F455325

General Info

Members Datasets Scaffolds Average Seq Length
499 233 998 252

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10001900|Ga0070709_100019004
Length 291
Sequence VTSEPQLAGQTVVVIGGSSGIGMETARRAAQEGADVIIVGRHADRLKQAAAEVGARDTAAFDATDQAALSGFFAGLPGPVDHVLVTGPGPYYAPLAELTRDRGQLDWDHHIWLPVAVAQQAVGRVRPGGTLLFMGGTRGGGRGPGLALIAANSAALPALIANLAIEIAPIRVNLIAAGFVDSPLSATLLGADLDKRRAQLRATLPIRRVVEPADVAALAVHLMINTAVTGATYDIDGGQQLLPGELRGARSAGRHHHRRLQGHRRGRGGRVPRARLGGGRHCPQDQAVGSR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
115 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.2
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 9.42
Rhizosphere 87.78
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10001900 3300005434 Bacteria 11346
2 Ga0065707_10100367 3300005295 Bacteria 2930
3 Ga0070658_10603961 3300005327 Bacteria 951
4 Ga0070683_100246528 3300005329 Bacteria 1699
5 Ga0070690_100287641 3300005330 Bacteria 1175
6 Ga0070670_100576925 3300005331 Bacteria 1005
7 Ga0068869_100375672 3300005334 Bacteria 1164
8 Ga0068868_100272607 3300005338 Bacteria 1430
9 Ga0068868_100592631 3300005338 Bacteria 981
10 Ga0070689_100215801 3300005340 Bacteria 1572
11 Ga0070692_10209244 3300005345 Bacteria 1147
12 Ga0070671_100000223 3300005355 Bacteria 37776
13 Ga0070671_100374750 3300005355 Bacteria 1216
14 Ga0070674_100297117 3300005356 Bacteria 1286
15 Ga0070709_10451529 3300005434 Bacteria 968
16 Ga0070714_100665942 3300005435 Bacteria 1003
17 Ga0070713_100035040 3300005436 Bacteria 4038
18 Ga0070713_100262722 3300005436 Bacteria 1578
19 Ga0070710_10088893 3300005437 Bacteria 1818
20 Ga0070710_10186453 3300005437 Bacteria 1302
21 Ga0070710_10322561 3300005437 Bacteria 1014
22 Ga0070711_100000001 3300005439 Bacteria 370591
23 Ga0070711_100013818 3300005439 Bacteria 5077
24 Ga0070711_100044295 3300005439 Bacteria 3020
25 Ga0070711_100159333 3300005439 Bacteria 1710
26 Ga0070711_100461157 3300005439 Bacteria 1042
27 Ga0070711_100660729 3300005439 Unclassified 877
28 Ga0070694_100279228 3300005444 Bacteria 1273
29 Ga0070694_100384926 3300005444 Bacteria 1095
30 Ga0070681_10132661 3300005458 Bacteria 2422
31 Ga0070706_100504254 3300005467 Bacteria 1126
32 Ga0070698_100000814 3300005471 Bacteria 34041
33 Ga0070698_100050909 3300005471 Bacteria 4219
34 Ga0070699_100000012 3300005518 Bacteria 246521
35 Ga0070684_100014787 3300005535 Bacteria 6333
36 Ga0070684_100260669 3300005535 Bacteria 1586
37 Ga0070686_100078424 3300005544 Bacteria 2181
38 Ga0070665_100286554 3300005548 Bacteria 1649
39 Ga0068855_100578533 3300005563 Bacteria 1213
40 Ga0070664_100185316 3300005564 Bacteria 1852
41 Ga0068854_100534781 3300005578 Bacteria 992
42 Ga0068856_100001346 3300005614 Bacteria 25824
43 Ga0068856_100040412 3300005614 Bacteria 4582
44 Ga0068856_100419331 3300005614 Bacteria 1358
45 Ga0068856_100527987 3300005614 Bacteria 1201
46 Ga0068864_100410080 3300005618 Bacteria 1289
47 Ga0068863_100023233 3300005841 Bacteria 5925
48 Ga0068863_100035836 3300005841 Bacteria 4724
49 Ga0081455_10001838 3300005937 Bacteria 25533
50 Ga0081455_10003753 3300005937 Bacteria 17355
51 Ga0070717_10003371 3300006028 Bacteria 11415
52 Ga0075365_10041544 3300006038 Bacteria 3005
53 Ga0070715_10106929 3300006163 Bacteria 1314
54 Ga0070716_100123770 3300006173 Bacteria 1623
55 Ga0070716_100150726 3300006173 Bacteria 1495
56 Ga0070712_100004311 3300006175 Bacteria 8759
57 Ga0070712_100027465 3300006175 Bacteria 3801
58 Ga0070712_100038626 3300006175 Bacteria 3263
59 Ga0070712_100250540 3300006175 Bacteria 1415
60 Ga0070712_100338618 3300006175 Bacteria 1227
61 Ga0097621_100006419 3300006237 Bacteria 8345
62 Ga0097621_100465400 3300006237 Bacteria 1141
63 Ga0068871_100125195 3300006358 Bacteria 2175
64 Ga0068871_100134469 3300006358 Bacteria 2099
65 Ga0075428_100044465 3300006844 Bacteria 4880
66 Ga0075431_100033564 3300006847 Bacteria 5289
67 Ga0075431_100675019 3300006847 Bacteria 1012
68 Ga0075433_10007972 3300006852 Bacteria 8433
69 Ga0075433_10299486 3300006852 Bacteria 1424
70 Ga0075434_100007912 3300006871 Bacteria 9852
71 Ga0075434_100171403 3300006871 Bacteria 2190
72 Ga0075429_100068083 3300006880 Bacteria 3098
73 Ga0075436_100002603 3300006914 Bacteria 12393
74 Ga0075436_100127999 3300006914 Bacteria 1779
75 Ga0075435_100005320 3300007076 Bacteria 8965
76 Ga0075435_100081163 3300007076 Bacteria 2664
77 Ga0075435_100162719 3300007076 Bacteria 1880
78 Ga0075435_100290824 3300007076 Bacteria 1396
79 Ga0075435_100352509 3300007076 Bacteria 1261
80 Ga0111539_10003578 3300009094 Bacteria 20479
81 Ga0111539_10106402 3300009094 Bacteria 3291
82 Ga0111539_10495664 3300009094 Bacteria 1423
83 Ga0105245_10010107 3300009098 Bacteria 8220
84 Ga0105245_10249428 3300009098 Bacteria 1724
85 Ga0105245_10408470 3300009098 Bacteria 1358
86 Ga0114129_10001503 3300009147 Bacteria 31564
87 Ga0114129_10301098 3300009147 Bacteria 2137
88 Ga0114129_10501775 3300009147 Bacteria 1585
89 Ga0105243_10284549 3300009148 Bacteria 1491
90 Ga0105243_10622788 3300009148 Bacteria 1042
91 Ga0105241_10245972 3300009174 Bacteria 1514
92 Ga0105242_10030550 3300009176 Bacteria 4302
93 Ga0105238_10028025 3300009551 Bacteria 5739
94 Ga0105239_10307800 3300010375 Bacteria 1785
95 Ga0105239_10634883 3300010375 Unclassified 1219
96 Ga0105239_10664476 3300010375 Bacteria 1190
97 Ga0157369_10001255 3300013105 Bacteria 31570
98 Ga0157369_10080868 3300013105 Bacteria 3478
99 Ga0157369_10646726 3300013105 Unclassified 1090
100 Ga0157374_10009117 3300013296 Bacteria 8502
101 Ga0163162_10948282 3300013306 Bacteria 972
102 Ga0157375_10545816 3300013308 Bacteria 1321
103 Ga0163163_10329651 3300014325 Bacteria 1581
104 Ga0182008_10027365 3300014497 Bacteria 2890
105 Ga0157376_10131148 3300014969 Bacteria 2236
106 Ga0157376_10205865 3300014969 Bacteria 1813
107 Ga0157376_10380219 3300014969 Bacteria 1360
108 Ga0157376_10392067 3300014969 Bacteria 1340
109 Ga0207426_1072345 3300025302 Bacteria 957
110 Ga0207692_10024116 3300025898 Bacteria 2823
111 Ga0207692_10045361 3300025898 Bacteria 2198
112 Ga0207692_10152934 3300025898 Bacteria 1323
113 Ga0207680_10094887 3300025903 Bacteria 1905
114 Ga0207699_10004193 3300025906 Bacteria 6900
115 Ga0207699_10040435 3300025906 Bacteria 2687
116 Ga0207699_10068786 3300025906 Bacteria 2157
117 Ga0207705_10409995 3300025909 Bacteria 1048
118 Ga0207707_10054412 3300025912 Bacteria 3484
119 Ga0207693_10044988 3300025915 Bacteria 3468
120 Ga0207693_10052822 3300025915 Bacteria 3187
121 Ga0207693_10182982 3300025915 Bacteria 1649
122 Ga0207693_10227067 3300025915 Bacteria 1466
123 Ga0207693_10262560 3300025915 Bacteria 1354
124 Ga0207693_10561735 3300025915 Bacteria 889
125 Ga0207663_10000001 3300025916 Bacteria 591990
126 Ga0207660_10252075 3300025917 Bacteria 1393
127 Ga0207652_10372770 3300025921 Bacteria 1288
128 Ga0207681_10041590 3300025923 Bacteria 3065
129 Ga0207694_10054598 3300025924 Bacteria 3100
130 Ga0207687_10133192 3300025927 Bacteria 1876
131 Ga0207700_10037170 3300025928 Bacteria 3524
132 Ga0207700_10182735 3300025928 Bacteria 1757
133 Ga0207700_10265787 3300025928 Bacteria 1470
134 Ga0207700_10454532 3300025928 Bacteria 1129
135 Ga0207700_10471189 3300025928 Bacteria 1109
136 Ga0207664_10012543 3300025929 Bacteria 6065
137 Ga0207664_10673937 3300025929 Bacteria 930
138 Ga0207644_10000876 3300025931 Bacteria 18994
139 Ga0207644_10152176 3300025931 Bacteria 1791
140 Ga0207690_10020964 3300025932 Bacteria 4047
141 Ga0207706_10311341 3300025933 Bacteria 1371
142 Ga0207686_10257968 3300025934 Bacteria 1277
143 Ga0207669_10073955 3300025937 Bacteria 2153
144 Ga0207704_10358222 3300025938 Bacteria 1138
145 Ga0207665_10014979 3300025939 Bacteria 5093
146 Ga0207665_10352138 3300025939 Bacteria 1112
147 Ga0207689_10324479 3300025942 Bacteria 1278
148 Ga0207661_10078157 3300025944 Bacteria 2723
149 Ga0207661_10383304 3300025944 Bacteria 1273
150 Ga0207679_10083927 3300025945 Bacteria 2443
151 Ga0207640_10285429 3300025981 Bacteria 1299
152 Ga0207677_10353554 3300026023 Bacteria 1232
153 Ga0207702_10020816 3300026078 Bacteria 5426
154 Ga0207702_10126712 3300026078 Bacteria 2293
155 Ga0207702_10460513 3300026078 Bacteria 1235
156 Ga0207641_10003036 3300026088 Bacteria 15125
157 Ga0207641_10025233 3300026088 Bacteria 4902
158 Ga0207676_10393722 3300026095 Bacteria 1293
159 Ga0207683_10010808 3300026121 Bacteria 7783
160 Ga0207698_10124440 3300026142 Bacteria 2190
161 Ga0207698_10524317 3300026142 Bacteria 1157
162 Ga0207428_10001136 3300027907 Bacteria 28891
163 Ga0268266_10244094 3300028379 Bacteria 1659
164 Ga0268265_10558236 3300028380 Bacteria 1088
165 Ga0265337_1000212 3300028556 Bacteria 31295
166 Ga0265326_10000396 3300028558 Bacteria 17493
167 Ga0265319_1005790 3300028563 Bacteria 5841
168 Ga0265334_10000275 3300028573 Bacteria 28899
169 Ga0265318_10019984 3300028577 Bacteria 2710
170 Ga0265323_10003017 3300028653 Bacteria 7512
171 Ga0265336_10003315 3300028666 Bacteria 6339
172 Ga0265338_10002068 3300028800 Bacteria 30992
173 Ga0265338_10016501 3300028800 Bacteria 8030
174 Ga0265324_10002106 3300029957 Bacteria 10504
175 Ga0265330_10106639 3300031235 Bacteria 1198
176 Ga0265332_10013420 3300031238 Bacteria 3630
177 Ga0265320_10011086 3300031240 Bacteria 5321
178 Ga0265325_10033121 3300031241 Bacteria 2755
179 Ga0265340_10002152 3300031247 Bacteria 11308
180 Ga0265339_10016550 3300031249 Bacteria 4393
181 Ga0265316_10058868 3300031344 Bacteria 2990
182 Ga0265316_10082779 3300031344 Bacteria 2459
183 Ga0265314_10004284 3300031711 Bacteria 13329
184 Ga0265342_10004292 3300031712 Bacteria 11289
185 Ga0316215_1008752 3300033544 Bacteria 996
186 Ga0316214_1002361 3300033545 Bacteria 2321
187 Ga0373926_0004526 3300035083 Bacteria 4565
188 Ga0373926_0012768 3300035083 Bacteria 2843
189 Ga0373926_0030973 3300035083 Bacteria 1885
190 Ga0373926_0065648 3300035083 Bacteria 1328
191 Ga0373934_0024020 3300035086 Bacteria 2357
192 Ga0373944_0003218 3300035089 Bacteria 4194
193 Ga0373944_0003235 3300035089 Bacteria 4186
194 Ga0373923_0003922 3300035111 Bacteria 4855
195 Ga0373936_0000176 3300035113 Bacteria 21305
196 Ga0373936_0016845 3300035113 Bacteria 2811
197 Ga0373945_0003774 3300035116 Bacteria 4783
198 Ga0373945_0015140 3300035116 Bacteria 2592
199 Ga0373945_0034095 3300035116 Bacteria 1812
200 Ga0373953_0002039 3300035117 Bacteria 6013
201 Ga0373953_0011228 3300035117 Bacteria 3139
202 Ga0373953_0017130 3300035117 Bacteria 2658
203 Ga0373954_0024814 3300035118 Bacteria 2735
204 Ga0373954_0059520 3300035118 Bacteria 1800
205 Ga0373954_0141732 3300035118 Bacteria 1172
206 Ga0373956_0003149 3300035119 Bacteria 6672
207 Ga0373956_0003384 3300035119 Bacteria 6425
208 Ga0373956_0036724 3300035119 Bacteria 2163
209 Ga0373943_0002414 3300035170 Bacteria 8473
210 Ga0373943_0005227 3300035170 Bacteria 5842
211 Ga0373946_0000238 3300035171 Bacteria 17241
212 Ga0373946_0009107 3300035171 Bacteria 3654
213 Ga0373955_0001273 3300035172 Bacteria 10719
214 Ga0373955_0008149 3300035172 Bacteria 4849
215 Ga0373955_0016648 3300035172 Bacteria 3622
216 Ga0373955_0021881 3300035172 Bacteria 3235
217 Ga0373955_0048528 3300035172 Bacteria 2302
218 Ga0373961_0036423 3300035241 Bacteria 1401
219 Ga0373924_0014419 3300035410 Bacteria 2987
220 Ga0373924_0025680 3300035410 Bacteria 2329
221 Ga0373924_0039823 3300035410 Bacteria 1921
222 Ga0373924_0157052 3300035410 Bacteria 996
223 Ga0373931_0016839 3300035691 Bacteria 3605
224 Ga0373931_0042089 3300035691 Bacteria 2401
225 Ga0373931_0357200 3300035691 Bacteria 916
226 Ga0373935_0006367 3300035692 Bacteria 7042
227 Ga0373935_0160589 3300035692 Bacteria 1531
228 Ga0373927_0004614 3300035695 Bacteria 9605
229 Ga0373927_0034369 3300035695 Bacteria 3298
230 Ga0373927_0270115 3300035695 Bacteria 1118
231 Ga0373933_0005217 3300035724 Bacteria 7088
232 Ga0373933_0011228 3300035724 Bacteria 4930
233 Ga0373933_0087720 3300035724 Bacteria 1916
234 Ga0373933_0161809 3300035724 Bacteria 1421
235 Ga0373947_0009099 3300035725 Bacteria 5707
236 Ga0373947_0167237 3300035725 Bacteria 1425
237 Ga0373937_0009466 3300036401 Bacteria 8469
238 Ga0373937_0035571 3300036401 Bacteria 4534
239 Ga0373937_0119957 3300036401 Bacteria 2450
240 Ga0373937_0155437 3300036401 Bacteria 2143
241 Ga0373937_0194661 3300036401 Bacteria 1905
242 Ga0373937_0260507 3300036401 Bacteria 1635
243 Ga0372808_007336 3300036459 Bacteria 1505
244 Ga0373925_0000013 3300037068 Bacteria 188673
245 Ga0373925_0003614 3300037068 Bacteria 11917
246 Ga0373925_0048181 3300037068 Bacteria 3174
247 Ga0373925_0112912 3300037068 Bacteria 2101
248 Ga0373925_0188358 3300037068 Bacteria 1636
249 Ga0436364_0750936 3300037853 Bacteria 4722
250 Ga0436364_0876150 3300037853 Bacteria 7957
251 Ga0436364_1027626 3300037853 Bacteria 986
252 Ga0395901_0024748 3300038443 Bacteria 6164
253 Ga0395901_0129255 3300038443 Bacteria 2654
254 Ga0436365_0817830 3300039437 Bacteria 915
255 Ga0436360_0886661 3300039438 Bacteria 1356
256 Ga0436361_1039658 3300039447 Bacteria 1345
257 Ga0436363_0759490 3300039450 Bacteria 1467
258 Ga0436362_0473960 3300039453 Bacteria 1099
259 Ga0439464_0021076 3300042439 Bacteria 1788
260 Ga0453683_0101319 3300044673 Bacteria 1808
261 Ga0466964_0163477 3300044706 Bacteria 1042
262 Ga0466960_0101370 3300044901 Bacteria 1483
263 Ga0466967_0034184 3300045976 Bacteria 4312
264 Ga0466967_0100011 3300045976 Bacteria 2649
265 Ga0466967_0215261 3300045976 Bacteria 1823
266 Ga0466967_0507200 3300045976 Unclassified 1184
267 Ga0466967_0593689 3300045976 Bacteria 1093
268 Ga0495592_0023841 3300046454 Bacteria 4654
269 Ga0495603_0000661 3300046455 Bacteria 19477
270 Ga0495590_0152941 3300046457 Bacteria 837
271 Ga0495629_0002801 3300046459 Bacteria 13294
272 Ga0495629_0166318 3300046459 Bacteria 1531
273 Ga0495641_0001407 3300046461 Bacteria 20458
274 Ga0495651_0019365 3300046462 Bacteria 5275
275 Ga0495651_0040931 3300046462 Bacteria 3600
276 Ga0495651_0120802 3300046462 Bacteria 1925
277 Ga0495651_0125999 3300046462 Bacteria 1875
278 Ga0495653_0009101 3300046463 Bacteria 8121
279 Ga0495653_0027372 3300046463 Bacteria 4562
280 Ga0495653_0064792 3300046463 Bacteria 2752
281 Ga0495653_0068382 3300046463 Bacteria 2664
282 Ga0495653_0144692 3300046463 Bacteria 1667
283 Ga0495580_0000002 3300046472 Bacteria 121311
284 Ga0495580_0179137 3300046472 Bacteria 1464
285 Ga0495582_0002623 3300046473 Bacteria 10014
286 Ga0495582_0011577 3300046473 Bacteria 4861
287 Ga0495582_0017634 3300046473 Bacteria 3906
288 Ga0495639_0025760 3300046475 Bacteria 2595
289 Ga0495662_0001838 3300046476 Bacteria 10636
290 Ga0495664_0001827 3300046477 Bacteria 11300
291 Ga0495664_0018238 3300046477 Bacteria 4017
292 Ga0495664_0105632 3300046477 Bacteria 1697
293 Ga0495664_0136599 3300046477 Bacteria 1485
294 Ga0495594_0043389 3300046499 Bacteria 2465
295 Ga0495608_0011910 3300046511 Bacteria 6049
296 Ga0495608_0020833 3300046511 Bacteria 4504
297 Ga0495608_0043508 3300046511 Bacteria 3000
298 Ga0495608_0049512 3300046511 Bacteria 2789
299 Ga0495608_0129273 3300046511 Bacteria 1617
300 Ga0495618_0013100 3300046514 Bacteria 5042
301 Ga0495618_0016767 3300046514 Bacteria 4486
302 Ga0495618_0065801 3300046514 Bacteria 2303
303 Ga0495618_0088414 3300046514 Bacteria 1981
304 Ga0495628_0020066 3300046516 Bacteria 5516
305 Ga0495628_0027226 3300046516 Bacteria 4654
306 Ga0495628_0083352 3300046516 Bacteria 2482
307 Ga0495628_0178904 3300046516 Bacteria 1605
308 Ga0495628_0188466 3300046516 Bacteria 1558
309 Ga0495630_0000829 3300046517 Bacteria 21787
310 Ga0495630_0020705 3300046517 Bacteria 4852
311 Ga0495630_0030463 3300046517 Bacteria 4013
312 Ga0495630_0080997 3300046517 Bacteria 2450
313 Ga0495630_0333510 3300046517 Bacteria 1160
314 Ga0495666_0022362 3300046526 Bacteria 3131
315 Ga0495666_0078935 3300046526 Bacteria 1559
316 Ga0495666_0239699 3300046526 Bacteria 828
317 Ga0495652_0097874 3300046529 Bacteria 2385
318 Ga0495652_0237689 3300046529 Bacteria 1358
319 Ga0495652_0246655 3300046529 Bacteria 1325
320 Ga0495665_0024876 3300046531 Bacteria 3217
321 Ga0495665_0027765 3300046531 Bacteria 3037
322 Ga0495640_0030926 3300046533 Bacteria 3827
323 Ga0495640_0061841 3300046533 Bacteria 2542
324 Ga0495640_0112209 3300046533 Bacteria 1780
325 Ga0495586_0006621 3300046535 Bacteria 6187
326 Ga0495586_0014352 3300046535 Bacteria 4209
327 Ga0495586_0016020 3300046535 Bacteria 3988
328 Ga0495587_0077410 3300046536 Bacteria 1931
329 Ga0495587_0104681 3300046536 Bacteria 1628
330 Ga0495587_0171363 3300046536 Bacteria 1233
331 Ga0495587_0175703 3300046536 Bacteria 1215
332 Ga0495645_0025456 3300046543 Bacteria 4294
333 Ga0495645_0028207 3300046543 Bacteria 4078
334 Ga0495645_0034333 3300046543 Bacteria 3701
335 Ga0495645_0066481 3300046543 Bacteria 2605
336 Ga0495645_0124340 3300046543 Bacteria 1813
337 Ga0495667_0009893 3300046559 Bacteria 6458
338 Ga0495667_0010691 3300046559 Bacteria 6206
339 Ga0495667_0014691 3300046559 Bacteria 5291
340 Ga0495667_0034607 3300046559 Bacteria 3377
341 Ga0495667_0077821 3300046559 Bacteria 2156
342 Ga0495667_0142301 3300046559 Bacteria 1545
343 Ga0495634_0007951 3300046642 Bacteria 7911
344 Ga0495634_0009278 3300046642 Bacteria 7264
345 Ga0495634_0013531 3300046642 Bacteria 5894
346 Ga0495634_0079072 3300046642 Bacteria 2154
347 Ga0495634_0089506 3300046642 Bacteria 2000
348 Ga0495635_0000790 3300046663 Bacteria 20637
349 Ga0495657_0006712 3300046675 Bacteria 8976
350 Ga0495657_0030230 3300046675 Bacteria 3795
351 Ga0495657_0064863 3300046675 Bacteria 2403
352 Ga0495657_0068393 3300046675 Bacteria 2327
353 Ga0495599_0021615 3300046678 Bacteria 4015
354 Ga0495599_0029420 3300046678 Bacteria 3444
355 Ga0495599_0038118 3300046678 Bacteria 3019
356 Ga0495599_0051891 3300046678 Bacteria 2569
357 Ga0495623_0029880 3300046679 Bacteria 3506
358 Ga0495623_0097078 3300046679 Bacteria 1800
359 Ga0495646_0016519 3300046680 Bacteria 4685
360 Ga0495646_0028647 3300046680 Bacteria 3485
361 Ga0495646_0035307 3300046680 Bacteria 3102
362 Ga0495658_0053941 3300046683 Bacteria 2285
363 Ga0495658_0095669 3300046683 Bacteria 1765
364 Ga0495658_0207165 3300046683 Bacteria 1224
365 Ga0495669_0130560 3300046684 Bacteria 1182
366 Ga0495613_0006714 3300046689 Bacteria 8590
367 Ga0495613_0016929 3300046689 Bacteria 5428
368 Ga0495624_0005490 3300046690 Bacteria 9129
369 Ga0495624_0025498 3300046690 Bacteria 3880
370 Ga0495624_0099609 3300046690 Bacteria 1790
371 Ga0495600_0033504 3300046809 Bacteria 3335
372 Ga0495600_0068296 3300046809 Bacteria 2322
373 Ga0495600_0069574 3300046809 Bacteria 2300
374 Ga0495600_0166349 3300046809 Bacteria 1424
375 Ga0495581_0003601 3300047315 Bacteria 8913
376 Ga0495581_0016185 3300047315 Bacteria 4335
377 Ga0495581_0022148 3300047315 Bacteria 3682
378 Ga0495604_0042814 3300047317 Bacteria 3546
379 Ga0495604_0192186 3300047317 Bacteria 1421
380 Ga0495604_0289140 3300047317 Bacteria 1104
381 Ga0495674_0001735 3300047319 Bacteria 21427
382 Ga0495674_0092271 3300047319 Bacteria 2585
383 Ga0495674_0106327 3300047319 Bacteria 2383
384 Ga0495674_0120991 3300047319 Bacteria 2211
385 Ga0495674_0229350 3300047319 Bacteria 1533
386 Ga0495674_0331698 3300047319 Bacteria 1238
387 Ga0495674_0366848 3300047319 Bacteria 1167
388 Ga0495676_0107273 3300047321 Bacteria 2056
389 Ga0495676_0185973 3300047321 Bacteria 1452
390 Ga0495676_0215251 3300047321 Bacteria 1327
391 Ga0495680_0002044 3300047322 Bacteria 21126
392 Ga0495680_0092091 3300047322 Bacteria 2271
393 Ga0495680_0148310 3300047322 Bacteria 1711
394 Ga0495680_0178749 3300047322 Bacteria 1533
395 Ga0495680_0223398 3300047322 Bacteria 1343
396 Ga0495675_0011663 3300047444 Bacteria 5518
397 Ga0495675_0043832 3300047444 Bacteria 2849
398 Ga0495675_0217594 3300047444 Bacteria 1157
399 Ga0495684_0004433 3300047471 Bacteria 10974
400 Ga0495684_0011248 3300047471 Bacteria 6914
401 Ga0495684_0026282 3300047471 Bacteria 4472
402 Ga0495684_0045685 3300047471 Bacteria 3351
403 Ga0495684_0100014 3300047471 Bacteria 2192
404 Ga0495684_0160962 3300047471 Bacteria 1674
405 Ga0495593_0025160 3300047673 Bacteria 3294
406 Ga0495593_0039713 3300047673 Bacteria 2536
407 Ga0495593_0042249 3300047673 Bacteria 2447
408 Ga0495593_0050760 3300047673 Bacteria 2196
409 Ga0495602_0075279 3300048088 Bacteria 2865
410 Ga0495602_0113694 3300048088 Bacteria 2193
411 Ga0495602_0184108 3300048088 Bacteria 1608
412 Ga0495602_0267106 3300048088 Bacteria 1266
413 Ga0495614_0007195 3300048089 Bacteria 4960
414 Ga0495614_0019379 3300048089 Bacteria 2943
415 Ga0496100_0007800 3300048903 Bacteria 5937
416 Ga0496100_0022762 3300048903 Bacteria 3796
417 Ga0496100_0243504 3300048903 Bacteria 1328
418 Ga0496101_0001217 3300048904 Bacteria 15404
419 Ga0496101_0005126 3300048904 Bacteria 8329
420 Ga0496101_0313129 3300048904 Unclassified 1231
421 Ga0496101_0552028 3300048904 Bacteria 911
422 Ga0496102_0046945 3300048905 Bacteria 3923
423 Ga0496102_0290370 3300048905 Bacteria 1541
424 Ga0496102_0399839 3300048905 Bacteria 1292
425 Ga0496102_0465262 3300048905 Bacteria 1185
426 Ga0496103_0222655 3300048906 Bacteria 1213
427 Ga0496104_0006687 3300048907 Bacteria 10145
428 Ga0496104_0065105 3300048907 Bacteria 3458
429 Ga0496104_0534862 3300048907 Bacteria 1083
430 Ga0496106_0046808 3300048909 Bacteria 3253
431 Ga0496106_0102873 3300048909 Bacteria 2216
432 Ga0496106_0132599 3300048909 Bacteria 1954
433 Ga0496107_0076798 3300048910 Bacteria 2433
434 Ga0496107_0149360 3300048910 Bacteria 1728
435 Ga0496108_0002694 3300048911 Bacteria 14211
436 Ga0496108_0006400 3300048911 Bacteria 9549
437 Ga0496108_0069525 3300048911 Bacteria 2971
438 Ga0496108_0080235 3300048911 Bacteria 2764
439 Ga0496108_0143074 3300048911 Bacteria 2061
440 Ga0496109_0001374 3300048912 Bacteria 20185
441 Ga0496109_0008969 3300048912 Bacteria 8518
442 Ga0496109_0089916 3300048912 Bacteria 2839
443 Ga0496109_0155926 3300048912 Bacteria 2139
444 Ga0496109_0563071 3300048912 Unclassified 1075
445 Ga0496109_0769494 3300048912 Bacteria 901
446 Ga0496110_0053300 3300048913 Bacteria 3556
447 Ga0496110_0084720 3300048913 Bacteria 2829
448 Ga0496110_0096859 3300048913 Bacteria 2644
449 Ga0496110_0104724 3300048913 Bacteria 2538
450 Ga0496110_0181242 3300048913 Bacteria 1913
451 Ga0496111_0010915 3300048914 Bacteria 6111
452 Ga0496111_0093475 3300048914 Unclassified 2205
453 Ga0496112_0004226 3300048915 Bacteria 12119
454 Ga0496112_0047622 3300048915 Bacteria 4206
455 Ga0496112_0162759 3300048915 Bacteria 2197
456 Ga0496113_0022391 3300048916 Bacteria 4469
457 Ga0496113_0042533 3300048916 Bacteria 3358
458 Ga0496114_0003142 3300048917 Bacteria 12678
459 Ga0496114_0067140 3300048917 Bacteria 3008
460 Ga0496114_0120059 3300048917 Bacteria 2260
461 Ga0496115_0034543 3300048918 Bacteria 3996
462 Ga0496126_0317588 3300048929 Bacteria 1281
463 Ga0501067_0035492 3300049583 Bacteria 2769
464 Ga0501067_0037439 3300049583 Bacteria 2695
465 Ga0501070_0086665 3300049586 Plasmid 2592
466 Ga0501075_0059376 3300049591 Bacteria 2881
467 Ga0501079_0082263 3300049741 Bacteria 2490
468 Ga0501081_0216862 3300049743 Bacteria 1391
469 Ga0501045_0027139 3300049824 Bacteria 4124
470 nmdc:mga00v17_94289_c1 3300050491 Bacteria 1883
471 nmdc:mga0yw44_9868_c1 3300050492 Bacteria 4849
472 nmdc:mga05p37_341519_c1 3300050507 Bacteria 1766
473 nmdc:mga05p37_783927_c1 3300050507 Bacteria 1045
474 nmdc:mga09592_100650_c1 3300050508 Bacteria 2475
475 nmdc:mga06r32_261944_c1 3300050510 Bacteria 1717
476 nmdc:mga06r32_83392_c1 3300050510 Bacteria 3115
477 nmdc:mga08y16_17629_c1 3300050511 Bacteria 7522
478 nmdc:mga08y16_216995_c1 3300050511 Bacteria 1981
479 nmdc:mga0n895_1595_c1 3300050512 Bacteria 17073
480 nmdc:mga0n895_447475_c1 3300050512 Bacteria 1304
481 nmdc:mga0n895_59988_c1 3300050512 Bacteria 3753
482 nmdc:mga0n895_68750_c1 3300050512 Bacteria 3509
483 nmdc:mga0rr50_136226_c1 3300050513 Bacteria 1971
484 nmdc:mga08x19_130973_c1 3300050514 Bacteria 1687
485 nmdc:mga08x19_1894_c1 3300050514 Bacteria 12814
486 nmdc:mga0a205_19576_c1 3300050515 Bacteria 6384
487 nmdc:mga0a205_2855_c1 3300050515 Bacteria 15289
488 nmdc:mga0a205_5057_c2 3300050515 Bacteria 8104
489 nmdc:mga0a205_87369_c1 3300050515 Bacteria 3012
490 Ga0495601_0017942 3300053077 Bacteria 4302
491 Ga0495601_0036989 3300053077 Bacteria 3051
492 Ga0495601_0155068 3300053077 Bacteria 1495
493 Ga0495612_0006774 3300053078 Bacteria 4693
494 Ga0495612_0007232 3300053078 Bacteria 4542
495 Ga0495612_0070817 3300053078 Bacteria 1454
496 Ga0495595_0089899 3300053084 Bacteria 1472
497 Ga0495619_0112617 3300053085 Bacteria 1860
498 Ga0530510_0239494 3300061734 Bacteria 1350
499 2819425305 2818991318 Bacteria 5266538
500 Ga0070709_10001900
501 Ga0065707_10100367
502 Ga0070658_10603961
503 Ga0070683_100246528
504 Ga0070690_100287641
505 Ga0070670_100576925
506 Ga0068869_100375672
507 Ga0068868_100272607
508 Ga0068868_100592631
509 Ga0070689_100215801
510 Ga0070692_10209244
511 Ga0070671_100000223
512 Ga0070671_100374750
513 Ga0070674_100297117
514 Ga0070709_10451529
515 Ga0070714_100665942
516 Ga0070713_100035040
517 Ga0070713_100262722
518 Ga0070710_10088893
519 Ga0070710_10186453
520 Ga0070710_10322561
521 Ga0070711_100000001
522 Ga0070711_100013818
523 Ga0070711_100044295
524 Ga0070711_100159333
525 Ga0070711_100461157
526 Ga0070711_100660729
527 Ga0070694_100279228
528 Ga0070694_100384926
529 Ga0070681_10132661
530 Ga0070706_100504254
531 Ga0070698_100000814
532 Ga0070698_100050909
533 Ga0070699_100000012
534 Ga0070684_100014787
535 Ga0070684_100260669
536 Ga0070686_100078424
537 Ga0070665_100286554
538 Ga0068855_100578533
539 Ga0070664_100185316
540 Ga0068854_100534781
541 Ga0068856_100001346
542 Ga0068856_100040412
543 Ga0068856_100419331
544 Ga0068856_100527987
545 Ga0068864_100410080
546 Ga0068863_100023233
547 Ga0068863_100035836
548 Ga0081455_10001838
549 Ga0081455_10003753
550 Ga0070717_10003371
551 Ga0075365_10041544
552 Ga0070715_10106929
553 Ga0070716_100123770
554 Ga0070716_100150726
555 Ga0070712_100004311
556 Ga0070712_100027465
557 Ga0070712_100038626
558 Ga0070712_100250540
559 Ga0070712_100338618
560 Ga0097621_100006419
561 Ga0097621_100465400
562 Ga0068871_100125195
563 Ga0068871_100134469
564 Ga0075428_100044465
565 Ga0075431_100033564
566 Ga0075431_100675019
567 Ga0075433_10007972
568 Ga0075433_10299486
569 Ga0075434_100007912
570 Ga0075434_100171403
571 Ga0075429_100068083
572 Ga0075436_100002603
573 Ga0075436_100127999
574 Ga0075435_100005320
575 Ga0075435_100081163
576 Ga0075435_100162719
577 Ga0075435_100290824
578 Ga0075435_100352509
579 Ga0111539_10003578
580 Ga0111539_10106402
581 Ga0111539_10495664
582 Ga0105245_10010107
583 Ga0105245_10249428
584 Ga0105245_10408470
585 Ga0114129_10001503
586 Ga0114129_10301098
587 Ga0114129_10501775
588 Ga0105243_10284549
589 Ga0105243_10622788
590 Ga0105241_10245972
591 Ga0105242_10030550
592 Ga0105238_10028025
593 Ga0105239_10307800
594 Ga0105239_10634883
595 Ga0105239_10664476
596 Ga0157369_10001255
597 Ga0157369_10080868
598 Ga0157369_10646726
599 Ga0157374_10009117
600 Ga0163162_10948282
601 Ga0157375_10545816
602 Ga0163163_10329651
603 Ga0182008_10027365
604 Ga0157376_10131148
605 Ga0157376_10205865
606 Ga0157376_10380219
607 Ga0157376_10392067
608 Ga0207426_1072345
609 Ga0207692_10024116
610 Ga0207692_10045361
611 Ga0207692_10152934
612 Ga0207680_10094887
613 Ga0207699_10004193
614 Ga0207699_10040435
615 Ga0207699_10068786
616 Ga0207705_10409995
617 Ga0207707_10054412
618 Ga0207693_10044988
619 Ga0207693_10052822
620 Ga0207693_10182982
621 Ga0207693_10227067
622 Ga0207693_10262560
623 Ga0207693_10561735
624 Ga0207663_10000001
625 Ga0207660_10252075
626 Ga0207652_10372770
627 Ga0207681_10041590
628 Ga0207694_10054598
629 Ga0207687_10133192
630 Ga0207700_10037170
631 Ga0207700_10182735
632 Ga0207700_10265787
633 Ga0207700_10454532
634 Ga0207700_10471189
635 Ga0207664_10012543
636 Ga0207664_10673937
637 Ga0207644_10000876
638 Ga0207644_10152176
639 Ga0207690_10020964
640 Ga0207706_10311341
641 Ga0207686_10257968
642 Ga0207669_10073955
643 Ga0207704_10358222
644 Ga0207665_10014979
645 Ga0207665_10352138
646 Ga0207689_10324479
647 Ga0207661_10078157
648 Ga0207661_10383304
649 Ga0207679_10083927
650 Ga0207640_10285429
651 Ga0207677_10353554
652 Ga0207702_10020816
653 Ga0207702_10126712
654 Ga0207702_10460513
655 Ga0207641_10003036
656 Ga0207641_10025233
657 Ga0207676_10393722
658 Ga0207683_10010808
659 Ga0207698_10124440
660 Ga0207698_10524317
661 Ga0207428_10001136
662 Ga0268266_10244094
663 Ga0268265_10558236
664 Ga0265337_1000212
665 Ga0265326_10000396
666 Ga0265319_1005790
667 Ga0265334_10000275
668 Ga0265318_10019984
669 Ga0265323_10003017
670 Ga0265336_10003315
671 Ga0265338_10002068
672 Ga0265338_10016501
673 Ga0265324_10002106
674 Ga0265330_10106639
675 Ga0265332_10013420
676 Ga0265320_10011086
677 Ga0265325_10033121
678 Ga0265340_10002152
679 Ga0265339_10016550
680 Ga0265316_10058868
681 Ga0265316_10082779
682 Ga0265314_10004284
683 Ga0265342_10004292
684 Ga0316215_1008752
685 Ga0316214_1002361
686 Ga0373926_0004526
687 Ga0373926_0012768
688 Ga0373926_0030973
689 Ga0373926_0065648
690 Ga0373934_0024020
691 Ga0373944_0003218
692 Ga0373944_0003235
693 Ga0373923_0003922
694 Ga0373936_0000176
695 Ga0373936_0016845
696 Ga0373945_0003774
697 Ga0373945_0015140
698 Ga0373945_0034095
699 Ga0373953_0002039
700 Ga0373953_0011228
701 Ga0373953_0017130
702 Ga0373954_0024814
703 Ga0373954_0059520
704 Ga0373954_0141732
705 Ga0373956_0003149
706 Ga0373956_0003384
707 Ga0373956_0036724
708 Ga0373943_0002414
709 Ga0373943_0005227
710 Ga0373946_0000238
711 Ga0373946_0009107
712 Ga0373955_0001273
713 Ga0373955_0008149
714 Ga0373955_0016648
715 Ga0373955_0021881
716 Ga0373955_0048528
717 Ga0373961_0036423
718 Ga0373924_0014419
719 Ga0373924_0025680
720 Ga0373924_0039823
721 Ga0373924_0157052
722 Ga0373931_0016839
723 Ga0373931_0042089
724 Ga0373931_0357200
725 Ga0373935_0006367
726 Ga0373935_0160589
727 Ga0373927_0004614
728 Ga0373927_0034369
729 Ga0373927_0270115
730 Ga0373933_0005217
731 Ga0373933_0011228
732 Ga0373933_0087720
733 Ga0373933_0161809
734 Ga0373947_0009099
735 Ga0373947_0167237
736 Ga0373937_0009466
737 Ga0373937_0035571
738 Ga0373937_0119957
739 Ga0373937_0155437
740 Ga0373937_0194661
741 Ga0373937_0260507
742 Ga0372808_007336
743 Ga0373925_0000013
744 Ga0373925_0003614
745 Ga0373925_0048181
746 Ga0373925_0112912
747 Ga0373925_0188358
748 Ga0436364_0750936
749 Ga0436364_0876150
750 Ga0436364_1027626
751 Ga0395901_0024748
752 Ga0395901_0129255
753 Ga0436365_0817830
754 Ga0436360_0886661
755 Ga0436361_1039658
756 Ga0436363_0759490
757 Ga0436362_0473960
758 Ga0439464_0021076
759 Ga0453683_0101319
760 Ga0466964_0163477
761 Ga0466960_0101370
762 Ga0466967_0034184
763 Ga0466967_0100011
764 Ga0466967_0215261
765 Ga0466967_0507200
766 Ga0466967_0593689
767 Ga0495592_0023841
768 Ga0495603_0000661
769 Ga0495590_0152941
770 Ga0495629_0002801
771 Ga0495629_0166318
772 Ga0495641_0001407
773 Ga0495651_0019365
774 Ga0495651_0040931
775 Ga0495651_0120802
776 Ga0495651_0125999
777 Ga0495653_0009101
778 Ga0495653_0027372
779 Ga0495653_0064792
780 Ga0495653_0068382
781 Ga0495653_0144692
782 Ga0495580_0000002
783 Ga0495580_0179137
784 Ga0495582_0002623
785 Ga0495582_0011577
786 Ga0495582_0017634
787 Ga0495639_0025760
788 Ga0495662_0001838
789 Ga0495664_0001827
790 Ga0495664_0018238
791 Ga0495664_0105632
792 Ga0495664_0136599
793 Ga0495594_0043389
794 Ga0495608_0011910
795 Ga0495608_0020833
796 Ga0495608_0043508
797 Ga0495608_0049512
798 Ga0495608_0129273
799 Ga0495618_0013100
800 Ga0495618_0016767
801 Ga0495618_0065801
802 Ga0495618_0088414
803 Ga0495628_0020066
804 Ga0495628_0027226
805 Ga0495628_0083352
806 Ga0495628_0178904
807 Ga0495628_0188466
808 Ga0495630_0000829
809 Ga0495630_0020705
810 Ga0495630_0030463
811 Ga0495630_0080997
812 Ga0495630_0333510
813 Ga0495666_0022362
814 Ga0495666_0078935
815 Ga0495666_0239699
816 Ga0495652_0097874
817 Ga0495652_0237689
818 Ga0495652_0246655
819 Ga0495665_0024876
820 Ga0495665_0027765
821 Ga0495640_0030926
822 Ga0495640_0061841
823 Ga0495640_0112209
824 Ga0495586_0006621
825 Ga0495586_0014352
826 Ga0495586_0016020
827 Ga0495587_0077410
828 Ga0495587_0104681
829 Ga0495587_0171363
830 Ga0495587_0175703
831 Ga0495645_0025456
832 Ga0495645_0028207
833 Ga0495645_0034333
834 Ga0495645_0066481
835 Ga0495645_0124340
836 Ga0495667_0009893
837 Ga0495667_0010691
838 Ga0495667_0014691
839 Ga0495667_0034607
840 Ga0495667_0077821
841 Ga0495667_0142301
842 Ga0495634_0007951
843 Ga0495634_0009278
844 Ga0495634_0013531
845 Ga0495634_0079072
846 Ga0495634_0089506
847 Ga0495635_0000790
848 Ga0495657_0006712
849 Ga0495657_0030230
850 Ga0495657_0064863
851 Ga0495657_0068393
852 Ga0495599_0021615
853 Ga0495599_0029420
854 Ga0495599_0038118
855 Ga0495599_0051891
856 Ga0495623_0029880
857 Ga0495623_0097078
858 Ga0495646_0016519
859 Ga0495646_0028647
860 Ga0495646_0035307
861 Ga0495658_0053941
862 Ga0495658_0095669
863 Ga0495658_0207165
864 Ga0495669_0130560
865 Ga0495613_0006714
866 Ga0495613_0016929
867 Ga0495624_0005490
868 Ga0495624_0025498
869 Ga0495624_0099609
870 Ga0495600_0033504
871 Ga0495600_0068296
872 Ga0495600_0069574
873 Ga0495600_0166349
874 Ga0495581_0003601
875 Ga0495581_0016185
876 Ga0495581_0022148
877 Ga0495604_0042814
878 Ga0495604_0192186
879 Ga0495604_0289140
880 Ga0495674_0001735
881 Ga0495674_0092271
882 Ga0495674_0106327
883 Ga0495674_0120991
884 Ga0495674_0229350
885 Ga0495674_0331698
886 Ga0495674_0366848
887 Ga0495676_0107273
888 Ga0495676_0185973
889 Ga0495676_0215251
890 Ga0495680_0002044
891 Ga0495680_0092091
892 Ga0495680_0148310
893 Ga0495680_0178749
894 Ga0495680_0223398
895 Ga0495675_0011663
896 Ga0495675_0043832
897 Ga0495675_0217594
898 Ga0495684_0004433
899 Ga0495684_0011248
900 Ga0495684_0026282
901 Ga0495684_0045685
902 Ga0495684_0100014
903 Ga0495684_0160962
904 Ga0495593_0025160
905 Ga0495593_0039713
906 Ga0495593_0042249
907 Ga0495593_0050760
908 Ga0495602_0075279
909 Ga0495602_0113694
910 Ga0495602_0184108
911 Ga0495602_0267106
912 Ga0495614_0007195
913 Ga0495614_0019379
914 Ga0496100_0007800
915 Ga0496100_0022762
916 Ga0496100_0243504
917 Ga0496101_0001217
918 Ga0496101_0005126
919 Ga0496101_0313129
920 Ga0496101_0552028
921 Ga0496102_0046945
922 Ga0496102_0290370
923 Ga0496102_0399839
924 Ga0496102_0465262
925 Ga0496103_0222655
926 Ga0496104_0006687
927 Ga0496104_0065105
928 Ga0496104_0534862
929 Ga0496106_0046808
930 Ga0496106_0102873
931 Ga0496106_0132599
932 Ga0496107_0076798
933 Ga0496107_0149360
934 Ga0496108_0002694
935 Ga0496108_0006400
936 Ga0496108_0069525
937 Ga0496108_0080235
938 Ga0496108_0143074
939 Ga0496109_0001374
940 Ga0496109_0008969
941 Ga0496109_0089916
942 Ga0496109_0155926
943 Ga0496109_0563071
944 Ga0496109_0769494
945 Ga0496110_0053300
946 Ga0496110_0084720
947 Ga0496110_0096859
948 Ga0496110_0104724
949 Ga0496110_0181242
950 Ga0496111_0010915
951 Ga0496111_0093475
952 Ga0496112_0004226
953 Ga0496112_0047622
954 Ga0496112_0162759
955 Ga0496113_0022391
956 Ga0496113_0042533
957 Ga0496114_0003142
958 Ga0496114_0067140
959 Ga0496114_0120059
960 Ga0496115_0034543
961 Ga0496126_0317588
962 Ga0501067_0035492
963 Ga0501067_0037439
964 Ga0501070_0086665
965 Ga0501075_0059376
966 Ga0501079_0082263
967 Ga0501081_0216862
968 Ga0501045_0027139
969 nmdc:mga00v17_94289_c1
970 nmdc:mga0yw44_9868_c1
971 nmdc:mga05p37_341519_c1
972 nmdc:mga05p37_783927_c1
973 nmdc:mga09592_100650_c1
974 nmdc:mga06r32_261944_c1
975 nmdc:mga06r32_83392_c1
976 nmdc:mga08y16_17629_c1
977 nmdc:mga08y16_216995_c1
978 nmdc:mga0n895_1595_c1
979 nmdc:mga0n895_447475_c1
980 nmdc:mga0n895_59988_c1
981 nmdc:mga0n895_68750_c1
982 nmdc:mga0rr50_136226_c1
983 nmdc:mga08x19_130973_c1
984 nmdc:mga08x19_1894_c1
985 nmdc:mga0a205_19576_c1
986 nmdc:mga0a205_2855_c1
987 nmdc:mga0a205_5057_c2
988 nmdc:mga0a205_87369_c1
989 Ga0495601_0017942
990 Ga0495601_0036989
991 Ga0495601_0155068
992 Ga0495612_0006774
993 Ga0495612_0007232
994 Ga0495612_0070817
995 Ga0495595_0089899
996 Ga0495619_0112617
997 Ga0530510_0239494
998 2819425305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

15

240

0.93

PF00106

adh_short

short chain dehydrogenase

10

192

0.89

PF23441

4

242

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nkh-assembly1.cif.gz_C structure of malc reductase/diels-alderase from malbranchea aurantiaca 0.9192 12 243
4fj0-assembly2.cif.gz_D crystal structure of the ternary complex between a fungal 17beta-hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone 0.9173 11 247
3itd-assembly1.cif.gz_A crystal structure of an inactive 17beta-hydroxysteroid dehydrogenase (y167f mutated form) from fungus cochliobolus lunatus 0.9113 11 247
1ja9-assembly1.cif.gz_A crystal structure of 1,3,6,8-tetrahydroxynaphthalene reductase in complex with nadph and pyroquilon 0.9091 12 247
7yb1-assembly1.cif.gz_C crystal structure of anthrol reductase (cbar) in complex with nadp+ 0.9088 16 247
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.916 14 84 3.40.50.720
1ja9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9091 12 247 3.40.50.720
af_C6TLW3_3_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9028 11 250 3.40.50.720
af_Q8T197_39_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9003 11 191 3.40.50.720
af_I6YCF0_1_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8993 14 244 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1F9A1F4-F1-model_v4 Short-chain dehydrogenase 0.9383 15 251 GO:0016491
AF-A0A1Z7Z1R9-F1-model_v4 Short-chain dehydrogenase 0.9311 14 251 GO:0016491
AF-A0A1F9A1F4-F1-model_v4 Short-chain dehydrogenase 0.9306 15 251 GO:0016491
AF-A0A558A8A2-F1-model_v4 SDR family oxidoreductase 0.9287 16 250 GO:0016491
AF-A0A6I2H041-F1-model_v4 SDR family oxidoreductase 0.9281 16 251 GO:0016491

Map