046457 | Ga0495590_0033503 | Ga0495590_0033503_52_474 | 140 |
| 362 | 3300046460 | Ga0495638_0000498 | Ga0495638_0000498_35731_36153 | 140 |
| 363 | 3300046460 | Ga0495638_0006938 | Ga0495638_0006938_327_749 | 140 |
| 364 | 3300046460 | Ga0495638_0308317 | Ga0495638_0308317_292_714 | 140 |
| 365 | 3300046471 | Ga0495650_0000703 | Ga0495650_0000703_35907_36329 | 140 |
| 366 | 3300046471 | Ga0495650_0001015 | Ga0495650_0001015_15469_15891 | 140 |
| 367 | 3300046474 | Ga0495605_0242540 | Ga0495605_0242540_94_516 | 140 |
| 368 | 3300046491 | Ga0495584_0000688 | Ga0495584_0000688_14061_14483 | 140 |
| 369 | 3300046492 | Ga0495585_0000200 | Ga0495585_0000200_60434_60856 | 140 |
| 370 | 3300046492 | Ga0495585_0040680 | Ga0495585_0040680_393_815 | 140 |
| 371 | 3300046501 | Ga0495607_0000090 | Ga0495607_0000090_48056_48478 | 140 |
| 372 | 3300046501 | Ga0495607_0000244 | Ga0495607_0000244_21929_22351 | 140 |
| 373 | 3300046506 | Ga0495583_0005713 | Ga0495583_0005713_6832_7254 | 140 |
| 374 | 3300046507 | Ga0495606_0000218 | Ga0495606_0000218_63935_64357 | 140 |
| 375 | 3300046507 | Ga0495606_0001182 | Ga0495606_0001182_34822_35244 | 140 |
| 376 | 3300046507 | Ga0495606_0003799 | Ga0495606_0003799_206_628 | 140 |
| 377 | 3300046507 | Ga0495606_0046340 | Ga0495606_0046340_869_1291 | 140 |
| 378 | 3300046507 | Ga0495606_0060559 | Ga0495606_0060559_1271_1693 | 140 |
| 379 | 3300046513 | Ga0495616_0000006 | Ga0495616_0000006_198754_199176 | 140 |
| 380 | 3300046513 | Ga0495616_0007706 | Ga0495616_0007706_1453_1875 | 140 |
| 381 | 3300046515 | Ga0495620_0000806 | Ga0495620_0000806_1563_1985 | 140 |
| 382 | 3300046515 | Ga0495620_0001426 | Ga0495620_0001426_2816_3238 | 140 |
| 383 | 3300046518 | Ga0495631_0000820 | Ga0495631_0000820_17853_18275 | 140 |
| 384 | 3300046518 | Ga0495631_0256275 | Ga0495631_0256275_29_451 | 140 |
| 385 | 3300046519 | Ga0495632_0001202 | Ga0495632_0001202_19945_20367 | 140 |
| 386 | 3300046519 | Ga0495632_0005484 | Ga0495632_0005484_1577_1999 | 140 |
| 387 | 3300046519 | Ga0495632_0014200 | Ga0495632_0014200_1351_1773 | 140 |
| 388 | 3300046519 | Ga0495632_0323226 | Ga0495632_0323226_117_539 | 140 |
| 389 | 3300046520 | Ga0495637_0004114 | Ga0495637_0004114_6100_6522 | 140 |
| 390 | 3300046524 | Ga0495648_0002324 | Ga0495648_0002324_17194_17616 | 140 |
| 391 | 3300046524 | Ga0495648_0291529 | Ga0495648_0291529_313_735 | 140 |
| 392 | 3300046537 | Ga0495598_0049569 | Ga0495598_0049569_319_741 | 140 |
| 393 | 3300046538 | Ga0495609_0007830 | Ga0495609_0007830_3651_4073 | 140 |
| 394 | 3300046539 | Ga0495621_0053509 | Ga0495621_0053509_595_1017 | 140 |
| 395 | 3300046557 | Ga0495622_0463564 | Ga0495622_0463564_39_467 | 140 |
| 396 | 3300046616 | Ga0495668_0019485 | Ga0495668_0019485_1592_2014 | 140 |
| 397 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2551766_2552188 | 140 |
| 398 | 3300046648 | Ga0495611_0000126 | Ga0495611_0000126_17810_18232 | 140 |
| 399 | 3300046660 | Ga0495625_0000200 | Ga0495625_0000200_18945_19367 | 140 |
| 400 | 3300046660 | Ga0495625_0012267 | Ga0495625_0012267_1212_1634 | 140 |
| 401 | 3300046660 | Ga0495625_0013566 | Ga0495625_0013566_1830_2252 | 140 |
| 402 | 3300046660 | Ga0495625_0084294 | Ga0495625_0084294_217_639 | 140 |
| 403 | 3300046664 | Ga0495659_0112645 | Ga0495659_0112645_114_536 | 140 |
| 404 | 3300046665 | Ga0495661_0004199 | Ga0495661_0004199_271_693 | 140 |
| 405 | 3300046683 | Ga0495658_0582675 | Ga0495658_0582675_67_492 | 140 |
| 406 | 3300046691 | Ga0495670_0017452 | Ga0495670_0017452_1576_1998 | 140 |
| 407 | 3300046692 | Ga0495671_0000457 | Ga0495671_0000457_16964_17386 | 140 |
| 408 | 3300046694 | Ga0495649_0029432 | Ga0495649_0029432_295_717 | 140 |
| 409 | 3300046794 | Ga0495589_0000008 | Ga0495589_0000008_75967_76389 | 140 |
| 410 | 3300046810 | Ga0495660_0000129 | Ga0495660_0000129_62500_62922 | 140 |
| 411 | 3300046810 | Ga0495660_0000133 | Ga0495660_0000133_18743_19165 | 140 |
| 412 | 3300047320 | Ga0495672_0213061 | Ga0495672_0213061_477_902 | 140 |
| 413 | 3300047323 | Ga0495683_0002369 | Ga0495683_0002369_5075_5497 | 140 |
| 414 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_671455_671877 | 140 |
| 415 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_487969_488391 | 140 |
| 416 | 3300047469 | Ga0495673_0000041 | Ga0495673_0000041_100792_101214 | 140 |
| 417 | 3300047469 | Ga0495673_0003178 | Ga0495673_0003178_1705_2127 | 140 |
| 418 | 3300047470 | Ga0495681_0055785 | Ga0495681_0055785_178_600 | 140 |
| 419 | 3300047472 | Ga0495686_0001461 | Ga0495686_0001461_20836_21258 | 140 |
| 420 | 3300047472 | Ga0495686_0002504 | Ga0495686_0002504_15535_15957 | 140 |
| 421 | 3300047472 | Ga0495686_0003220 | Ga0495686_0003220_12387_12809 | 140 |
| 422 | 3300047472 | Ga0495686_0036155 | Ga0495686_0036155_77_499 | 140 |
| 423 | 3300048090 | Ga0495615_0022747 | Ga0495615_0022747_315_737 | 140 |
| 424 | 3300048904 | Ga0496101_1228785 | Ga0496101_1228785_143_565 | 140 |
| 425 | 3300048905 | Ga0496102_0468766 | Ga0496102_0468766_563_985 | 140 |
| 426 | 3300048907 | Ga0496104_0435350 | Ga0496104_0435350_758_1180 | 140 |
| 427 | 3300048909 | Ga0496106_0001625 | Ga0496106_0001625_166_588 | 140 |
| 428 | 3300048910 | Ga0496107_1317127 | Ga0496107_1317127_25_447 | 140 |
| 429 | 3300048912 | Ga0496109_0198204 | Ga0496109_0198204_126_548 | 140 |
| 430 | 3300048916 | Ga0496113_0068452 | Ga0496113_0068452_1853_2275 | 140 |
| 431 | 3300048919 | Ga0496116_0108572 | Ga0496116_0108572_708_1130 | 140 |
| 432 | 3300048920 | Ga0496117_0011047 | Ga0496117_0011047_7625_8047 | 140 |
| 433 | 3300048920 | Ga0496117_0291626 | Ga0496117_0291626_117_539 | 140 |
| 434 | 3300048920 | Ga0496117_0301581 | Ga0496117_0301581_238_660 | 140 |
| 435 | 3300048921 | Ga0496118_0000184 | Ga0496118_0000184_29411_29833 | 140 |
| 436 | 3300048921 | Ga0496118_0009622 | Ga0496118_0009622_3434_3856 | 140 |
| 437 | 3300048921 | Ga0496118_0101045 | Ga0496118_0101045_686_1108 | 140 |
| 438 | 3300048922 | Ga0496119_0018976 | Ga0496119_0018976_4584_5006 | 140 |
| 439 | 3300048923 | Ga0496120_0136130 | Ga0496120_0136130_141_563 | 140 |
| 440 | 3300048924 | Ga0496121_0001516 | Ga0496121_0001516_1552_1974 | 140 |
| 441 | 3300048924 | Ga0496121_0003543 | Ga0496121_0003543_20126_20548 | 140 |
| 442 | 3300048924 | Ga0496121_0013794 | Ga0496121_0013794_6925_7350 | 140 |
| 443 | 3300048924 | Ga0496121_0269998 | Ga0496121_0269998_94_516 | 140 |
| 444 | 3300048924 | Ga0496121_0308240 | Ga0496121_0308240_255_677 | 140 |
| 445 | 3300048924 | Ga0496121_0755599 | Ga0496121_0755599_44_466 | 140 |
| 446 | 3300048925 | Ga0496122_0348472 | Ga0496122_0348472_287_709 | 140 |
| 447 | 3300048926 | Ga0496123_0032853 | Ga0496123_0032853_3032_3454 | 140 |
| 448 | 3300048927 | Ga0496124_0000203 | Ga0496124_0000203_779_1201 | 140 |
| 449 | 3300048927 | Ga0496124_0000410 | Ga0496124_0000410_267_689 | 140 |
| 450 | 3300048927 | Ga0496124_0146256 | Ga0496124_0146256_191_613 | 140 |
| 451 | 3300048927 | Ga0496124_0667825 | Ga0496124_0667825_147_569 | 140 |
| 452 | 3300048928 | Ga0496125_0207659 | Ga0496125_0207659_155_577 | 140 |
| 453 | 3300048929 | Ga0496126_0032157 | Ga0496126_0032157_2422_2844 | 140 |
| 454 | 3300049459 | Ga0495678_000158 | Ga0495678_000158_64075_64497 | 140 |
| 455 | 3300049460 | Ga0495682_0002070 | Ga0495682_0002070_9153_9575 | 140 |
| 456 | 3300049460 | Ga0495682_0002462 | Ga0495682_0002462_3792_4214 | 140 |
| 457 | 3300049568 | Ga0501031_0240247 | Ga0501031_0240247_595_1017 | 140 |
| 458 | 3300049568 | Ga0501031_0540883 | Ga0501031_0540883_82_504 | 140 |
| 459 | 3300049569 | Ga0501032_0244632 | Ga0501032_0244632_104_526 | 140 |
| 460 | 3300049569 | Ga0501032_0829507 | Ga0501032_0829507_103_525 | 140 |
| 461 | 3300049570 | Ga0501033_0000430 | Ga0501033_0000430_32340_32762 | 140 |
| 462 | 3300049570 | Ga0501033_0074163 | Ga0501033_0074163_2041_2463 | 140 |
| 463 | 3300049571 | Ga0501034_0090605 | Ga0501034_0090605_84_506 | 140 |
| 464 | 3300049571 | Ga0501034_0901887 | Ga0501034_0901887_240_665 | 140 |
| 465 | 3300049572 | Ga0501036_0348340 | Ga0501036_0348340_665_1087 | 140 |
| 466 | 3300049572 | Ga0501036_0402219 | Ga0501036_0402219_74_496 | 140 |
| 467 | 3300049573 | Ga0501037_0557567 | Ga0501037_0557567_162_584 | 140 |
| 468 | 3300049574 | Ga0501038_0047067 | Ga0501038_0047067_3140_3562 | 140 |
| 469 | 3300049574 | Ga0501038_0408389 | Ga0501038_0408389_617_1039 | 140 |
| 470 | 3300049575 | Ga0501039_0899479 | Ga0501039_0899479_95_517 | 140 |
| 471 | 3300049578 | Ga0501042_0201658 | Ga0501042_0201658_109_531 | 140 |
| 472 | 3300049579 | Ga0501043_0069107 | Ga0501043_0069107_244_666 | 140 |
| 473 | 3300049579 | Ga0501043_0099531 | Ga0501043_0099531_319_741 | 140 |
| 474 | 3300049579 | Ga0501043_0122814 | Ga0501043_0122814_154_576 | 140 |
| 475 | 3300049579 | Ga0501043_0885757 | Ga0501043_0885757_34_465 | 140 |
| 476 | 3300049581 | Ga0501047_0103246 | Ga0501047_0103246_131_553 | 140 |
| 477 | 3300049581 | Ga0501047_1075400 | Ga0501047_1075400_54_485 | 140 |
| 478 | 3300049582 | Ga0501048_0139468 | Ga0501048_0139468_592_1014 | 140 |
| 479 | 3300049586 | Ga0501070_0212318 | Ga0501070_0212318_557_979 | 140 |
| 480 | 3300049586 | Ga0501070_0387628 | Ga0501070_0387628_73_495 | 140 |
| 481 | 3300049586 | Ga0501070_0988530 | Ga0501070_0988530_167_589 | 140 |
| 482 | 3300049589 | Ga0501073_0196943 | Ga0501073_0196943_876_1298 | 140 |
| 483 | 3300049742 | Ga0501080_0154871 | Ga0501080_0154871_1620_2042 | 140 |
| 484 | 3300049822 | Ga0501035_0009267 | Ga0501035_0009267_926_1348 | 140 |
| 485 | 3300049822 | Ga0501035_0020916 | Ga0501035_0020916_5173_5595 | 140 |
| 486 | 3300049822 | Ga0501035_0164942 | Ga0501035_0164942_896_1318 | 140 |
| 487 | 3300049822 | Ga0501035_0279104 | Ga0501035_0279104_74_496 | 140 |
| 488 | 3300049822 | Ga0501035_0724258 | Ga0501035_0724258_133_555 | 140 |
| 489 | 3300049823 | Ga0501044_0136563 | Ga0501044_0136563_265_687 | 140 |
| 490 | 3300049823 | Ga0501044_0145462 | Ga0501044_0145462_830_1252 | 140 |
| 491 | 3300049823 | Ga0501044_0191900 | Ga0501044_0191900_1130_1552 | 140 |
| 492 | 3300049823 | Ga0501044_0823967 | Ga0501044_0823967_128_550 | 140 |
| 493 | 3300050493 | nmdc:mga0k408_857870_c1 | nmdc:mga0k408_857870_c1_22_444 | 140 |
| 494 | 3300050516 | nmdc:mga0sz30_217682_c1 | nmdc:mga0sz30_217682_c1_281_703 | 140 |
| 495 | 3300053087 | Ga0500643_000140 | Ga0500643_000140_50385_50807 | 140 |
| 496 | 3300053103 | Ga0500555_000251 | Ga0500555_000251_1341_1763 | 140 |
| 497 | 3300053120 | Ga0500597_351409 | Ga0500597_351409_27_455 | 140 |
| 498 | 3300053131 | Ga0500652_289215 | Ga0500652_289215_194_616 | 140 |
| 499 | 3300053160 | Ga0500633_0008839 | Ga0500633_0008839_1670_2092 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sxu-assembly1.cif.gz_A | structure of the e. coli ssb-dna polymerase iii interface | 0.9106 | 3 | 140 |
| 3sxu-assembly1.cif.gz_A | structure of the e. coli ssb-dna polymerase iii interface | 0.8921 | 3 | 140 |
| 4ern-assembly1.cif.gz_A | crystal structure of the c-terminal domain of human xpb/ercc-3 excision repair protein at 1.80 a | 0.7196 | 2 | 140 |
| 4c30-assembly1.cif.gz_A | crystal structure of deinococcus radiodurans uvrd in complex with dna, form 2 | 0.7161 | 3 | 68 |
| 4ern-assembly1.cif.gz_A | crystal structure of the c-terminal domain of human xpb/ercc-3 excision repair protein at 1.80 a | 0.7105 | 2 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1em8C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi | 0.9004 | 1 | 140 | 3.40.50.10110 |
| 1em8C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi | 0.8944 | 1 | 140 | 3.40.50.10110 |
| af_A0A140LFS6_48_320_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8104 | 16 | 82 | 3.40.50.300 |
| af_Q12039_8_270_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7663 | 3 | 58 | 3.40.50.300 |
| af_Q59MW2_423_606_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7481 | 15 | 140 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534AFP5-F1-model_v4 | DNA polymerase III subunit chi | 0.9927 | 1 | 140 |
GO:0003677
GO:0003887 GO:0006260 GO:0032298 |
| AF-Q4VJV4-F1-model_v4 | HolC | 0.9801 | 17 | 128 |
GO:0003677
GO:0003887 GO:0006260 GO:0032298 |
| AF-A0A1B3WB96-F1-model_v4 | DNA polymerase III subunit chi | 0.978 | 20 | 140 |
GO:0003677
GO:0003887 GO:0006260 GO:0032298 |
| AF-Q4VJV1-F1-model_v4 | HolC | 0.9736 | 23 | 128 |
GO:0003677
GO:0003887 GO:0006260 GO:0032298 |
| AF-T0YM01-F1-model_v4 | DNA polymerase III chi subunit, HolC (EC 2.7.7.7) | 0.9627 | 46 | 140 |
GO:0003677
GO:0003887 GO:0006260 GO:0032298 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar