F455276
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 498 | 300 | 498 | 350 |
Family's Representative Sequence
| Representative Sequence | 3300049577|Ga0501041_0040199|Ga0501041_0040199_1447_2613 |
| Length | 388 |
| Sequence | LNSESISRIAKSRGCVHPAAAGIEDKQRRRRLMATTYKILILGASYGSLLATKLLFAGHTLKLVCLPAEAELINKEGARVRLPVKGREGLVEIDTRKLPGKLSADGPGAVNPADYDLIALAMMEPQYRSAGVRELMDAIARAKVPCMSIMNMPPLTYLKRIRGLNTDACRGAYTDPSVWDGFDPRLMTLCSPDPQAFRPPDEKVNVLQVRLATNFKAARFESEAHTAILRRLEADIEAVRFDTGSGKIELPVKLKVHDSIFVPLAKWPMLIAGNYRCVQKDGMRSIKDAVHSNLEASRSVYDWVVKLCVSLGAAEKDLVPFEKYANAALSLGSPSSAARALFGGAPNIERVDRLVKAIAAQKGMRSDVVDETVALVDARLEANRKKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 111 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 179 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 189 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 297 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 298 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.41 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 95.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_3467282 | 2162886012 | Bacteria | 1520 |
| 2 | Ga0065707_10213590 | 3300005295 | Bacteria | 1255 |
| 3 | Ga0070676_10024851 | 3300005328 | Bacteria | 3380 |
| 4 | Ga0070683_100019858 | 3300005329 | Bacteria | 5973 |
| 5 | Ga0070683_100230770 | 3300005329 | Bacteria | 1760 |
| 6 | Ga0070690_100061882 | 3300005330 | Bacteria | 2412 |
| 7 | Ga0070670_100027589 | 3300005331 | Bacteria | 4884 |
| 8 | Ga0070670_100033992 | 3300005331 | Bacteria | 4389 |
| 9 | Ga0070670_100050283 | 3300005331 | Bacteria | 3582 |
| 10 | Ga0068869_100000160 | 3300005334 | Bacteria | 33574 |
| 11 | Ga0068869_100145861 | 3300005334 | Bacteria | 1832 |
| 12 | Ga0070666_10110978 | 3300005335 | Bacteria | 1896 |
| 13 | Ga0070666_10216737 | 3300005335 | Bacteria | 1349 |
| 14 | Ga0070680_100119054 | 3300005336 | Bacteria | 2203 |
| 15 | Ga0068868_100014921 | 3300005338 | Bacteria | 5736 |
| 16 | Ga0068868_100113707 | 3300005338 | Bacteria | 2201 |
| 17 | Ga0070660_100016015 | 3300005339 | Bacteria | 5431 |
| 18 | Ga0070689_100072365 | 3300005340 | Bacteria | 2694 |
| 19 | Ga0070687_100004543 | 3300005343 | Bacteria | 5544 |
| 20 | Ga0070661_100000620 | 3300005344 | Bacteria | 26406 |
| 21 | Ga0070669_100011878 | 3300005353 | Bacteria | 6179 |
| 22 | Ga0070669_100031053 | 3300005353 | Bacteria | 3857 |
| 23 | Ga0070669_100083135 | 3300005353 | Bacteria | 2387 |
| 24 | Ga0070675_100029112 | 3300005354 | Bacteria | 4451 |
| 25 | Ga0070675_100060594 | 3300005354 | Bacteria | 3124 |
| 26 | Ga0070675_100065732 | 3300005354 | Bacteria | 2999 |
| 27 | Ga0070675_100115292 | 3300005354 | Bacteria | 2277 |
| 28 | Ga0070675_100209625 | 3300005354 | Bacteria | 1693 |
| 29 | Ga0070671_100044932 | 3300005355 | Bacteria | 3671 |
| 30 | Ga0070673_100048813 | 3300005364 | Bacteria | 3302 |
| 31 | Ga0070673_100060663 | 3300005364 | Bacteria | 2998 |
| 32 | Ga0070688_100018714 | 3300005365 | Bacteria | 4002 |
| 33 | Ga0070688_100161747 | 3300005365 | Bacteria | 1539 |
| 34 | Ga0070659_100102397 | 3300005366 | Bacteria | 2305 |
| 35 | Ga0070667_100015642 | 3300005367 | Bacteria | 6273 |
| 36 | Ga0070667_100260164 | 3300005367 | Bacteria | 1553 |
| 37 | Ga0070709_10012776 | 3300005434 | Bacteria | 4706 |
| 38 | Ga0070714_100002858 | 3300005435 | Bacteria | 12764 |
| 39 | Ga0070714_100066309 | 3300005435 | Bacteria | 3111 |
| 40 | Ga0070713_100002510 | 3300005436 | Bacteria | 11999 |
| 41 | Ga0070710_10022267 | 3300005437 | Bacteria | 3312 |
| 42 | Ga0070701_10040097 | 3300005438 | Bacteria | 2379 |
| 43 | Ga0070705_100104155 | 3300005440 | Bacteria | 1798 |
| 44 | Ga0070700_100045274 | 3300005441 | Bacteria | 2714 |
| 45 | Ga0070694_100041782 | 3300005444 | Bacteria | 3060 |
| 46 | Ga0070708_100103017 | 3300005445 | Bacteria | 2616 |
| 47 | Ga0070681_10025486 | 3300005458 | Bacteria | 5949 |
| 48 | Ga0070681_10026284 | 3300005458 | Bacteria | 5851 |
| 49 | Ga0068867_100006924 | 3300005459 | Bacteria | 8025 |
| 50 | Ga0068867_100007220 | 3300005459 | Bacteria | 7856 |
| 51 | Ga0070685_10084102 | 3300005466 | Bacteria | 1913 |
| 52 | Ga0070706_100126961 | 3300005467 | Bacteria | 2379 |
| 53 | Ga0070707_100154860 | 3300005468 | Bacteria | 2232 |
| 54 | Ga0070698_100019996 | 3300005471 | Bacteria | 7019 |
| 55 | Ga0070684_100009360 | 3300005535 | Bacteria | 7712 |
| 56 | Ga0070684_100032420 | 3300005535 | Bacteria | 4453 |
| 57 | Ga0070697_100121823 | 3300005536 | Bacteria | 2182 |
| 58 | Ga0068853_100026587 | 3300005539 | Bacteria | 4860 |
| 59 | Ga0070672_100021376 | 3300005543 | Bacteria | 4733 |
| 60 | Ga0070672_100093417 | 3300005543 | Bacteria | 2430 |
| 61 | Ga0070686_100038807 | 3300005544 | Bacteria | 2963 |
| 62 | Ga0070695_100051247 | 3300005545 | Bacteria | 2648 |
| 63 | Ga0070696_100000665 | 3300005546 | Bacteria | 22042 |
| 64 | Ga0070696_100090148 | 3300005546 | Bacteria | 2181 |
| 65 | Ga0070693_100013949 | 3300005547 | Bacteria | 4104 |
| 66 | Ga0070665_100080002 | 3300005548 | Bacteria | 3273 |
| 67 | Ga0070704_100002331 | 3300005549 | Bacteria | 10641 |
| 68 | Ga0070704_100002392 | 3300005549 | Bacteria | 10532 |
| 69 | Ga0070704_100005685 | 3300005549 | Bacteria | 7284 |
| 70 | Ga0070704_100059794 | 3300005549 | Bacteria | 2720 |
| 71 | Ga0070664_100037070 | 3300005564 | Bacteria | 4097 |
| 72 | Ga0070664_100060500 | 3300005564 | Bacteria | 3225 |
| 73 | Ga0070664_100083104 | 3300005564 | Bacteria | 2762 |
| 74 | Ga0070664_100235648 | 3300005564 | Bacteria | 1642 |
| 75 | Ga0068857_100003360 | 3300005577 | Bacteria | 13320 |
| 76 | Ga0068857_100017599 | 3300005577 | Bacteria | 6266 |
| 77 | Ga0068854_100001488 | 3300005578 | Bacteria | 14183 |
| 78 | Ga0068854_100221530 | 3300005578 | Bacteria | 1497 |
| 79 | Ga0068856_100019529 | 3300005614 | Bacteria | 6578 |
| 80 | Ga0070702_100017930 | 3300005615 | Bacteria | 3662 |
| 81 | Ga0070702_100056568 | 3300005615 | Bacteria | 2266 |
| 82 | Ga0068859_100002394 | 3300005617 | Bacteria | 19095 |
| 83 | Ga0068864_100000395 | 3300005618 | Bacteria | 37880 |
| 84 | Ga0068864_100041019 | 3300005618 | Bacteria | 3959 |
| 85 | Ga0068864_100104294 | 3300005618 | Bacteria | 2518 |
| 86 | Ga0068864_100159062 | 3300005618 | Bacteria | 2052 |
| 87 | Ga0068864_100351120 | 3300005618 | Bacteria | 1391 |
| 88 | Ga0068866_10020734 | 3300005718 | Bacteria | 3017 |
| 89 | Ga0068861_100003084 | 3300005719 | Bacteria | 11007 |
| 90 | Ga0068861_100213841 | 3300005719 | Bacteria | 1625 |
| 91 | Ga0068851_10055598 | 3300005834 | Bacteria | 2016 |
| 92 | Ga0068870_10003450 | 3300005840 | Bacteria | 6698 |
| 93 | Ga0068863_100005560 | 3300005841 | Bacteria | 12392 |
| 94 | Ga0068863_100079538 | 3300005841 | Bacteria | 3104 |
| 95 | Ga0068863_100083864 | 3300005841 | Bacteria | 3020 |
| 96 | Ga0068863_100087535 | 3300005841 | Bacteria | 2951 |
| 97 | Ga0068863_100100664 | 3300005841 | Bacteria | 2747 |
| 98 | Ga0068858_100022939 | 3300005842 | Bacteria | 5821 |
| 99 | Ga0068860_100015795 | 3300005843 | Bacteria | 7372 |
| 100 | Ga0068860_100075949 | 3300005843 | Bacteria | 3195 |
| 101 | Ga0068862_100096637 | 3300005844 | Bacteria | 2579 |
| 102 | Ga0081455_10004832 | 3300005937 | Bacteria | 14960 |
| 103 | Ga0081538_10001845 | 3300005981 | Bacteria | 21365 |
| 104 | Ga0081538_10049794 | 3300005981 | Bacteria | 2538 |
| 105 | Ga0075365_10162406 | 3300006038 | Bacteria | 1557 |
| 106 | Ga0070715_10032185 | 3300006163 | Bacteria | 2134 |
| 107 | Ga0075367_10134375 | 3300006178 | Bacteria | 1530 |
| 108 | Ga0075369_10089691 | 3300006186 | Bacteria | 1371 |
| 109 | Ga0075366_10025324 | 3300006195 | Bacteria | 3464 |
| 110 | Ga0097621_100029643 | 3300006237 | Bacteria | 4324 |
| 111 | Ga0097621_100083200 | 3300006237 | Bacteria | 2666 |
| 112 | Ga0068871_100020011 | 3300006358 | Bacteria | 5120 |
| 113 | Ga0068871_100049355 | 3300006358 | Bacteria | 3401 |
| 114 | Ga0075428_100000638 | 3300006844 | Bacteria | 35958 |
| 115 | Ga0075428_100049674 | 3300006844 | Bacteria | 4602 |
| 116 | Ga0075428_100129532 | 3300006844 | Bacteria | 2745 |
| 117 | Ga0075430_100021232 | 3300006846 | Bacteria | 5520 |
| 118 | Ga0075430_100029137 | 3300006846 | Bacteria | 4686 |
| 119 | Ga0075431_100000307 | 3300006847 | Bacteria | 38506 |
| 120 | Ga0075431_100065250 | 3300006847 | Bacteria | 3759 |
| 121 | Ga0075431_100093908 | 3300006847 | Bacteria | 3096 |
| 122 | Ga0075431_100386998 | 3300006847 | Bacteria | 1402 |
| 123 | Ga0075433_10062535 | 3300006852 | Bacteria | 3260 |
| 124 | Ga0075433_10093495 | 3300006852 | Bacteria | 2660 |
| 125 | Ga0075429_100011701 | 3300006880 | Bacteria | 7609 |
| 126 | Ga0075429_100155755 | 3300006880 | Bacteria | 2001 |
| 127 | Ga0068865_100001154 | 3300006881 | Bacteria | 15331 |
| 128 | Ga0075436_100110908 | 3300006914 | Bacteria | 1915 |
| 129 | Ga0097620_100002394 | 3300006931 | Bacteria | 19095 |
| 130 | Ga0075435_100010857 | 3300007076 | Bacteria | 6670 |
| 131 | Ga0075435_100129221 | 3300007076 | Bacteria | 2113 |
| 132 | Ga0099794_10021420 | 3300007265 | Bacteria | 2937 |
| 133 | Ga0099794_10077562 | 3300007265 | Bacteria | 1635 |
| 134 | Ga0099795_10022112 | 3300007788 | Bacteria | 2095 |
| 135 | Ga0105240_10000780 | 3300009093 | Bacteria | 57653 |
| 136 | Ga0105240_10001181 | 3300009093 | Bacteria | 45705 |
| 137 | Ga0111539_10004193 | 3300009094 | Bacteria | 18910 |
| 138 | Ga0105245_10165719 | 3300009098 | Bacteria | 2100 |
| 139 | Ga0114129_10186839 | 3300009147 | Bacteria | 2816 |
| 140 | Ga0105243_10022371 | 3300009148 | Bacteria | 4804 |
| 141 | Ga0105243_10100544 | 3300009148 | Bacteria | 2399 |
| 142 | Ga0105243_10206130 | 3300009148 | Bacteria | 1728 |
| 143 | Ga0105242_10001652 | 3300009176 | Bacteria | 17627 |
| 144 | Ga0105242_10020100 | 3300009176 | Bacteria | 5233 |
| 145 | Ga0105242_10020636 | 3300009176 | Bacteria | 5169 |
| 146 | Ga0105242_10036038 | 3300009176 | Bacteria | 3967 |
| 147 | Ga0105248_10002497 | 3300009177 | Bacteria | 20453 |
| 148 | Ga0105248_10030740 | 3300009177 | Bacteria | 5999 |
| 149 | Ga0105248_10047007 | 3300009177 | Bacteria | 4839 |
| 150 | Ga0105248_10176321 | 3300009177 | Bacteria | 2409 |
| 151 | Ga0105237_10012555 | 3300009545 | Bacteria | 8924 |
| 152 | Ga0105238_10039131 | 3300009551 | Bacteria | 4810 |
| 153 | Ga0105249_10155903 | 3300009553 | Bacteria | 2202 |
| 154 | Ga0105249_10255269 | 3300009553 | Bacteria | 1740 |
| 155 | Ga0105249_10521545 | 3300009553 | Bacteria | 1236 |
| 156 | Ga0099796_10019895 | 3300010159 | Bacteria | 2042 |
| 157 | Ga0105239_10032279 | 3300010375 | Bacteria | 5755 |
| 158 | Ga0105246_10142919 | 3300011119 | Bacteria | 1802 |
| 159 | Ga0157373_10031559 | 3300013100 | Bacteria | 3814 |
| 160 | Ga0157373_10065965 | 3300013100 | Bacteria | 2561 |
| 161 | Ga0157370_10014726 | 3300013104 | Bacteria | 7986 |
| 162 | Ga0157369_10140409 | 3300013105 | Bacteria | 2557 |
| 163 | Ga0157374_10084500 | 3300013296 | Bacteria | 3017 |
| 164 | Ga0157378_10029647 | 3300013297 | Bacteria | 4832 |
| 165 | Ga0157378_10047322 | 3300013297 | Bacteria | 3824 |
| 166 | Ga0157378_10113521 | 3300013297 | Bacteria | 2487 |
| 167 | Ga0163162_10198498 | 3300013306 | Bacteria | 2135 |
| 168 | Ga0157372_10000854 | 3300013307 | Bacteria | 33050 |
| 169 | Ga0157372_10409253 | 3300013307 | Bacteria | 1581 |
| 170 | Ga0157375_10126126 | 3300013308 | Bacteria | 2675 |
| 171 | Ga0157375_10349952 | 3300013308 | Bacteria | 1643 |
| 172 | Ga0163163_10002115 | 3300014325 | Bacteria | 16762 |
| 173 | Ga0163163_10345885 | 3300014325 | Bacteria | 1543 |
| 174 | Ga0163163_10549662 | 3300014325 | Bacteria | 1217 |
| 175 | Ga0157380_10093664 | 3300014326 | Bacteria | 2484 |
| 176 | Ga0157380_10103126 | 3300014326 | Bacteria | 2380 |
| 177 | Ga0157380_10198046 | 3300014326 | Bacteria | 1780 |
| 178 | Ga0157380_10273328 | 3300014326 | Bacteria | 1542 |
| 179 | Ga0157377_10135912 | 3300014745 | Bacteria | 1506 |
| 180 | Ga0157379_10000271 | 3300014968 | Bacteria | 40851 |
| 181 | Ga0157379_10123706 | 3300014968 | Bacteria | 2327 |
| 182 | Ga0157379_10280751 | 3300014968 | Bacteria | 1515 |
| 183 | Ga0157376_10298615 | 3300014969 | Bacteria | 1524 |
| 184 | Ga0206356_11215269 | 3300020070 | Bacteria | 1263 |
| 185 | Ga0213875_10000040 | 3300021388 | Bacteria | 156362 |
| 186 | Ga0213875_10005885 | 3300021388 | Bacteria | 6516 |
| 187 | Ga0213871_10040563 | 3300021441 | Bacteria | 1249 |
| 188 | Ga0207666_1004719 | 3300025271 | Bacteria | 1719 |
| 189 | Ga0207682_10003567 | 3300025893 | Bacteria | 6731 |
| 190 | Ga0207692_10047048 | 3300025898 | Bacteria | 2165 |
| 191 | Ga0207680_10064210 | 3300025903 | Bacteria | 2250 |
| 192 | Ga0207685_10019450 | 3300025905 | Bacteria | 2239 |
| 193 | Ga0207699_10009723 | 3300025906 | Bacteria | 4800 |
| 194 | Ga0207645_10009698 | 3300025907 | Bacteria | 6651 |
| 195 | Ga0207645_10166156 | 3300025907 | Bacteria | 1445 |
| 196 | Ga0207643_10007625 | 3300025908 | Bacteria | 5816 |
| 197 | Ga0207643_10010434 | 3300025908 | Bacteria | 5004 |
| 198 | Ga0207707_10008295 | 3300025912 | Bacteria | 9015 |
| 199 | Ga0207707_10077546 | 3300025912 | Bacteria | 2901 |
| 200 | Ga0207695_10008281 | 3300025913 | Bacteria | 13042 |
| 201 | Ga0207671_10027627 | 3300025914 | Bacteria | 4242 |
| 202 | Ga0207660_10104852 | 3300025917 | Bacteria | 2117 |
| 203 | Ga0207657_10002918 | 3300025919 | Bacteria | 18354 |
| 204 | Ga0207649_10013764 | 3300025920 | Bacteria | 4522 |
| 205 | Ga0207681_10155868 | 3300025923 | Bacteria | 1716 |
| 206 | Ga0207694_10115496 | 3300025924 | Bacteria | 2138 |
| 207 | Ga0207694_10227255 | 3300025924 | Bacteria | 1523 |
| 208 | Ga0207650_10069764 | 3300025925 | Bacteria | 2641 |
| 209 | Ga0207659_10087782 | 3300025926 | Bacteria | 2316 |
| 210 | Ga0207659_10089485 | 3300025926 | Bacteria | 2296 |
| 211 | Ga0207687_10045993 | 3300025927 | Bacteria | 3019 |
| 212 | Ga0207700_10000183 | 3300025928 | Bacteria | 37732 |
| 213 | Ga0207700_10091169 | 3300025928 | Bacteria | 2407 |
| 214 | Ga0207664_10003432 | 3300025929 | Bacteria | 10565 |
| 215 | Ga0207664_10031758 | 3300025929 | Bacteria | 4042 |
| 216 | Ga0207644_10029749 | 3300025931 | Bacteria | 3791 |
| 217 | Ga0207644_10169447 | 3300025931 | Bacteria | 1703 |
| 218 | Ga0207706_10014132 | 3300025933 | Bacteria | 7238 |
| 219 | Ga0207706_10117659 | 3300025933 | Bacteria | 2337 |
| 220 | Ga0207706_10141215 | 3300025933 | Bacteria | 2119 |
| 221 | Ga0207686_10018281 | 3300025934 | Bacteria | 3967 |
| 222 | Ga0207686_10134323 | 3300025934 | Bacteria | 1701 |
| 223 | Ga0207709_10023739 | 3300025935 | Bacteria | 3493 |
| 224 | Ga0207670_10074064 | 3300025936 | Bacteria | 2363 |
| 225 | Ga0207670_10208982 | 3300025936 | Bacteria | 1487 |
| 226 | Ga0207669_10112900 | 3300025937 | Bacteria | 1826 |
| 227 | Ga0207704_10002332 | 3300025938 | Bacteria | 8528 |
| 228 | Ga0207704_10086822 | 3300025938 | Bacteria | 2042 |
| 229 | Ga0207665_10089010 | 3300025939 | Bacteria | 2137 |
| 230 | Ga0207691_10052989 | 3300025940 | Bacteria | 3705 |
| 231 | Ga0207691_10058790 | 3300025940 | Bacteria | 3496 |
| 232 | Ga0207691_10087427 | 3300025940 | Bacteria | 2796 |
| 233 | Ga0207691_10225028 | 3300025940 | Bacteria | 1626 |
| 234 | Ga0207711_10143421 | 3300025941 | Bacteria | 2150 |
| 235 | Ga0207711_10374443 | 3300025941 | Bacteria | 1321 |
| 236 | Ga0207689_10000028 | 3300025942 | Bacteria | 100652 |
| 237 | Ga0207689_10005226 | 3300025942 | Bacteria | 11645 |
| 238 | Ga0207689_10104579 | 3300025942 | Bacteria | 2326 |
| 239 | Ga0207661_10016498 | 3300025944 | Bacteria | 5450 |
| 240 | Ga0207661_10073400 | 3300025944 | Bacteria | 2802 |
| 241 | Ga0207661_10204886 | 3300025944 | Bacteria | 1736 |
| 242 | Ga0207679_10021618 | 3300025945 | Bacteria | 4366 |
| 243 | Ga0207679_10178582 | 3300025945 | Bacteria | 1754 |
| 244 | Ga0207679_10221061 | 3300025945 | Bacteria | 1593 |
| 245 | Ga0207667_10025128 | 3300025949 | Bacteria | 6526 |
| 246 | Ga0207667_10460832 | 3300025949 | Bacteria | 1291 |
| 247 | Ga0207651_10352229 | 3300025960 | Bacteria | 1240 |
| 248 | Ga0207712_10093856 | 3300025961 | Bacteria | 2215 |
| 249 | Ga0207668_10034187 | 3300025972 | Bacteria | 3374 |
| 250 | Ga0207640_10004727 | 3300025981 | Bacteria | 7397 |
| 251 | Ga0207658_10108881 | 3300025986 | Bacteria | 2186 |
| 252 | Ga0207677_10027767 | 3300026023 | Bacteria | 3571 |
| 253 | Ga0207703_10002194 | 3300026035 | Bacteria | 17130 |
| 254 | Ga0207703_10009843 | 3300026035 | Bacteria | 7499 |
| 255 | Ga0207703_10303139 | 3300026035 | Bacteria | 1458 |
| 256 | Ga0207639_10057461 | 3300026041 | Bacteria | 2987 |
| 257 | Ga0207708_10240464 | 3300026075 | Bacteria | 1456 |
| 258 | Ga0207708_10283093 | 3300026075 | Bacteria | 1344 |
| 259 | Ga0207702_10002279 | 3300026078 | Bacteria | 18408 |
| 260 | Ga0207641_10074726 | 3300026088 | Bacteria | 2924 |
| 261 | Ga0207641_10116983 | 3300026088 | Bacteria | 2373 |
| 262 | Ga0207641_10154440 | 3300026088 | Bacteria | 2081 |
| 263 | Ga0207648_10001620 | 3300026089 | Bacteria | 24687 |
| 264 | Ga0207648_10024004 | 3300026089 | Bacteria | 5450 |
| 265 | Ga0207648_10094046 | 3300026089 | Bacteria | 2621 |
| 266 | Ga0207648_10116949 | 3300026089 | Bacteria | 2343 |
| 267 | Ga0207676_10005681 | 3300026095 | Bacteria | 8826 |
| 268 | Ga0207676_10006221 | 3300026095 | Bacteria | 8429 |
| 269 | Ga0207676_10062858 | 3300026095 | Bacteria | 2946 |
| 270 | Ga0207676_10173982 | 3300026095 | Bacteria | 1878 |
| 271 | Ga0207676_10277507 | 3300026095 | Bacteria | 1520 |
| 272 | Ga0207674_10000022 | 3300026116 | Bacteria | 161298 |
| 273 | Ga0207674_10105321 | 3300026116 | Bacteria | 2799 |
| 274 | Ga0207674_10235329 | 3300026116 | Bacteria | 1779 |
| 275 | Ga0207675_100001456 | 3300026118 | Bacteria | 23727 |
| 276 | Ga0207675_100007847 | 3300026118 | Bacteria | 10070 |
| 277 | Ga0207683_10007883 | 3300026121 | Bacteria | 9109 |
| 278 | Ga0207683_10014757 | 3300026121 | Bacteria | 6650 |
| 279 | Ga0207698_10012587 | 3300026142 | Bacteria | 5543 |
| 280 | Ga0207698_10199550 | 3300026142 | Bacteria | 1790 |
| 281 | Ga0209967_1000767 | 3300027364 | Bacteria | 4109 |
| 282 | Ga0209981_1000591 | 3300027378 | Bacteria | 4574 |
| 283 | Ga0209996_1003604 | 3300027395 | Bacteria | 1953 |
| 284 | Ga0210000_1000081 | 3300027462 | Bacteria | 13652 |
| 285 | Ga0209995_1000402 | 3300027471 | Bacteria | 6745 |
| 286 | Ga0209968_1000708 | 3300027526 | Bacteria | 5129 |
| 287 | Ga0209999_1000253 | 3300027543 | Bacteria | 7734 |
| 288 | Ga0209974_10010773 | 3300027876 | Bacteria | 3081 |
| 289 | Ga0209974_10013906 | 3300027876 | Bacteria | 2681 |
| 290 | Ga0268265_10299631 | 3300028380 | Bacteria | 1447 |
| 291 | Ga0268264_10001919 | 3300028381 | Bacteria | 18762 |
| 292 | Ga0268264_10053353 | 3300028381 | Bacteria | 3372 |
| 293 | Ga0265318_10002144 | 3300028577 | Bacteria | 10723 |
| 294 | Ga0265338_10117676 | 3300028800 | Bacteria | 2126 |
| 295 | Ga0307511_10000065 | 3300030521 | Bacteria | 88859 |
| 296 | Ga0265330_10002013 | 3300031235 | Bacteria | 11281 |
| 297 | Ga0265332_10000199 | 3300031238 | Bacteria | 48650 |
| 298 | Ga0265332_10015971 | 3300031238 | Bacteria | 3313 |
| 299 | Ga0265325_10022307 | 3300031241 | Bacteria | 3470 |
| 300 | Ga0265329_10000991 | 3300031242 | Bacteria | 14171 |
| 301 | Ga0265339_10140691 | 3300031249 | Bacteria | 1228 |
| 302 | Ga0265331_10001027 | 3300031250 | Bacteria | 21785 |
| 303 | Ga0265331_10009792 | 3300031250 | Bacteria | 5345 |
| 304 | Ga0265327_10003598 | 3300031251 | Bacteria | 14622 |
| 305 | Ga0265316_10010249 | 3300031344 | Bacteria | 8554 |
| 306 | Ga0265316_10019983 | 3300031344 | Bacteria | 5713 |
| 307 | Ga0316575_10012610 | 3300031665 | Bacteria | 3147 |
| 308 | Ga0265314_10012115 | 3300031711 | Bacteria | 7063 |
| 309 | Ga0265342_10006173 | 3300031712 | Bacteria | 8962 |
| 310 | Ga0316578_10016899 | 3300031728 | Unclassified | 3959 |
| 311 | Ga0373926_0012145 | 3300035083 | Bacteria | 2909 |
| 312 | Ga0373934_0018143 | 3300035086 | Bacteria | 2691 |
| 313 | Ga0373923_0065631 | 3300035111 | Bacteria | 1550 |
| 314 | Ga0373936_0008966 | 3300035113 | Bacteria | 3771 |
| 315 | Ga0373936_0073665 | 3300035113 | Bacteria | 1412 |
| 316 | Ga0373953_0006425 | 3300035117 | Bacteria | 3871 |
| 317 | Ga0373954_0002637 | 3300035118 | Bacteria | 7547 |
| 318 | Ga0373954_0006094 | 3300035118 | Bacteria | 5247 |
| 319 | Ga0373954_0009416 | 3300035118 | Bacteria | 4296 |
| 320 | Ga0373954_0012647 | 3300035118 | Bacteria | 3755 |
| 321 | Ga0373956_0000018 | 3300035119 | Bacteria | 50671 |
| 322 | Ga0373957_0007711 | 3300035120 | Bacteria | 3455 |
| 323 | Ga0373957_0069024 | 3300035120 | Bacteria | 1380 |
| 324 | Ga0373946_0012569 | 3300035171 | Bacteria | 3171 |
| 325 | Ga0373955_0001648 | 3300035172 | Bacteria | 9553 |
| 326 | Ga0373955_0002161 | 3300035172 | Bacteria | 8506 |
| 327 | Ga0373955_0007644 | 3300035172 | Bacteria | 4980 |
| 328 | Ga0316574_0037874 | 3300035398 | Bacteria | 2959 |
| 329 | Ga0373924_0001847 | 3300035410 | Bacteria | 7006 |
| 330 | Ga0373935_0098001 | 3300035692 | Bacteria | 1929 |
| 331 | Ga0373933_0000035 | 3300035724 | Bacteria | 82702 |
| 332 | Ga0373933_0000832 | 3300035724 | Bacteria | 18866 |
| 333 | Ga0373947_0191392 | 3300035725 | Bacteria | 1335 |
| 334 | Ga0373937_0001048 | 3300036401 | Bacteria | 23373 |
| 335 | Ga0373937_0002135 | 3300036401 | Bacteria | 16540 |
| 336 | Ga0373937_0024477 | 3300036401 | Bacteria | 5446 |
| 337 | Ga0373937_0377429 | 3300036401 | Bacteria | 1344 |
| 338 | Ga0316582_0152006 | 3300036647 | Bacteria | 1565 |
| 339 | Ga0395905_0411355 | 3300037471 | Bacteria | 1248 |
| 340 | Ga0436364_0374996 | 3300037853 | Bacteria | 6606 |
| 341 | Ga0436364_0576120 | 3300037853 | Bacteria | 27783 |
| 342 | Ga0436364_1209713 | 3300037853 | Bacteria | 1066 |
| 343 | Ga0400483_146919 | 3300039062 | Bacteria | 2567 |
| 344 | Ga0400483_211488 | 3300039062 | Bacteria | 1356 |
| 345 | Ga0436365_0017926 | 3300039437 | Bacteria | 5872 |
| 346 | Ga0436362_0682656 | 3300039453 | Bacteria | 1902 |
| 347 | Ga0439464_0001416 | 3300042439 | Bacteria | 5637 |
| 348 | Ga0439460_0061955 | 3300042461 | Bacteria | 1143 |
| 349 | Ga0451576_0095780 | 3300045051 | Bacteria | 3087 |
| 350 | Ga0495592_0001428 | 3300046454 | Bacteria | 16575 |
| 351 | Ga0495629_0003053 | 3300046459 | Bacteria | 12729 |
| 352 | Ga0495629_0165636 | 3300046459 | Bacteria | 1535 |
| 353 | Ga0495641_0034875 | 3300046461 | Bacteria | 2375 |
| 354 | Ga0495651_0000350 | 3300046462 | Bacteria | 35585 |
| 355 | Ga0495651_0000476 | 3300046462 | Bacteria | 30843 |
| 356 | Ga0495651_0006469 | 3300046462 | Bacteria | 8958 |
| 357 | Ga0495653_0000900 | 3300046463 | Bacteria | 23000 |
| 358 | Ga0495653_0007068 | 3300046463 | Bacteria | 9210 |
| 359 | Ga0495580_0229960 | 3300046472 | Bacteria | 1273 |
| 360 | Ga0495582_0017891 | 3300046473 | Bacteria | 3874 |
| 361 | Ga0495639_0003619 | 3300046475 | Bacteria | 6661 |
| 362 | Ga0495662_0015857 | 3300046476 | Bacteria | 3657 |
| 363 | Ga0495664_0000685 | 3300046477 | Bacteria | 17239 |
| 364 | Ga0495608_0005364 | 3300046511 | Bacteria | 9158 |
| 365 | Ga0495608_0006821 | 3300046511 | Bacteria | 8096 |
| 366 | Ga0495618_0101518 | 3300046514 | Bacteria | 1841 |
| 367 | Ga0495620_0057021 | 3300046515 | Bacteria | 1641 |
| 368 | Ga0495628_0001118 | 3300046516 | Bacteria | 24530 |
| 369 | Ga0495628_0013837 | 3300046516 | Bacteria | 6779 |
| 370 | Ga0495628_0013977 | 3300046516 | Bacteria | 6739 |
| 371 | Ga0495652_0000469 | 3300046529 | Bacteria | 47242 |
| 372 | Ga0495652_0002547 | 3300046529 | Bacteria | 18683 |
| 373 | Ga0495640_0003500 | 3300046533 | Bacteria | 12633 |
| 374 | Ga0495586_0001410 | 3300046535 | Bacteria | 13299 |
| 375 | Ga0495587_0016992 | 3300046536 | Bacteria | 4523 |
| 376 | Ga0495645_0000044 | 3300046543 | Bacteria | 90950 |
| 377 | Ga0495667_0000641 | 3300046559 | Bacteria | 22253 |
| 378 | Ga0495667_0053997 | 3300046559 | Bacteria | 2645 |
| 379 | Ga0495667_0110917 | 3300046559 | Bacteria | 1772 |
| 380 | Ga0495634_0006920 | 3300046642 | Bacteria | 8571 |
| 381 | Ga0495635_0002907 | 3300046663 | Bacteria | 11768 |
| 382 | Ga0495635_0053722 | 3300046663 | Bacteria | 2775 |
| 383 | Ga0495657_0014595 | 3300046675 | Bacteria | 5764 |
| 384 | Ga0495599_0000684 | 3300046678 | Bacteria | 19253 |
| 385 | Ga0495599_0001448 | 3300046678 | Bacteria | 13611 |
| 386 | Ga0495599_0061940 | 3300046678 | Bacteria | 2337 |
| 387 | Ga0495599_0071417 | 3300046678 | Bacteria | 2167 |
| 388 | Ga0495623_0011647 | 3300046679 | Bacteria | 5697 |
| 389 | Ga0495646_0078021 | 3300046680 | Bacteria | 1936 |
| 390 | Ga0495658_0003277 | 3300046683 | Bacteria | 8044 |
| 391 | Ga0495658_0020147 | 3300046683 | Bacteria | 3495 |
| 392 | Ga0495658_0189520 | 3300046683 | Bacteria | 1278 |
| 393 | Ga0495669_0082810 | 3300046684 | Bacteria | 1474 |
| 394 | Ga0495613_0028133 | 3300046689 | Bacteria | 4182 |
| 395 | Ga0495613_0042051 | 3300046689 | Bacteria | 3382 |
| 396 | Ga0495624_0011667 | 3300046690 | Bacteria | 6035 |
| 397 | Ga0495600_0011543 | 3300046809 | Bacteria | 5508 |
| 398 | Ga0495600_0047265 | 3300046809 | Bacteria | 2807 |
| 399 | Ga0495674_0005934 | 3300047319 | Bacteria | 11722 |
| 400 | Ga0495674_0008528 | 3300047319 | Bacteria | 9755 |
| 401 | Ga0495672_0057821 | 3300047320 | Bacteria | 2251 |
| 402 | Ga0495680_0000363 | 3300047322 | Bacteria | 50862 |
| 403 | Ga0495675_0006056 | 3300047444 | Bacteria | 7403 |
| 404 | Ga0495684_0066523 | 3300047471 | Bacteria | 2740 |
| 405 | Ga0495684_0073224 | 3300047471 | Bacteria | 2602 |
| 406 | Ga0495593_0011918 | 3300047673 | Bacteria | 4986 |
| 407 | Ga0496102_0317651 | 3300048905 | Bacteria | 1467 |
| 408 | Ga0496104_0217789 | 3300048907 | Bacteria | 1821 |
| 409 | Ga0496108_0419873 | 3300048911 | Bacteria | 1168 |
| 410 | Ga0496109_0257933 | 3300048912 | Bacteria | 1642 |
| 411 | Ga0496111_0125358 | 3300048914 | Bacteria | 1898 |
| 412 | Ga0496112_0210440 | 3300048915 | Bacteria | 1902 |
| 413 | Ga0496115_0065497 | 3300048918 | Bacteria | 2935 |
| 414 | Ga0501031_0252125 | 3300049568 | Bacteria | 1147 |
| 415 | Ga0501032_0098516 | 3300049569 | Unclassified | 1937 |
| 416 | Ga0501033_0097677 | 3300049570 | Unclassified | 2145 |
| 417 | Ga0501034_0064295 | 3300049571 | Bacteria | 3683 |
| 418 | Ga0501034_0159847 | 3300049571 | Unclassified | 2225 |
| 419 | Ga0501036_0105458 | 3300049572 | Bacteria | 2384 |
| 420 | Ga0501036_0206462 | 3300049572 | Bacteria | 1651 |
| 421 | Ga0501039_0119358 | 3300049575 | Bacteria | 2066 |
| 422 | Ga0501040_0013684 | 3300049576 | Bacteria | 5336 |
| 423 | Ga0501041_0005857 | 3300049577 | Bacteria | 7186 |
| 424 | Ga0501041_0040199 | 3300049577 | Bacteria | 2838 |
| 425 | Ga0501042_0002819 | 3300049578 | Bacteria | 10768 |
| 426 | Ga0501043_0061705 | 3300049579 | Unclassified | 2943 |
| 427 | Ga0501046_0066745 | 3300049580 | Unclassified | 2803 |
| 428 | Ga0501046_0071356 | 3300049580 | Bacteria | 2699 |
| 429 | Ga0501046_0183786 | 3300049580 | Bacteria | 1562 |
| 430 | Ga0501047_0005005 | 3300049581 | Bacteria | 12437 |
| 431 | Ga0501048_0042882 | 3300049582 | Bacteria | 3239 |
| 432 | Ga0501048_0091849 | 3300049582 | Bacteria | 2141 |
| 433 | Ga0501048_0154482 | 3300049582 | Bacteria | 1623 |
| 434 | Ga0501068_0017092 | 3300049584 | Bacteria | 4192 |
| 435 | Ga0501069_0131941 | 3300049585 | Bacteria | 1431 |
| 436 | Ga0501070_0080799 | 3300049586 | Bacteria | 2689 |
| 437 | Ga0501070_0275788 | 3300049586 | Bacteria | 1372 |
| 438 | Ga0501071_0020981 | 3300049587 | Bacteria | 4547 |
| 439 | Ga0501071_0046908 | 3300049587 | Bacteria | 3103 |
| 440 | Ga0501071_0193166 | 3300049587 | Bacteria | 1527 |
| 441 | Ga0501072_0002669 | 3300049588 | Bacteria | 13374 |
| 442 | Ga0501072_0011738 | 3300049588 | Bacteria | 6694 |
| 443 | Ga0501072_0109024 | 3300049588 | Bacteria | 2203 |
| 444 | Ga0501072_0114894 | 3300049588 | Bacteria | 2143 |
| 445 | Ga0501072_0255964 | 3300049588 | Bacteria | 1394 |
| 446 | Ga0501075_0034527 | 3300049591 | Bacteria | 3766 |
| 447 | Ga0501075_0065321 | 3300049591 | Bacteria | 2745 |
| 448 | Ga0501075_0132970 | 3300049591 | Bacteria | 1895 |
| 449 | Ga0501076_0003456 | 3300049592 | Bacteria | 11084 |
| 450 | Ga0501076_0114587 | 3300049592 | Bacteria | 2181 |
| 451 | Ga0501077_0028017 | 3300049593 | Bacteria | 3580 |
| 452 | Ga0501077_0058600 | 3300049593 | Bacteria | 2445 |
| 453 | Ga0501077_0059055 | 3300049593 | Bacteria | 2435 |
| 454 | Ga0501079_0000323 | 3300049741 | Bacteria | 30084 |
| 455 | Ga0501079_0071414 | 3300049741 | Bacteria | 2682 |
| 456 | Ga0501079_0180111 | 3300049741 | Bacteria | 1649 |
| 457 | Ga0501079_0310683 | 3300049741 | Bacteria | 1233 |
| 458 | Ga0501080_0005501 | 3300049742 | Bacteria | 11306 |
| 459 | Ga0501080_0115390 | 3300049742 | Bacteria | 2490 |
| 460 | Ga0501081_0180129 | 3300049743 | Bacteria | 1528 |
| 461 | Ga0501035_0168905 | 3300049822 | Unclassified | 1890 |
| 462 | Ga0501035_0206842 | 3300049822 | Bacteria | 1681 |
| 463 | Ga0501044_0142942 | 3300049823 | Bacteria | 2380 |
| 464 | Ga0501044_0320945 | 3300049823 | Bacteria | 1473 |
| 465 | Ga0501045_0005023 | 3300049824 | Bacteria | 9166 |
| 466 | Ga0501045_0013107 | 3300049824 | Bacteria | 5848 |
| 467 | Ga0501045_0234664 | 3300049824 | Bacteria | 1365 |
| 468 | nmdc:mga00v17_145073_c1 | 3300050491 | Bacteria | 1523 |
| 469 | nmdc:mga05p37_303718_c1 | 3300050507 | Bacteria | 1895 |
| 470 | nmdc:mga09592_106255_c1 | 3300050508 | Bacteria | 2407 |
| 471 | nmdc:mga09592_9460_c1 | 3300050508 | Bacteria | 7920 |
| 472 | nmdc:mga0qj67_23645_c1 | 3300050509 | Bacteria | 4728 |
| 473 | nmdc:mga0qj67_7198_c1 | 3300050509 | Bacteria | 8214 |
| 474 | nmdc:mga06r32_109074_c1 | 3300050510 | Bacteria | 2722 |
| 475 | nmdc:mga06r32_184958_c1 | 3300050510 | Bacteria | 2070 |
| 476 | nmdc:mga06r32_44791_c1 | 3300050510 | Bacteria | 4215 |
| 477 | nmdc:mga06r32_7623_c1 | 3300050510 | Bacteria | 9733 |
| 478 | nmdc:mga08y16_185854_c1 | 3300050511 | Bacteria | 2157 |
| 479 | nmdc:mga08y16_21112_c1 | 3300050511 | Bacteria | 6875 |
| 480 | nmdc:mga08y16_501678_c1 | 3300050511 | Bacteria | 1233 |
| 481 | nmdc:mga0n895_28770_c1 | 3300050512 | Bacteria | 5290 |
| 482 | nmdc:mga0rr50_152820_c1 | 3300050513 | Bacteria | 1867 |
| 483 | Ga0495601_0003774 | 3300053077 | Bacteria | 8721 |
| 484 | Ga0495601_0006586 | 3300053077 | Bacteria | 6793 |
| 485 | Ga0495601_0094160 | 3300053077 | Bacteria | 1930 |
| 486 | Ga0495612_0065550 | 3300053078 | Bacteria | 1508 |
| 487 | Ga0495595_0000296 | 3300053084 | Bacteria | 19337 |
| 488 | Ga0495619_0003061 | 3300053085 | Bacteria | 10857 |
| 489 | Ga0495619_0006623 | 3300053085 | Bacteria | 7330 |
| 490 | Ga0495619_0012058 | 3300053085 | Bacteria | 5445 |
| 491 | Ga0500646_0000771 | 3300053090 | Bacteria | 8997 |
| 492 | Ga0500604_0000329 | 3300053151 | Bacteria | 13186 |
| 493 | Ga0501084_0213223 | 3300054114 | Bacteria | 1629 |
| 494 | Ga0501082_0035298 | 3300060353 | Bacteria | 4310 |
| 495 | Ga0501082_0095879 | 3300060353 | Bacteria | 2564 |
| 496 | Ga0501082_0155250 | 3300060353 | Bacteria | 1988 |
| 497 | Ga0530510_0000769 | 3300061734 | Bacteria | 20843 |
| 498 | Ga0530510_0006623 | 3300061734 | Bacteria | 8077 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006881 | Ga0068865_100001154 | Ga0068865_1000011542 | 269 |
| 2 | 3300025938 | Ga0207704_10002332 | Ga0207704_100023323 | 269 |
| 3 | 3300026095 | Ga0207676_10277507 | Ga0207676_102775072 | 288 |
| 4 | 3300005546 | Ga0070696_100000665 | Ga0070696_1000006659 | 302 |
| 5 | 3300009176 | Ga0105242_10020100 | Ga0105242_100201002 | 311 |
| 6 | 3300009176 | Ga0105242_10020636 | Ga0105242_100206363 | 311 |
| 7 | 3300009545 | Ga0105237_10012555 | Ga0105237_100125554 | 311 |
| 8 | 3300010375 | Ga0105239_10032279 | Ga0105239_100322793 | 311 |
| 9 | 3300013105 | Ga0157369_10140409 | Ga0157369_101404093 | 311 |
| 10 | 3300013296 | Ga0157374_10084500 | Ga0157374_100845003 | 311 |
| 11 | 3300013307 | Ga0157372_10409253 | Ga0157372_104092532 | 311 |
| 12 | 3300014325 | Ga0163163_10549662 | Ga0163163_105496621 | 311 |
| 13 | 3300014968 | Ga0157379_10280751 | Ga0157379_102807512 | 311 |
| 14 | 3300035117 | Ga0373953_0006425 | Ga0373953_0006425_2208_3257 | 311 |
| 15 | 3300035118 | Ga0373954_0006094 | Ga0373954_0006094_1667_2716 | 311 |
| 16 | 3300035120 | Ga0373957_0007711 | Ga0373957_0007711_1834_2883 | 311 |
| 17 | 3300035172 | Ga0373955_0007644 | Ga0373955_0007644_2539_3588 | 311 |
| 18 | 3300036401 | Ga0373937_0024477 | Ga0373937_0024477_1638_2687 | 311 |
| 19 | 3300046559 | Ga0495667_0110917 | Ga0495667_0110917_331_1380 | 311 |
| 20 | 3300046689 | Ga0495613_0028133 | Ga0495613_0028133_2519_3568 | 311 |
| 21 | 3300047471 | Ga0495684_0066523 | Ga0495684_0066523_870_1919 | 311 |
| 22 | 3300049578 | Ga0501042_0002819 | Ga0501042_0002819_9742_10740 | 313 |
| 23 | 3300009553 | Ga0105249_10255269 | Ga0105249_102552691 | 314 |
| 24 | 3300009177 | Ga0105248_10176321 | Ga0105248_101763212 | 317 |
| 25 | 3300005334 | Ga0068869_100145861 | Ga0068869_1001458612 | 318 |
| 26 | 3300005535 | Ga0070684_100032420 | Ga0070684_1000324203 | 318 |
| 27 | 3300005539 | Ga0068853_100026587 | Ga0068853_1000265873 | 318 |
| 28 | 3300005841 | Ga0068863_100100664 | Ga0068863_1001006643 | 318 |
| 29 | 3300005843 | Ga0068860_100075949 | Ga0068860_1000759492 | 318 |
| 30 | 3300025914 | Ga0207671_10027627 | Ga0207671_100276273 | 318 |
| 31 | 3300025927 | Ga0207687_10045993 | Ga0207687_100459933 | 318 |
| 32 | 3300025934 | Ga0207686_10018281 | Ga0207686_100182813 | 318 |
| 33 | 3300025941 | Ga0207711_10374443 | Ga0207711_103744431 | 318 |
| 34 | 3300025944 | Ga0207661_10204886 | Ga0207661_102048862 | 318 |
| 35 | 3300026035 | Ga0207703_10303139 | Ga0207703_103031391 | 318 |
| 36 | 3300026041 | Ga0207639_10057461 | Ga0207639_100574612 | 318 |
| 37 | 3300028381 | Ga0268264_10053353 | Ga0268264_100533532 | 318 |
| 38 | 3300025961 | Ga0207712_10093856 | Ga0207712_100938562 | 321 |
| 39 | 3300046472 | Ga0495580_0229960 | Ga0495580_0229960_198_1253 | 321 |
| 40 | 3300009093 | Ga0105240_10000780 | Ga0105240_100007805 | 322 |
| 41 | 3300006846 | Ga0075430_100029137 | Ga0075430_1000291372 | 323 |
| 42 | 3300006847 | Ga0075431_100000307 | Ga0075431_10000030732 | 323 |
| 43 | 3300006880 | Ga0075429_100155755 | Ga0075429_1001557552 | 323 |
| 44 | 3300050508 | nmdc:mga09592_106255_c1 | nmdc:mga09592_106255_c1_1313_2386 | 323 |
| 45 | 3300050509 | nmdc:mga0qj67_23645_c1 | nmdc:mga0qj67_23645_c1_3368_4441 | 323 |
| 46 | 3300050510 | nmdc:mga06r32_7623_c1 | nmdc:mga06r32_7623_c1_4060_5133 | 323 |
| 47 | 3300037853 | Ga0436364_1209713 | Ga0436364_1209713_29_1009 | 324 |
| 48 | 3300050511 | nmdc:mga08y16_185854_c1 | nmdc:mga08y16_185854_c1_1152_2132 | 325 |
| 49 | 3300020070 | Ga0206356_11215269 | Ga0206356_112152691 | 327 |
| 50 | 3300049585 | Ga0501069_0131941 | Ga0501069_0131941_57_1052 | 327 |
| 51 | 3300049575 | Ga0501039_0119358 | Ga0501039_0119358_924_1991 | 329 |
| 52 | 3300028800 | Ga0265338_10117676 | Ga0265338_101176763 | 330 |
| 53 | 3300049568 | Ga0501031_0252125 | Ga0501031_0252125_28_1089 | 332 |
| 54 | 3300049572 | Ga0501036_0206462 | Ga0501036_0206462_463_1524 | 332 |
| 55 | 3300049576 | Ga0501040_0013684 | Ga0501040_0013684_3045_4106 | 332 |
| 56 | 3300049577 | Ga0501041_0005857 | Ga0501041_0005857_5369_6430 | 332 |
| 57 | 3300049580 | Ga0501046_0071356 | Ga0501046_0071356_1003_2064 | 332 |
| 58 | 3300049582 | Ga0501048_0091849 | Ga0501048_0091849_301_1362 | 332 |
| 59 | 3300049587 | Ga0501071_0046908 | Ga0501071_0046908_110_1171 | 332 |
| 60 | 3300049588 | Ga0501072_0002669 | Ga0501072_0002669_1989_3050 | 332 |
| 61 | 3300049592 | Ga0501076_0114587 | Ga0501076_0114587_1090_2151 | 332 |
| 62 | 3300049741 | Ga0501079_0000323 | Ga0501079_0000323_2044_3105 | 332 |
| 63 | 3300049742 | Ga0501080_0115390 | Ga0501080_0115390_1111_2172 | 332 |
| 64 | 3300049824 | Ga0501045_0005023 | Ga0501045_0005023_348_1409 | 332 |
| 65 | 3300060353 | Ga0501082_0035298 | Ga0501082_0035298_906_1967 | 332 |
| 66 | 3300061734 | Ga0530510_0000769 | Ga0530510_0000769_19742_20803 | 332 |
| 67 | 3300021441 | Ga0213871_10040563 | Ga0213871_100405632 | 333 |
| 68 | 3300036401 | Ga0373937_0377429 | Ga0373937_0377429_23_1030 | 334 |
| 69 | 3300039062 | Ga0400483_211488 | Ga0400483_211488_68_1138 | 336 |
| 70 | 3300042439 | Ga0439464_0001416 | Ga0439464_0001416_2679_3746 | 337 |
| 71 | 3300005353 | Ga0070669_100011878 | Ga0070669_1000118787 | 341 |
| 72 | 3300005354 | Ga0070675_100065732 | Ga0070675_1000657321 | 341 |
| 73 | 3300005365 | Ga0070688_100161747 | Ga0070688_1001617471 | 341 |
| 74 | 3300005441 | Ga0070700_100045274 | Ga0070700_1000452742 | 341 |
| 75 | 3300005466 | Ga0070685_10084102 | Ga0070685_100841022 | 341 |
| 76 | 3300005618 | Ga0068864_100351120 | Ga0068864_1003511201 | 341 |
| 77 | 3300006237 | Ga0097621_100083200 | Ga0097621_1000832003 | 341 |
| 78 | 3300006358 | Ga0068871_100020011 | Ga0068871_1000200113 | 341 |
| 79 | 3300009148 | Ga0105243_10100544 | Ga0105243_101005442 | 341 |
| 80 | 3300013297 | Ga0157378_10029647 | Ga0157378_100296472 | 341 |
| 81 | 3300014326 | Ga0157380_10103126 | Ga0157380_101031262 | 341 |
| 82 | 3300025907 | Ga0207645_10166156 | Ga0207645_101661561 | 341 |
| 83 | 3300025942 | Ga0207689_10005226 | Ga0207689_100052265 | 341 |
| 84 | 3300026075 | Ga0207708_10240464 | Ga0207708_102404642 | 341 |
| 85 | 3300026088 | Ga0207641_10116983 | Ga0207641_101169833 | 341 |
| 86 | 3300026118 | Ga0207675_100007847 | Ga0207675_1000078477 | 341 |
| 87 | 3300026121 | Ga0207683_10014757 | Ga0207683_100147575 | 341 |
| 88 | 3300028380 | Ga0268265_10299631 | Ga0268265_102996312 | 341 |
| 89 | 3300031235 | Ga0265330_10002013 | Ga0265330_100020135 | 341 |
| 90 | 3300031238 | Ga0265332_10000199 | Ga0265332_100001999 | 341 |
| 91 | 3300031241 | Ga0265325_10022307 | Ga0265325_100223073 | 341 |
| 92 | 3300031242 | Ga0265329_10000991 | Ga0265329_100009914 | 341 |
| 93 | 3300031249 | Ga0265339_10140691 | Ga0265339_101406911 | 341 |
| 94 | 3300031250 | Ga0265331_10001027 | Ga0265331_100010276 | 341 |
| 95 | 3300031251 | Ga0265327_10003598 | Ga0265327_100035986 | 341 |
| 96 | 3300031344 | Ga0265316_10010249 | Ga0265316_100102497 | 341 |
| 97 | 3300031712 | Ga0265342_10006173 | Ga0265342_100061739 | 341 |
| 98 | 3300005459 | Ga0068867_100007220 | Ga0068867_1000072202 | 342 |
| 99 | 3300007265 | Ga0099794_10021420 | Ga0099794_100214201 | 342 |
| 100 | 3300026089 | Ga0207648_10094046 | Ga0207648_100940462 | 342 |
| 101 | 3300035083 | Ga0373926_0012145 | Ga0373926_0012145_1718_2749 | 342 |
| 102 | 3300035113 | Ga0373936_0008966 | Ga0373936_0008966_2177_3208 | 342 |
| 103 | 3300035171 | Ga0373946_0012569 | Ga0373946_0012569_220_1251 | 342 |
| 104 | 3300035172 | Ga0373955_0002161 | Ga0373955_0002161_3247_4278 | 342 |
| 105 | 3300046461 | Ga0495641_0034875 | Ga0495641_0034875_1278_2309 | 342 |
| 106 | 3300046462 | Ga0495651_0006469 | Ga0495651_0006469_2452_3483 | 342 |
| 107 | 3300046463 | Ga0495653_0007068 | Ga0495653_0007068_2748_3779 | 342 |
| 108 | 3300046473 | Ga0495582_0017891 | Ga0495582_0017891_502_1533 | 342 |
| 109 | 3300046475 | Ga0495639_0003619 | Ga0495639_0003619_1044_2075 | 342 |
| 110 | 3300046476 | Ga0495662_0015857 | Ga0495662_0015857_1275_2306 | 342 |
| 111 | 3300046511 | Ga0495608_0006821 | Ga0495608_0006821_5637_6668 | 342 |
| 112 | 3300046516 | Ga0495628_0013837 | Ga0495628_0013837_4085_5116 | 342 |
| 113 | 3300046535 | Ga0495586_0001410 | Ga0495586_0001410_1269_2300 | 342 |
| 114 | 3300046642 | Ga0495634_0006920 | Ga0495634_0006920_1429_2460 | 342 |
| 115 | 3300046663 | Ga0495635_0002907 | Ga0495635_0002907_1248_2279 | 342 |
| 116 | 3300046683 | Ga0495658_0003277 | Ga0495658_0003277_1031_2062 | 342 |
| 117 | 3300046689 | Ga0495613_0042051 | Ga0495613_0042051_1780_2811 | 342 |
| 118 | 3300046809 | Ga0495600_0011543 | Ga0495600_0011543_345_1376 | 342 |
| 119 | 3300047319 | Ga0495674_0008528 | Ga0495674_0008528_1631_2662 | 342 |
| 120 | 3300047444 | Ga0495675_0006056 | Ga0495675_0006056_1153_2184 | 342 |
| 121 | 3300053077 | Ga0495601_0003774 | Ga0495601_0003774_5640_6671 | 342 |
| 122 | 3300053085 | Ga0495619_0012058 | Ga0495619_0012058_1269_2300 | 342 |
| 123 | 3300049593 | Ga0501077_0059055 | Ga0501077_0059055_916_2040 | 343 |
| 124 | 3300005329 | Ga0070683_100019858 | Ga0070683_1000198581 | 345 |
| 125 | 3300005339 | Ga0070660_100016015 | Ga0070660_1000160152 | 345 |
| 126 | 3300005344 | Ga0070661_100000620 | Ga0070661_10000062016 | 345 |
| 127 | 3300005435 | Ga0070714_100002858 | Ga0070714_1000028582 | 345 |
| 128 | 3300005458 | Ga0070681_10026284 | Ga0070681_100262842 | 345 |
| 129 | 3300005535 | Ga0070684_100009360 | Ga0070684_1000093602 | 345 |
| 130 | 3300005577 | Ga0068857_100003360 | Ga0068857_1000033602 | 345 |
| 131 | 3300005578 | Ga0068854_100001488 | Ga0068854_1000014883 | 345 |
| 132 | 3300005614 | Ga0068856_100019529 | Ga0068856_1000195294 | 345 |
| 133 | 3300009093 | Ga0105240_10001181 | Ga0105240_1000118120 | 345 |
| 134 | 3300009551 | Ga0105238_10039131 | Ga0105238_100391314 | 345 |
| 135 | 3300013100 | Ga0157373_10031559 | Ga0157373_100315592 | 345 |
| 136 | 3300013104 | Ga0157370_10014726 | Ga0157370_100147265 | 345 |
| 137 | 3300013307 | Ga0157372_10000854 | Ga0157372_100008542 | 345 |
| 138 | 3300025912 | Ga0207707_10077546 | Ga0207707_100775462 | 345 |
| 139 | 3300025913 | Ga0207695_10008281 | Ga0207695_100082812 | 345 |
| 140 | 3300025919 | Ga0207657_10002918 | Ga0207657_1000291812 | 345 |
| 141 | 3300025920 | Ga0207649_10013764 | Ga0207649_100137644 | 345 |
| 142 | 3300025929 | Ga0207664_10003432 | Ga0207664_100034322 | 345 |
| 143 | 3300025944 | Ga0207661_10016498 | Ga0207661_100164985 | 345 |
| 144 | 3300025949 | Ga0207667_10025128 | Ga0207667_100251282 | 345 |
| 145 | 3300025981 | Ga0207640_10004727 | Ga0207640_100047276 | 345 |
| 146 | 3300026078 | Ga0207702_10002279 | Ga0207702_100022798 | 345 |
| 147 | 3300026116 | Ga0207674_10000022 | Ga0207674_1000002283 | 345 |
| 148 | 3300037471 | Ga0395905_0411355 | Ga0395905_0411355_54_1160 | 345 |
| 149 | 3300046515 | Ga0495620_0057021 | Ga0495620_0057021_251_1294 | 346 |
| 150 | 3300046684 | Ga0495669_0082810 | Ga0495669_0082810_171_1214 | 346 |
| 151 | 3300027364 | Ga0209967_1000767 | Ga0209967_10007673 | 347 |
| 152 | 3300027378 | Ga0209981_1000591 | Ga0209981_10005915 | 347 |
| 153 | 3300027395 | Ga0209996_1003604 | Ga0209996_10036043 | 347 |
| 154 | 3300027462 | Ga0210000_1000081 | Ga0210000_10000815 | 347 |
| 155 | 3300027471 | Ga0209995_1000402 | Ga0209995_10004025 | 347 |
| 156 | 3300027543 | Ga0209999_1000253 | Ga0209999_10002532 | 347 |
| 157 | 3300049584 | Ga0501068_0017092 | Ga0501068_0017092_2286_3338 | 347 |
| 158 | 3300049587 | Ga0501071_0020981 | Ga0501071_0020981_2759_3811 | 347 |
| 159 | 3300049588 | Ga0501072_0109024 | Ga0501072_0109024_216_1268 | 347 |
| 160 | 3300049588 | Ga0501072_0255964 | Ga0501072_0255964_105_1223 | 347 |
| 161 | 3300049742 | Ga0501080_0005501 | Ga0501080_0005501_1594_2646 | 347 |
| 162 | 3300048907 | Ga0496104_0217789 | Ga0496104_0217789_720_1769 | 348 |
| 163 | 3300048915 | Ga0496112_0210440 | Ga0496112_0210440_722_1771 | 348 |
| 164 | 3300049588 | Ga0501072_0011738 | Ga0501072_0011738_3750_4805 | 348 |
| 165 | 3300049591 | Ga0501075_0132970 | Ga0501075_0132970_114_1169 | 348 |
| 166 | 3300049593 | Ga0501077_0058600 | Ga0501077_0058600_223_1278 | 348 |
| 167 | 3300049741 | Ga0501079_0071414 | Ga0501079_0071414_824_1879 | 348 |
| 168 | 3300049822 | Ga0501035_0206842 | Ga0501035_0206842_368_1423 | 348 |
| 169 | 3300060353 | Ga0501082_0095879 | Ga0501082_0095879_59_1114 | 348 |
| 170 | 3300061734 | Ga0530510_0006623 | Ga0530510_0006623_1485_2540 | 348 |
| 171 | 3300005440 | Ga0070705_100104155 | Ga0070705_1001041552 | 349 |
| 172 | 3300005615 | Ga0070702_100056568 | Ga0070702_1000565682 | 349 |
| 173 | 3300006844 | Ga0075428_100049674 | Ga0075428_1000496743 | 349 |
| 174 | 3300006847 | Ga0075431_100065250 | Ga0075431_1000652503 | 349 |
| 175 | 3300006852 | Ga0075433_10093495 | Ga0075433_100934952 | 349 |
| 176 | 3300025928 | Ga0207700_10091169 | Ga0207700_100911692 | 349 |
| 177 | 3300025939 | Ga0207665_10089010 | Ga0207665_100890102 | 349 |
| 178 | 3300027526 | Ga0209968_1000708 | Ga0209968_10007082 | 349 |
| 179 | 3300035086 | Ga0373934_0018143 | Ga0373934_0018143_1515_2573 | 349 |
| 180 | 3300035118 | Ga0373954_0002637 | Ga0373954_0002637_1958_3016 | 349 |
| 181 | 3300035410 | Ga0373924_0001847 | Ga0373924_0001847_3494_4552 | 349 |
| 182 | 3300046477 | Ga0495664_0000685 | Ga0495664_0000685_5668_6726 | 349 |
| 183 | 3300046514 | Ga0495618_0101518 | Ga0495618_0101518_589_1647 | 349 |
| 184 | 3300046516 | Ga0495628_0001118 | Ga0495628_0001118_21205_22263 | 349 |
| 185 | 3300046516 | Ga0495628_0013977 | Ga0495628_0013977_1498_2556 | 349 |
| 186 | 3300046529 | Ga0495652_0000469 | Ga0495652_0000469_17675_18733 | 349 |
| 187 | 3300046543 | Ga0495645_0000044 | Ga0495645_0000044_37908_38966 | 349 |
| 188 | 3300046559 | Ga0495667_0053997 | Ga0495667_0053997_1008_2066 | 349 |
| 189 | 3300046675 | Ga0495657_0014595 | Ga0495657_0014595_1396_2454 | 349 |
| 190 | 3300046678 | Ga0495599_0000684 | Ga0495599_0000684_15317_16375 | 349 |
| 191 | 3300046678 | Ga0495599_0001448 | Ga0495599_0001448_8665_9723 | 349 |
| 192 | 3300047471 | Ga0495684_0073224 | Ga0495684_0073224_1381_2439 | 349 |
| 193 | 3300049591 | Ga0501075_0065321 | Ga0501075_0065321_806_1963 | 349 |
| 194 | 3300049741 | Ga0501079_0310683 | Ga0501079_0310683_13_1128 | 349 |
| 195 | 3300050510 | nmdc:mga06r32_44791_c1 | nmdc:mga06r32_44791_c1_1354_2430 | 349 |
| 196 | 3300053077 | Ga0495601_0094160 | Ga0495601_0094160_580_1638 | 349 |
| 197 | 3300039453 | Ga0436362_0682656 | Ga0436362_0682656_364_1443 | 350 |
| 198 | 3300047320 | Ga0495672_0057821 | Ga0495672_0057821_1033_2097 | 350 |
| 199 | 3300005329 | Ga0070683_100230770 | Ga0070683_1002307702 | 351 |
| 200 | 3300005434 | Ga0070709_10012776 | Ga0070709_100127764 | 351 |
| 201 | 3300005435 | Ga0070714_100066309 | Ga0070714_1000663093 | 351 |
| 202 | 3300005437 | Ga0070710_10022267 | Ga0070710_100222673 | 351 |
| 203 | 3300006163 | Ga0070715_10032185 | Ga0070715_100321852 | 351 |
| 204 | 3300021388 | Ga0213875_10000040 | Ga0213875_1000004025 | 351 |
| 205 | 3300025898 | Ga0207692_10047048 | Ga0207692_100470481 | 351 |
| 206 | 3300025905 | Ga0207685_10019450 | Ga0207685_100194502 | 351 |
| 207 | 3300025906 | Ga0207699_10009723 | Ga0207699_100097232 | 351 |
| 208 | 3300025926 | Ga0207659_10087782 | Ga0207659_100877823 | 351 |
| 209 | 3300025929 | Ga0207664_10031758 | Ga0207664_100317582 | 351 |
| 210 | 3300025933 | Ga0207706_10117659 | Ga0207706_101176592 | 351 |
| 211 | 3300025944 | Ga0207661_10073400 | Ga0207661_100734002 | 351 |
| 212 | 3300026116 | Ga0207674_10235329 | Ga0207674_102353292 | 351 |
| 213 | 3300026142 | Ga0207698_10199550 | Ga0207698_101995502 | 351 |
| 214 | 3300048914 | Ga0496111_0125358 | Ga0496111_0125358_461_1525 | 351 |
| 215 | 3300005549 | Ga0070704_100002392 | Ga0070704_1000023922 | 352 |
| 216 | 3300005564 | Ga0070664_100037070 | Ga0070664_1000370704 | 352 |
| 217 | 3300006846 | Ga0075430_100021232 | Ga0075430_1000212325 | 352 |
| 218 | 3300006847 | Ga0075431_100093908 | Ga0075431_1000939082 | 352 |
| 219 | 3300006852 | Ga0075433_10062535 | Ga0075433_100625353 | 352 |
| 220 | 3300021388 | Ga0213875_10005885 | Ga0213875_100058851 | 352 |
| 221 | 3300025917 | Ga0207660_10104852 | Ga0207660_101048521 | 352 |
| 222 | 3300025945 | Ga0207679_10021618 | Ga0207679_100216183 | 352 |
| 223 | 3300027876 | Ga0209974_10010773 | Ga0209974_100107733 | 352 |
| 224 | 3300037853 | Ga0436364_0374996 | Ga0436364_0374996_215_1285 | 352 |
| 225 | 3300049571 | Ga0501034_0064295 | Ga0501034_0064295_368_1435 | 352 |
| 226 | 3300049572 | Ga0501036_0105458 | Ga0501036_0105458_1242_2312 | 352 |
| 227 | 3300049580 | Ga0501046_0183786 | Ga0501046_0183786_291_1361 | 352 |
| 228 | 3300049582 | Ga0501048_0154482 | Ga0501048_0154482_305_1375 | 352 |
| 229 | 3300049587 | Ga0501071_0193166 | Ga0501071_0193166_283_1353 | 352 |
| 230 | 3300049741 | Ga0501079_0180111 | Ga0501079_0180111_120_1190 | 352 |
| 231 | 3300049743 | Ga0501081_0180129 | Ga0501081_0180129_188_1258 | 352 |
| 232 | 3300049824 | Ga0501045_0234664 | Ga0501045_0234664_241_1311 | 352 |
| 233 | 3300050509 | nmdc:mga0qj67_7198_c1 | nmdc:mga0qj67_7198_c1_918_1985 | 352 |
| 234 | 3300050510 | nmdc:mga06r32_184958_c1 | nmdc:mga06r32_184958_c1_652_1719 | 352 |
| 235 | 3300050512 | nmdc:mga0n895_28770_c1 | nmdc:mga0n895_28770_c1_976_2109 | 352 |
| 236 | 3300054114 | Ga0501084_0213223 | Ga0501084_0213223_413_1483 | 352 |
| 237 | 2162886012 | MBSR1b_contig_3467282 | MBSR1b_0401.00007520 | 353 |
| 238 | 3300005295 | Ga0065707_10213590 | Ga0065707_102135901 | 353 |
| 239 | 3300005328 | Ga0070676_10024851 | Ga0070676_100248513 | 353 |
| 240 | 3300005330 | Ga0070690_100061882 | Ga0070690_1000618824 | 353 |
| 241 | 3300005331 | Ga0070670_100027589 | Ga0070670_1000275894 | 353 |
| 242 | 3300005331 | Ga0070670_100033992 | Ga0070670_1000339922 | 353 |
| 243 | 3300005331 | Ga0070670_100050283 | Ga0070670_1000502833 | 353 |
| 244 | 3300005334 | Ga0068869_100000160 | Ga0068869_1000001608 | 353 |
| 245 | 3300005335 | Ga0070666_10110978 | Ga0070666_101109782 | 353 |
| 246 | 3300005335 | Ga0070666_10216737 | Ga0070666_102167372 | 353 |
| 247 | 3300005336 | Ga0070680_100119054 | Ga0070680_1001190541 | 353 |
| 248 | 3300005338 | Ga0068868_100014921 | Ga0068868_1000149213 | 353 |
| 249 | 3300005338 | Ga0068868_100113707 | Ga0068868_1001137073 | 353 |
| 250 | 3300005340 | Ga0070689_100072365 | Ga0070689_1000723653 | 353 |
| 251 | 3300005343 | Ga0070687_100004543 | Ga0070687_1000045434 | 353 |
| 252 | 3300005353 | Ga0070669_100031053 | Ga0070669_1000310532 | 353 |
| 253 | 3300005353 | Ga0070669_100083135 | Ga0070669_1000831351 | 353 |
| 254 | 3300005354 | Ga0070675_100029112 | Ga0070675_1000291122 | 353 |
| 255 | 3300005354 | Ga0070675_100060594 | Ga0070675_1000605944 | 353 |
| 256 | 3300005354 | Ga0070675_100115292 | Ga0070675_1001152922 | 353 |
| 257 | 3300005354 | Ga0070675_100209625 | Ga0070675_1002096252 | 353 |
| 258 | 3300005355 | Ga0070671_100044932 | Ga0070671_1000449322 | 353 |
| 259 | 3300005364 | Ga0070673_100048813 | Ga0070673_1000488133 | 353 |
| 260 | 3300005364 | Ga0070673_100060663 | Ga0070673_1000606633 | 353 |
| 261 | 3300005365 | Ga0070688_100018714 | Ga0070688_1000187143 | 353 |
| 262 | 3300005366 | Ga0070659_100102397 | Ga0070659_1001023971 | 353 |
| 263 | 3300005367 | Ga0070667_100015642 | Ga0070667_1000156424 | 353 |
| 264 | 3300005367 | Ga0070667_100260164 | Ga0070667_1002601641 | 353 |
| 265 | 3300005436 | Ga0070713_100002510 | Ga0070713_1000025106 | 353 |
| 266 | 3300005438 | Ga0070701_10040097 | Ga0070701_100400973 | 353 |
| 267 | 3300005444 | Ga0070694_100041782 | Ga0070694_1000417822 | 353 |
| 268 | 3300005445 | Ga0070708_100103017 | Ga0070708_1001030172 | 353 |
| 269 | 3300005458 | Ga0070681_10025486 | Ga0070681_100254864 | 353 |
| 270 | 3300005459 | Ga0068867_100006924 | Ga0068867_1000069242 | 353 |
| 271 | 3300005467 | Ga0070706_100126961 | Ga0070706_1001269613 | 353 |
| 272 | 3300005468 | Ga0070707_100154860 | Ga0070707_1001548603 | 353 |
| 273 | 3300005471 | Ga0070698_100019996 | Ga0070698_1000199962 | 353 |
| 274 | 3300005536 | Ga0070697_100121823 | Ga0070697_1001218232 | 353 |
| 275 | 3300005543 | Ga0070672_100021376 | Ga0070672_1000213763 | 353 |
| 276 | 3300005543 | Ga0070672_100093417 | Ga0070672_1000934172 | 353 |
| 277 | 3300005544 | Ga0070686_100038807 | Ga0070686_1000388072 | 353 |
| 278 | 3300005545 | Ga0070695_100051247 | Ga0070695_1000512472 | 353 |
| 279 | 3300005546 | Ga0070696_100090148 | Ga0070696_1000901482 | 353 |
| 280 | 3300005547 | Ga0070693_100013949 | Ga0070693_1000139493 | 353 |
| 281 | 3300005548 | Ga0070665_100080002 | Ga0070665_1000800023 | 353 |
| 282 | 3300005549 | Ga0070704_100002331 | Ga0070704_1000023316 | 353 |
| 283 | 3300005549 | Ga0070704_100005685 | Ga0070704_1000056855 | 353 |
| 284 | 3300005549 | Ga0070704_100059794 | Ga0070704_1000597942 | 353 |
| 285 | 3300005564 | Ga0070664_100060500 | Ga0070664_1000605004 | 353 |
| 286 | 3300005564 | Ga0070664_100083104 | Ga0070664_1000831042 | 353 |
| 287 | 3300005564 | Ga0070664_100235648 | Ga0070664_1002356481 | 353 |
| 288 | 3300005577 | Ga0068857_100017599 | Ga0068857_1000175992 | 353 |
| 289 | 3300005578 | Ga0068854_100221530 | Ga0068854_1002215301 | 353 |
| 290 | 3300005615 | Ga0070702_100017930 | Ga0070702_1000179303 | 353 |
| 291 | 3300005617 | Ga0068859_100002394 | Ga0068859_1000023942 | 353 |
| 292 | 3300005618 | Ga0068864_100000395 | Ga0068864_1000003952 | 353 |
| 293 | 3300005618 | Ga0068864_100041019 | Ga0068864_1000410193 | 353 |
| 294 | 3300005618 | Ga0068864_100104294 | Ga0068864_1001042942 | 353 |
| 295 | 3300005618 | Ga0068864_100159062 | Ga0068864_1001590622 | 353 |
| 296 | 3300005718 | Ga0068866_10020734 | Ga0068866_100207342 | 353 |
| 297 | 3300005719 | Ga0068861_100003084 | Ga0068861_1000030848 | 353 |
| 298 | 3300005719 | Ga0068861_100213841 | Ga0068861_1002138411 | 353 |
| 299 | 3300005834 | Ga0068851_10055598 | Ga0068851_100555981 | 353 |
| 300 | 3300005840 | Ga0068870_10003450 | Ga0068870_100034504 | 353 |
| 301 | 3300005841 | Ga0068863_100005560 | Ga0068863_1000055607 | 353 |
| 302 | 3300005841 | Ga0068863_100079538 | Ga0068863_1000795382 | 353 |
| 303 | 3300005841 | Ga0068863_100083864 | Ga0068863_1000838642 | 353 |
| 304 | 3300005841 | Ga0068863_100087535 | Ga0068863_1000875353 | 353 |
| 305 | 3300005842 | Ga0068858_100022939 | Ga0068858_1000229394 | 353 |
| 306 | 3300005843 | Ga0068860_100015795 | Ga0068860_1000157956 | 353 |
| 307 | 3300005844 | Ga0068862_100096637 | Ga0068862_1000966372 | 353 |
| 308 | 3300005937 | Ga0081455_10004832 | Ga0081455_100048326 | 353 |
| 309 | 3300005981 | Ga0081538_10001845 | Ga0081538_1000184516 | 353 |
| 310 | 3300005981 | Ga0081538_10049794 | Ga0081538_100497942 | 353 |
| 311 | 3300006038 | Ga0075365_10162406 | Ga0075365_101624061 | 353 |
| 312 | 3300006178 | Ga0075367_10134375 | Ga0075367_101343752 | 353 |
| 313 | 3300006186 | Ga0075369_10089691 | Ga0075369_100896911 | 353 |
| 314 | 3300006195 | Ga0075366_10025324 | Ga0075366_100253244 | 353 |
| 315 | 3300006237 | Ga0097621_100029643 | Ga0097621_1000296433 | 353 |
| 316 | 3300006358 | Ga0068871_100049355 | Ga0068871_1000493553 | 353 |
| 317 | 3300006844 | Ga0075428_100000638 | Ga0075428_1000006389 | 353 |
| 318 | 3300006844 | Ga0075428_100129532 | Ga0075428_1001295321 | 353 |
| 319 | 3300006847 | Ga0075431_100386998 | Ga0075431_1003869981 | 353 |
| 320 | 3300006880 | Ga0075429_100011701 | Ga0075429_1000117012 | 353 |
| 321 | 3300006914 | Ga0075436_100110908 | Ga0075436_1001109082 | 353 |
| 322 | 3300006931 | Ga0097620_100002394 | Ga0097620_10000239417 | 353 |
| 323 | 3300007076 | Ga0075435_100010857 | Ga0075435_1000108575 | 353 |
| 324 | 3300007076 | Ga0075435_100129221 | Ga0075435_1001292212 | 353 |
| 325 | 3300007265 | Ga0099794_10077562 | Ga0099794_100775621 | 353 |
| 326 | 3300007788 | Ga0099795_10022112 | Ga0099795_100221121 | 353 |
| 327 | 3300009094 | Ga0111539_10004193 | Ga0111539_100041931 | 353 |
| 328 | 3300009098 | Ga0105245_10165719 | Ga0105245_101657192 | 353 |
| 329 | 3300009147 | Ga0114129_10186839 | Ga0114129_101868392 | 353 |
| 330 | 3300009148 | Ga0105243_10022371 | Ga0105243_100223714 | 353 |
| 331 | 3300009148 | Ga0105243_10206130 | Ga0105243_102061301 | 353 |
| 332 | 3300009176 | Ga0105242_10001652 | Ga0105242_1000165215 | 353 |
| 333 | 3300009176 | Ga0105242_10036038 | Ga0105242_100360382 | 353 |
| 334 | 3300009177 | Ga0105248_10002497 | Ga0105248_100024976 | 353 |
| 335 | 3300009177 | Ga0105248_10030740 | Ga0105248_100307408 | 353 |
| 336 | 3300009177 | Ga0105248_10047007 | Ga0105248_100470072 | 353 |
| 337 | 3300009553 | Ga0105249_10155903 | Ga0105249_101559031 | 353 |
| 338 | 3300009553 | Ga0105249_10521545 | Ga0105249_105215452 | 353 |
| 339 | 3300010159 | Ga0099796_10019895 | Ga0099796_100198951 | 353 |
| 340 | 3300011119 | Ga0105246_10142919 | Ga0105246_101429192 | 353 |
| 341 | 3300013100 | Ga0157373_10065965 | Ga0157373_100659653 | 353 |
| 342 | 3300013297 | Ga0157378_10047322 | Ga0157378_100473222 | 353 |
| 343 | 3300013297 | Ga0157378_10113521 | Ga0157378_101135214 | 353 |
| 344 | 3300013306 | Ga0163162_10198498 | Ga0163162_101984982 | 353 |
| 345 | 3300013308 | Ga0157375_10126126 | Ga0157375_101261262 | 353 |
| 346 | 3300013308 | Ga0157375_10349952 | Ga0157375_103499521 | 353 |
| 347 | 3300014325 | Ga0163163_10002115 | Ga0163163_100021157 | 353 |
| 348 | 3300014325 | Ga0163163_10345885 | Ga0163163_103458852 | 353 |
| 349 | 3300014326 | Ga0157380_10093664 | Ga0157380_100936643 | 353 |
| 350 | 3300014326 | Ga0157380_10198046 | Ga0157380_101980461 | 353 |
| 351 | 3300014326 | Ga0157380_10273328 | Ga0157380_102733282 | 353 |
| 352 | 3300014745 | Ga0157377_10135912 | Ga0157377_101359121 | 353 |
| 353 | 3300014968 | Ga0157379_10000271 | Ga0157379_100002711 | 353 |
| 354 | 3300014968 | Ga0157379_10123706 | Ga0157379_101237062 | 353 |
| 355 | 3300014969 | Ga0157376_10298615 | Ga0157376_102986151 | 353 |
| 356 | 3300025271 | Ga0207666_1004719 | Ga0207666_10047192 | 353 |
| 357 | 3300025893 | Ga0207682_10003567 | Ga0207682_100035674 | 353 |
| 358 | 3300025903 | Ga0207680_10064210 | Ga0207680_100642102 | 353 |
| 359 | 3300025907 | Ga0207645_10009698 | Ga0207645_100096982 | 353 |
| 360 | 3300025908 | Ga0207643_10007625 | Ga0207643_100076254 | 353 |
| 361 | 3300025908 | Ga0207643_10010434 | Ga0207643_100104343 | 353 |
| 362 | 3300025912 | Ga0207707_10008295 | Ga0207707_100082952 | 353 |
| 363 | 3300025923 | Ga0207681_10155868 | Ga0207681_101558682 | 353 |
| 364 | 3300025924 | Ga0207694_10115496 | Ga0207694_101154962 | 353 |
| 365 | 3300025924 | Ga0207694_10227255 | Ga0207694_102272552 | 353 |
| 366 | 3300025925 | Ga0207650_10069764 | Ga0207650_100697642 | 353 |
| 367 | 3300025926 | Ga0207659_10089485 | Ga0207659_100894853 | 353 |
| 368 | 3300025928 | Ga0207700_10000183 | Ga0207700_1000018317 | 353 |
| 369 | 3300025931 | Ga0207644_10029749 | Ga0207644_100297492 | 353 |
| 370 | 3300025931 | Ga0207644_10169447 | Ga0207644_101694472 | 353 |
| 371 | 3300025933 | Ga0207706_10014132 | Ga0207706_100141321 | 353 |
| 372 | 3300025933 | Ga0207706_10141215 | Ga0207706_101412152 | 353 |
| 373 | 3300025934 | Ga0207686_10134323 | Ga0207686_101343232 | 353 |
| 374 | 3300025935 | Ga0207709_10023739 | Ga0207709_100237393 | 353 |
| 375 | 3300025936 | Ga0207670_10074064 | Ga0207670_100740642 | 353 |
| 376 | 3300025936 | Ga0207670_10208982 | Ga0207670_102089821 | 353 |
| 377 | 3300025937 | Ga0207669_10112900 | Ga0207669_101129002 | 353 |
| 378 | 3300025938 | Ga0207704_10086822 | Ga0207704_100868222 | 353 |
| 379 | 3300025940 | Ga0207691_10052989 | Ga0207691_100529892 | 353 |
| 380 | 3300025940 | Ga0207691_10058790 | Ga0207691_100587903 | 353 |
| 381 | 3300025940 | Ga0207691_10087427 | Ga0207691_100874275 | 353 |
| 382 | 3300025940 | Ga0207691_10225028 | Ga0207691_102250281 | 353 |
| 383 | 3300025941 | Ga0207711_10143421 | Ga0207711_101434212 | 353 |
| 384 | 3300025942 | Ga0207689_10000028 | Ga0207689_1000002825 | 353 |
| 385 | 3300025942 | Ga0207689_10104579 | Ga0207689_101045792 | 353 |
| 386 | 3300025945 | Ga0207679_10178582 | Ga0207679_101785823 | 353 |
| 387 | 3300025945 | Ga0207679_10221061 | Ga0207679_102210611 | 353 |
| 388 | 3300025949 | Ga0207667_10460832 | Ga0207667_104608321 | 353 |
| 389 | 3300025960 | Ga0207651_10352229 | Ga0207651_103522291 | 353 |
| 390 | 3300025972 | Ga0207668_10034187 | Ga0207668_100341872 | 353 |
| 391 | 3300025986 | Ga0207658_10108881 | Ga0207658_101088812 | 353 |
| 392 | 3300026023 | Ga0207677_10027767 | Ga0207677_100277674 | 353 |
| 393 | 3300026035 | Ga0207703_10002194 | Ga0207703_1000219416 | 353 |
| 394 | 3300026035 | Ga0207703_10009843 | Ga0207703_100098434 | 353 |
| 395 | 3300026075 | Ga0207708_10283093 | Ga0207708_102830931 | 353 |
| 396 | 3300026088 | Ga0207641_10074726 | Ga0207641_100747261 | 353 |
| 397 | 3300026088 | Ga0207641_10154440 | Ga0207641_101544402 | 353 |
| 398 | 3300026089 | Ga0207648_10001620 | Ga0207648_1000162014 | 353 |
| 399 | 3300026089 | Ga0207648_10024004 | Ga0207648_100240042 | 353 |
| 400 | 3300026089 | Ga0207648_10116949 | Ga0207648_101169492 | 353 |
| 401 | 3300026095 | Ga0207676_10005681 | Ga0207676_100056818 | 353 |
| 402 | 3300026095 | Ga0207676_10006221 | Ga0207676_100062212 | 353 |
| 403 | 3300026095 | Ga0207676_10062858 | Ga0207676_100628582 | 353 |
| 404 | 3300026095 | Ga0207676_10173982 | Ga0207676_101739822 | 353 |
| 405 | 3300026116 | Ga0207674_10105321 | Ga0207674_101053212 | 353 |
| 406 | 3300026118 | Ga0207675_100001456 | Ga0207675_1000014568 | 353 |
| 407 | 3300026121 | Ga0207683_10007883 | Ga0207683_1000788311 | 353 |
| 408 | 3300026142 | Ga0207698_10012587 | Ga0207698_100125872 | 353 |
| 409 | 3300027876 | Ga0209974_10013906 | Ga0209974_100139062 | 353 |
| 410 | 3300028381 | Ga0268264_10001919 | Ga0268264_1000191917 | 353 |
| 411 | 3300028577 | Ga0265318_10002144 | Ga0265318_100021441 | 353 |
| 412 | 3300030521 | Ga0307511_10000065 | Ga0307511_1000006549 | 353 |
| 413 | 3300031238 | Ga0265332_10015971 | Ga0265332_100159713 | 353 |
| 414 | 3300031250 | Ga0265331_10009792 | Ga0265331_100097926 | 353 |
| 415 | 3300031344 | Ga0265316_10019983 | Ga0265316_100199835 | 353 |
| 416 | 3300031665 | Ga0316575_10012610 | Ga0316575_100126104 | 353 |
| 417 | 3300031711 | Ga0265314_10012115 | Ga0265314_100121152 | 353 |
| 418 | 3300031728 | Ga0316578_10016899 | Ga0316578_100168992 | 353 |
| 419 | 3300035111 | Ga0373923_0065631 | Ga0373923_0065631_103_1176 | 353 |
| 420 | 3300035113 | Ga0373936_0073665 | Ga0373936_0073665_193_1266 | 353 |
| 421 | 3300035118 | Ga0373954_0009416 | Ga0373954_0009416_192_1262 | 353 |
| 422 | 3300035118 | Ga0373954_0012647 | Ga0373954_0012647_889_1962 | 353 |
| 423 | 3300035119 | Ga0373956_0000018 | Ga0373956_0000018_22935_24005 | 353 |
| 424 | 3300035120 | Ga0373957_0069024 | Ga0373957_0069024_61_1134 | 353 |
| 425 | 3300035172 | Ga0373955_0001648 | Ga0373955_0001648_131_1204 | 353 |
| 426 | 3300035398 | Ga0316574_0037874 | Ga0316574_0037874_1560_2627 | 353 |
| 427 | 3300035692 | Ga0373935_0098001 | Ga0373935_0098001_822_1895 | 353 |
| 428 | 3300035724 | Ga0373933_0000035 | Ga0373933_0000035_24780_25850 | 353 |
| 429 | 3300035724 | Ga0373933_0000832 | Ga0373933_0000832_10874_11947 | 353 |
| 430 | 3300035725 | Ga0373947_0191392 | Ga0373947_0191392_67_1140 | 353 |
| 431 | 3300036401 | Ga0373937_0001048 | Ga0373937_0001048_14954_16027 | 353 |
| 432 | 3300036401 | Ga0373937_0002135 | Ga0373937_0002135_12912_13982 | 353 |
| 433 | 3300036647 | Ga0316582_0152006 | Ga0316582_0152006_302_1369 | 353 |
| 434 | 3300037853 | Ga0436364_0576120 | Ga0436364_0576120_23809_24885 | 353 |
| 435 | 3300039062 | Ga0400483_146919 | Ga0400483_146919_708_1778 | 353 |
| 436 | 3300039437 | Ga0436365_0017926 | Ga0436365_0017926_563_1633 | 353 |
| 437 | 3300042461 | Ga0439460_0061955 | Ga0439460_0061955_58_1125 | 353 |
| 438 | 3300045051 | Ga0451576_0095780 | Ga0451576_0095780_588_1658 | 353 |
| 439 | 3300046454 | Ga0495592_0001428 | Ga0495592_0001428_1309_2382 | 353 |
| 440 | 3300046459 | Ga0495629_0003053 | Ga0495629_0003053_385_1458 | 353 |
| 441 | 3300046459 | Ga0495629_0165636 | Ga0495629_0165636_355_1425 | 353 |
| 442 | 3300046462 | Ga0495651_0000350 | Ga0495651_0000350_24060_25130 | 353 |
| 443 | 3300046462 | Ga0495651_0000476 | Ga0495651_0000476_1575_2648 | 353 |
| 444 | 3300046463 | Ga0495653_0000900 | Ga0495653_0000900_7976_9049 | 353 |
| 445 | 3300046511 | Ga0495608_0005364 | Ga0495608_0005364_1047_2120 | 353 |
| 446 | 3300046529 | Ga0495652_0002547 | Ga0495652_0002547_12043_13116 | 353 |
| 447 | 3300046533 | Ga0495640_0003500 | Ga0495640_0003500_11210_12283 | 353 |
| 448 | 3300046536 | Ga0495587_0016992 | Ga0495587_0016992_2484_3557 | 353 |
| 449 | 3300046559 | Ga0495667_0000641 | Ga0495667_0000641_19248_20321 | 353 |
| 450 | 3300046663 | Ga0495635_0053722 | Ga0495635_0053722_46_1119 | 353 |
| 451 | 3300046678 | Ga0495599_0061940 | Ga0495599_0061940_208_1281 | 353 |
| 452 | 3300046678 | Ga0495599_0071417 | Ga0495599_0071417_829_1899 | 353 |
| 453 | 3300046679 | Ga0495623_0011647 | Ga0495623_0011647_1433_2506 | 353 |
| 454 | 3300046680 | Ga0495646_0078021 | Ga0495646_0078021_201_1274 | 353 |
| 455 | 3300046683 | Ga0495658_0020147 | Ga0495658_0020147_763_1833 | 353 |
| 456 | 3300046683 | Ga0495658_0189520 | Ga0495658_0189520_180_1250 | 353 |
| 457 | 3300046690 | Ga0495624_0011667 | Ga0495624_0011667_3853_4926 | 353 |
| 458 | 3300046809 | Ga0495600_0047265 | Ga0495600_0047265_1678_2751 | 353 |
| 459 | 3300047319 | Ga0495674_0005934 | Ga0495674_0005934_5631_6704 | 353 |
| 460 | 3300047322 | Ga0495680_0000363 | Ga0495680_0000363_33322_34395 | 353 |
| 461 | 3300047673 | Ga0495593_0011918 | Ga0495593_0011918_2040_3113 | 353 |
| 462 | 3300048905 | Ga0496102_0317651 | Ga0496102_0317651_178_1248 | 353 |
| 463 | 3300048911 | Ga0496108_0419873 | Ga0496108_0419873_43_1113 | 353 |
| 464 | 3300048912 | Ga0496109_0257933 | Ga0496109_0257933_247_1317 | 353 |
| 465 | 3300048918 | Ga0496115_0065497 | Ga0496115_0065497_1782_2852 | 353 |
| 466 | 3300049569 | Ga0501032_0098516 | Ga0501032_0098516_494_1585 | 353 |
| 467 | 3300049570 | Ga0501033_0097677 | Ga0501033_0097677_81_1172 | 353 |
| 468 | 3300049571 | Ga0501034_0159847 | Ga0501034_0159847_169_1239 | 353 |
| 469 | 3300049577 | Ga0501041_0040199 | Ga0501041_0040199_1447_2613 | 353 |
| 470 | 3300049579 | Ga0501043_0061705 | Ga0501043_0061705_1613_2704 | 353 |
| 471 | 3300049580 | Ga0501046_0066745 | Ga0501046_0066745_1018_2109 | 353 |
| 472 | 3300049581 | Ga0501047_0005005 | Ga0501047_0005005_7076_8167 | 353 |
| 473 | 3300049582 | Ga0501048_0042882 | Ga0501048_0042882_966_2132 | 353 |
| 474 | 3300049586 | Ga0501070_0080799 | Ga0501070_0080799_726_1805 | 353 |
| 475 | 3300049586 | Ga0501070_0275788 | Ga0501070_0275788_110_1189 | 353 |
| 476 | 3300049588 | Ga0501072_0114894 | Ga0501072_0114894_973_2043 | 353 |
| 477 | 3300049591 | Ga0501075_0034527 | Ga0501075_0034527_301_1467 | 353 |
| 478 | 3300049592 | Ga0501076_0003456 | Ga0501076_0003456_94_1260 | 353 |
| 479 | 3300049593 | Ga0501077_0028017 | Ga0501077_0028017_1038_2204 | 353 |
| 480 | 3300049822 | Ga0501035_0168905 | Ga0501035_0168905_136_1227 | 353 |
| 481 | 3300049823 | Ga0501044_0142942 | Ga0501044_0142942_934_2025 | 353 |
| 482 | 3300049823 | Ga0501044_0320945 | Ga0501044_0320945_74_1144 | 353 |
| 483 | 3300049824 | Ga0501045_0013107 | Ga0501045_0013107_89_1159 | 353 |
| 484 | 3300050491 | nmdc:mga00v17_145073_c1 | nmdc:mga00v17_145073_c1_437_1510 | 353 |
| 485 | 3300050507 | nmdc:mga05p37_303718_c1 | nmdc:mga05p37_303718_c1_349_1419 | 353 |
| 486 | 3300050508 | nmdc:mga09592_9460_c1 | nmdc:mga09592_9460_c1_2142_3212 | 353 |
| 487 | 3300050510 | nmdc:mga06r32_109074_c1 | nmdc:mga06r32_109074_c1_1175_2248 | 353 |
| 488 | 3300050511 | nmdc:mga08y16_21112_c1 | nmdc:mga08y16_21112_c1_2355_3425 | 353 |
| 489 | 3300050511 | nmdc:mga08y16_501678_c1 | nmdc:mga08y16_501678_c1_117_1187 | 353 |
| 490 | 3300050513 | nmdc:mga0rr50_152820_c1 | nmdc:mga0rr50_152820_c1_260_1330 | 353 |
| 491 | 3300053077 | Ga0495601_0006586 | Ga0495601_0006586_567_1640 | 353 |
| 492 | 3300053078 | Ga0495612_0065550 | Ga0495612_0065550_360_1433 | 353 |
| 493 | 3300053084 | Ga0495595_0000296 | Ga0495595_0000296_4134_5207 | 353 |
| 494 | 3300053085 | Ga0495619_0003061 | Ga0495619_0003061_9664_10737 | 353 |
| 495 | 3300053085 | Ga0495619_0006623 | Ga0495619_0006623_4585_5655 | 353 |
| 496 | 3300053090 | Ga0500646_0000771 | Ga0500646_0000771_5904_6980 | 353 |
| 497 | 3300053151 | Ga0500604_0000329 | Ga0500604_0000329_976_2052 | 353 |
| 498 | 3300060353 | Ga0501082_0155250 | Ga0501082_0155250_454_1620 | 353 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zix-assembly2.cif.gz_B | crystal structure of ketopantoate reductase from pseudomonas aeruginosa bound to nadp+ | 0.7707 | 4 | 349 |
| 5ayv-assembly1.cif.gz_A | crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate | 0.7683 | 1 | 350 |
| 5ayv-assembly1.cif.gz_A | crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate | 0.7637 | 1 | 350 |
| 3i83-assembly1.cif.gz_A | crystal structure of 2-dehydropantoate 2-reductase from methylococcus capsulatus | 0.7624 | 4 | 353 |
| 5hws-assembly1.cif.gz_D | crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ | 0.7561 | 1 | 347 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5zikA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.7891 | 225 | 346 | 1.10.1040.10 |
| 5zikA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.7778 | 225 | 346 | 1.10.1040.10 |
| 5hwsD02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.7601 | 232 | 346 | 1.10.1040.10 |
| 3egoB02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.7575 | 227 | 345 | 1.10.1040.10 |
| 3ghyB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7401 | 1 | 221 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537CP80-F1-model_v4 | Uncharacterized protein | 0.9945 | 242 | 352 |
|
| AF-A0A381Q2U3-F1-model_v4 | Uncharacterized protein | 0.9944 | 23 | 353 |
|
| AF-A0A537NZE7-F1-model_v4 | Uncharacterized protein | 0.9916 | 241 | 352 |
|
| AF-A0A536ZVG5-F1-model_v4 | Uncharacterized protein | 0.9915 | 240 | 352 |
|
| AF-A0A381Q2U3-F1-model_v4 | Uncharacterized protein | 0.9884 | 23 | 353 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar