F455276

General Info

Members Datasets Scaffolds Average Seq Length
498 300 498 350

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0040199|Ga0501041_0040199_1447_2613
Length 388
Sequence LNSESISRIAKSRGCVHPAAAGIEDKQRRRRLMATTYKILILGASYGSLLATKLLFAGHTLKLVCLPAEAELINKEGARVRLPVKGREGLVEIDTRKLPGKLSADGPGAVNPADYDLIALAMMEPQYRSAGVRELMDAIARAKVPCMSIMNMPPLTYLKRIRGLNTDACRGAYTDPSVWDGFDPRLMTLCSPDPQAFRPPDEKVNVLQVRLATNFKAARFESEAHTAILRRLEADIEAVRFDTGSGKIELPVKLKVHDSIFVPLAKWPMLIAGNYRCVQKDGMRSIKDAVHSNLEASRSVYDWVVKLCVSLGAAEKDLVPFEKYANAALSLGSPSSAARALFGGAPNIERVDRLVKAIAAQKGMRSDVVDETVALVDARLEANRKKAA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
297 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 1.41
Rhizosphere 95.38
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3467282 2162886012 Bacteria 1520
2 Ga0065707_10213590 3300005295 Bacteria 1255
3 Ga0070676_10024851 3300005328 Bacteria 3380
4 Ga0070683_100019858 3300005329 Bacteria 5973
5 Ga0070683_100230770 3300005329 Bacteria 1760
6 Ga0070690_100061882 3300005330 Bacteria 2412
7 Ga0070670_100027589 3300005331 Bacteria 4884
8 Ga0070670_100033992 3300005331 Bacteria 4389
9 Ga0070670_100050283 3300005331 Bacteria 3582
10 Ga0068869_100000160 3300005334 Bacteria 33574
11 Ga0068869_100145861 3300005334 Bacteria 1832
12 Ga0070666_10110978 3300005335 Bacteria 1896
13 Ga0070666_10216737 3300005335 Bacteria 1349
14 Ga0070680_100119054 3300005336 Bacteria 2203
15 Ga0068868_100014921 3300005338 Bacteria 5736
16 Ga0068868_100113707 3300005338 Bacteria 2201
17 Ga0070660_100016015 3300005339 Bacteria 5431
18 Ga0070689_100072365 3300005340 Bacteria 2694
19 Ga0070687_100004543 3300005343 Bacteria 5544
20 Ga0070661_100000620 3300005344 Bacteria 26406
21 Ga0070669_100011878 3300005353 Bacteria 6179
22 Ga0070669_100031053 3300005353 Bacteria 3857
23 Ga0070669_100083135 3300005353 Bacteria 2387
24 Ga0070675_100029112 3300005354 Bacteria 4451
25 Ga0070675_100060594 3300005354 Bacteria 3124
26 Ga0070675_100065732 3300005354 Bacteria 2999
27 Ga0070675_100115292 3300005354 Bacteria 2277
28 Ga0070675_100209625 3300005354 Bacteria 1693
29 Ga0070671_100044932 3300005355 Bacteria 3671
30 Ga0070673_100048813 3300005364 Bacteria 3302
31 Ga0070673_100060663 3300005364 Bacteria 2998
32 Ga0070688_100018714 3300005365 Bacteria 4002
33 Ga0070688_100161747 3300005365 Bacteria 1539
34 Ga0070659_100102397 3300005366 Bacteria 2305
35 Ga0070667_100015642 3300005367 Bacteria 6273
36 Ga0070667_100260164 3300005367 Bacteria 1553
37 Ga0070709_10012776 3300005434 Bacteria 4706
38 Ga0070714_100002858 3300005435 Bacteria 12764
39 Ga0070714_100066309 3300005435 Bacteria 3111
40 Ga0070713_100002510 3300005436 Bacteria 11999
41 Ga0070710_10022267 3300005437 Bacteria 3312
42 Ga0070701_10040097 3300005438 Bacteria 2379
43 Ga0070705_100104155 3300005440 Bacteria 1798
44 Ga0070700_100045274 3300005441 Bacteria 2714
45 Ga0070694_100041782 3300005444 Bacteria 3060
46 Ga0070708_100103017 3300005445 Bacteria 2616
47 Ga0070681_10025486 3300005458 Bacteria 5949
48 Ga0070681_10026284 3300005458 Bacteria 5851
49 Ga0068867_100006924 3300005459 Bacteria 8025
50 Ga0068867_100007220 3300005459 Bacteria 7856
51 Ga0070685_10084102 3300005466 Bacteria 1913
52 Ga0070706_100126961 3300005467 Bacteria 2379
53 Ga0070707_100154860 3300005468 Bacteria 2232
54 Ga0070698_100019996 3300005471 Bacteria 7019
55 Ga0070684_100009360 3300005535 Bacteria 7712
56 Ga0070684_100032420 3300005535 Bacteria 4453
57 Ga0070697_100121823 3300005536 Bacteria 2182
58 Ga0068853_100026587 3300005539 Bacteria 4860
59 Ga0070672_100021376 3300005543 Bacteria 4733
60 Ga0070672_100093417 3300005543 Bacteria 2430
61 Ga0070686_100038807 3300005544 Bacteria 2963
62 Ga0070695_100051247 3300005545 Bacteria 2648
63 Ga0070696_100000665 3300005546 Bacteria 22042
64 Ga0070696_100090148 3300005546 Bacteria 2181
65 Ga0070693_100013949 3300005547 Bacteria 4104
66 Ga0070665_100080002 3300005548 Bacteria 3273
67 Ga0070704_100002331 3300005549 Bacteria 10641
68 Ga0070704_100002392 3300005549 Bacteria 10532
69 Ga0070704_100005685 3300005549 Bacteria 7284
70 Ga0070704_100059794 3300005549 Bacteria 2720
71 Ga0070664_100037070 3300005564 Bacteria 4097
72 Ga0070664_100060500 3300005564 Bacteria 3225
73 Ga0070664_100083104 3300005564 Bacteria 2762
74 Ga0070664_100235648 3300005564 Bacteria 1642
75 Ga0068857_100003360 3300005577 Bacteria 13320
76 Ga0068857_100017599 3300005577 Bacteria 6266
77 Ga0068854_100001488 3300005578 Bacteria 14183
78 Ga0068854_100221530 3300005578 Bacteria 1497
79 Ga0068856_100019529 3300005614 Bacteria 6578
80 Ga0070702_100017930 3300005615 Bacteria 3662
81 Ga0070702_100056568 3300005615 Bacteria 2266
82 Ga0068859_100002394 3300005617 Bacteria 19095
83 Ga0068864_100000395 3300005618 Bacteria 37880
84 Ga0068864_100041019 3300005618 Bacteria 3959
85 Ga0068864_100104294 3300005618 Bacteria 2518
86 Ga0068864_100159062 3300005618 Bacteria 2052
87 Ga0068864_100351120 3300005618 Bacteria 1391
88 Ga0068866_10020734 3300005718 Bacteria 3017
89 Ga0068861_100003084 3300005719 Bacteria 11007
90 Ga0068861_100213841 3300005719 Bacteria 1625
91 Ga0068851_10055598 3300005834 Bacteria 2016
92 Ga0068870_10003450 3300005840 Bacteria 6698
93 Ga0068863_100005560 3300005841 Bacteria 12392
94 Ga0068863_100079538 3300005841 Bacteria 3104
95 Ga0068863_100083864 3300005841 Bacteria 3020
96 Ga0068863_100087535 3300005841 Bacteria 2951
97 Ga0068863_100100664 3300005841 Bacteria 2747
98 Ga0068858_100022939 3300005842 Bacteria 5821
99 Ga0068860_100015795 3300005843 Bacteria 7372
100 Ga0068860_100075949 3300005843 Bacteria 3195
101 Ga0068862_100096637 3300005844 Bacteria 2579
102 Ga0081455_10004832 3300005937 Bacteria 14960
103 Ga0081538_10001845 3300005981 Bacteria 21365
104 Ga0081538_10049794 3300005981 Bacteria 2538
105 Ga0075365_10162406 3300006038 Bacteria 1557
106 Ga0070715_10032185 3300006163 Bacteria 2134
107 Ga0075367_10134375 3300006178 Bacteria 1530
108 Ga0075369_10089691 3300006186 Bacteria 1371
109 Ga0075366_10025324 3300006195 Bacteria 3464
110 Ga0097621_100029643 3300006237 Bacteria 4324
111 Ga0097621_100083200 3300006237 Bacteria 2666
112 Ga0068871_100020011 3300006358 Bacteria 5120
113 Ga0068871_100049355 3300006358 Bacteria 3401
114 Ga0075428_100000638 3300006844 Bacteria 35958
115 Ga0075428_100049674 3300006844 Bacteria 4602
116 Ga0075428_100129532 3300006844 Bacteria 2745
117 Ga0075430_100021232 3300006846 Bacteria 5520
118 Ga0075430_100029137 3300006846 Bacteria 4686
119 Ga0075431_100000307 3300006847 Bacteria 38506
120 Ga0075431_100065250 3300006847 Bacteria 3759
121 Ga0075431_100093908 3300006847 Bacteria 3096
122 Ga0075431_100386998 3300006847 Bacteria 1402
123 Ga0075433_10062535 3300006852 Bacteria 3260
124 Ga0075433_10093495 3300006852 Bacteria 2660
125 Ga0075429_100011701 3300006880 Bacteria 7609
126 Ga0075429_100155755 3300006880 Bacteria 2001
127 Ga0068865_100001154 3300006881 Bacteria 15331
128 Ga0075436_100110908 3300006914 Bacteria 1915
129 Ga0097620_100002394 3300006931 Bacteria 19095
130 Ga0075435_100010857 3300007076 Bacteria 6670
131 Ga0075435_100129221 3300007076 Bacteria 2113
132 Ga0099794_10021420 3300007265 Bacteria 2937
133 Ga0099794_10077562 3300007265 Bacteria 1635
134 Ga0099795_10022112 3300007788 Bacteria 2095
135 Ga0105240_10000780 3300009093 Bacteria 57653
136 Ga0105240_10001181 3300009093 Bacteria 45705
137 Ga0111539_10004193 3300009094 Bacteria 18910
138 Ga0105245_10165719 3300009098 Bacteria 2100
139 Ga0114129_10186839 3300009147 Bacteria 2816
140 Ga0105243_10022371 3300009148 Bacteria 4804
141 Ga0105243_10100544 3300009148 Bacteria 2399
142 Ga0105243_10206130 3300009148 Bacteria 1728
143 Ga0105242_10001652 3300009176 Bacteria 17627
144 Ga0105242_10020100 3300009176 Bacteria 5233
145 Ga0105242_10020636 3300009176 Bacteria 5169
146 Ga0105242_10036038 3300009176 Bacteria 3967
147 Ga0105248_10002497 3300009177 Bacteria 20453
148 Ga0105248_10030740 3300009177 Bacteria 5999
149 Ga0105248_10047007 3300009177 Bacteria 4839
150 Ga0105248_10176321 3300009177 Bacteria 2409
151 Ga0105237_10012555 3300009545 Bacteria 8924
152 Ga0105238_10039131 3300009551 Bacteria 4810
153 Ga0105249_10155903 3300009553 Bacteria 2202
154 Ga0105249_10255269 3300009553 Bacteria 1740
155 Ga0105249_10521545 3300009553 Bacteria 1236
156 Ga0099796_10019895 3300010159 Bacteria 2042
157 Ga0105239_10032279 3300010375 Bacteria 5755
158 Ga0105246_10142919 3300011119 Bacteria 1802
159 Ga0157373_10031559 3300013100 Bacteria 3814
160 Ga0157373_10065965 3300013100 Bacteria 2561
161 Ga0157370_10014726 3300013104 Bacteria 7986
162 Ga0157369_10140409 3300013105 Bacteria 2557
163 Ga0157374_10084500 3300013296 Bacteria 3017
164 Ga0157378_10029647 3300013297 Bacteria 4832
165 Ga0157378_10047322 3300013297 Bacteria 3824
166 Ga0157378_10113521 3300013297 Bacteria 2487
167 Ga0163162_10198498 3300013306 Bacteria 2135
168 Ga0157372_10000854 3300013307 Bacteria 33050
169 Ga0157372_10409253 3300013307 Bacteria 1581
170 Ga0157375_10126126 3300013308 Bacteria 2675
171 Ga0157375_10349952 3300013308 Bacteria 1643
172 Ga0163163_10002115 3300014325 Bacteria 16762
173 Ga0163163_10345885 3300014325 Bacteria 1543
174 Ga0163163_10549662 3300014325 Bacteria 1217
175 Ga0157380_10093664 3300014326 Bacteria 2484
176 Ga0157380_10103126 3300014326 Bacteria 2380
177 Ga0157380_10198046 3300014326 Bacteria 1780
178 Ga0157380_10273328 3300014326 Bacteria 1542
179 Ga0157377_10135912 3300014745 Bacteria 1506
180 Ga0157379_10000271 3300014968 Bacteria 40851
181 Ga0157379_10123706 3300014968 Bacteria 2327
182 Ga0157379_10280751 3300014968 Bacteria 1515
183 Ga0157376_10298615 3300014969 Bacteria 1524
184 Ga0206356_11215269 3300020070 Bacteria 1263
185 Ga0213875_10000040 3300021388 Bacteria 156362
186 Ga0213875_10005885 3300021388 Bacteria 6516
187 Ga0213871_10040563 3300021441 Bacteria 1249
188 Ga0207666_1004719 3300025271 Bacteria 1719
189 Ga0207682_10003567 3300025893 Bacteria 6731
190 Ga0207692_10047048 3300025898 Bacteria 2165
191 Ga0207680_10064210 3300025903 Bacteria 2250
192 Ga0207685_10019450 3300025905 Bacteria 2239
193 Ga0207699_10009723 3300025906 Bacteria 4800
194 Ga0207645_10009698 3300025907 Bacteria 6651
195 Ga0207645_10166156 3300025907 Bacteria 1445
196 Ga0207643_10007625 3300025908 Bacteria 5816
197 Ga0207643_10010434 3300025908 Bacteria 5004
198 Ga0207707_10008295 3300025912 Bacteria 9015
199 Ga0207707_10077546 3300025912 Bacteria 2901
200 Ga0207695_10008281 3300025913 Bacteria 13042
201 Ga0207671_10027627 3300025914 Bacteria 4242
202 Ga0207660_10104852 3300025917 Bacteria 2117
203 Ga0207657_10002918 3300025919 Bacteria 18354
204 Ga0207649_10013764 3300025920 Bacteria 4522
205 Ga0207681_10155868 3300025923 Bacteria 1716
206 Ga0207694_10115496 3300025924 Bacteria 2138
207 Ga0207694_10227255 3300025924 Bacteria 1523
208 Ga0207650_10069764 3300025925 Bacteria 2641
209 Ga0207659_10087782 3300025926 Bacteria 2316
210 Ga0207659_10089485 3300025926 Bacteria 2296
211 Ga0207687_10045993 3300025927 Bacteria 3019
212 Ga0207700_10000183 3300025928 Bacteria 37732
213 Ga0207700_10091169 3300025928 Bacteria 2407
214 Ga0207664_10003432 3300025929 Bacteria 10565
215 Ga0207664_10031758 3300025929 Bacteria 4042
216 Ga0207644_10029749 3300025931 Bacteria 3791
217 Ga0207644_10169447 3300025931 Bacteria 1703
218 Ga0207706_10014132 3300025933 Bacteria 7238
219 Ga0207706_10117659 3300025933 Bacteria 2337
220 Ga0207706_10141215 3300025933 Bacteria 2119
221 Ga0207686_10018281 3300025934 Bacteria 3967
222 Ga0207686_10134323 3300025934 Bacteria 1701
223 Ga0207709_10023739 3300025935 Bacteria 3493
224 Ga0207670_10074064 3300025936 Bacteria 2363
225 Ga0207670_10208982 3300025936 Bacteria 1487
226 Ga0207669_10112900 3300025937 Bacteria 1826
227 Ga0207704_10002332 3300025938 Bacteria 8528
228 Ga0207704_10086822 3300025938 Bacteria 2042
229 Ga0207665_10089010 3300025939 Bacteria 2137
230 Ga0207691_10052989 3300025940 Bacteria 3705
231 Ga0207691_10058790 3300025940 Bacteria 3496
232 Ga0207691_10087427 3300025940 Bacteria 2796
233 Ga0207691_10225028 3300025940 Bacteria 1626
234 Ga0207711_10143421 3300025941 Bacteria 2150
235 Ga0207711_10374443 3300025941 Bacteria 1321
236 Ga0207689_10000028 3300025942 Bacteria 100652
237 Ga0207689_10005226 3300025942 Bacteria 11645
238 Ga0207689_10104579 3300025942 Bacteria 2326
239 Ga0207661_10016498 3300025944 Bacteria 5450
240 Ga0207661_10073400 3300025944 Bacteria 2802
241 Ga0207661_10204886 3300025944 Bacteria 1736
242 Ga0207679_10021618 3300025945 Bacteria 4366
243 Ga0207679_10178582 3300025945 Bacteria 1754
244 Ga0207679_10221061 3300025945 Bacteria 1593
245 Ga0207667_10025128 3300025949 Bacteria 6526
246 Ga0207667_10460832 3300025949 Bacteria 1291
247 Ga0207651_10352229 3300025960 Bacteria 1240
248 Ga0207712_10093856 3300025961 Bacteria 2215
249 Ga0207668_10034187 3300025972 Bacteria 3374
250 Ga0207640_10004727 3300025981 Bacteria 7397
251 Ga0207658_10108881 3300025986 Bacteria 2186
252 Ga0207677_10027767 3300026023 Bacteria 3571
253 Ga0207703_10002194 3300026035 Bacteria 17130
254 Ga0207703_10009843 3300026035 Bacteria 7499
255 Ga0207703_10303139 3300026035 Bacteria 1458
256 Ga0207639_10057461 3300026041 Bacteria 2987
257 Ga0207708_10240464 3300026075 Bacteria 1456
258 Ga0207708_10283093 3300026075 Bacteria 1344
259 Ga0207702_10002279 3300026078 Bacteria 18408
260 Ga0207641_10074726 3300026088 Bacteria 2924
261 Ga0207641_10116983 3300026088 Bacteria 2373
262 Ga0207641_10154440 3300026088 Bacteria 2081
263 Ga0207648_10001620 3300026089 Bacteria 24687
264 Ga0207648_10024004 3300026089 Bacteria 5450
265 Ga0207648_10094046 3300026089 Bacteria 2621
266 Ga0207648_10116949 3300026089 Bacteria 2343
267 Ga0207676_10005681 3300026095 Bacteria 8826
268 Ga0207676_10006221 3300026095 Bacteria 8429
269 Ga0207676_10062858 3300026095 Bacteria 2946
270 Ga0207676_10173982 3300026095 Bacteria 1878
271 Ga0207676_10277507 3300026095 Bacteria 1520
272 Ga0207674_10000022 3300026116 Bacteria 161298
273 Ga0207674_10105321 3300026116 Bacteria 2799
274 Ga0207674_10235329 3300026116 Bacteria 1779
275 Ga0207675_100001456 3300026118 Bacteria 23727
276 Ga0207675_100007847 3300026118 Bacteria 10070
277 Ga0207683_10007883 3300026121 Bacteria 9109
278 Ga0207683_10014757 3300026121 Bacteria 6650
279 Ga0207698_10012587 3300026142 Bacteria 5543
280 Ga0207698_10199550 3300026142 Bacteria 1790
281 Ga0209967_1000767 3300027364 Bacteria 4109
282 Ga0209981_1000591 3300027378 Bacteria 4574
283 Ga0209996_1003604 3300027395 Bacteria 1953
284 Ga0210000_1000081 3300027462 Bacteria 13652
285 Ga0209995_1000402 3300027471 Bacteria 6745
286 Ga0209968_1000708 3300027526 Bacteria 5129
287 Ga0209999_1000253 3300027543 Bacteria 7734
288 Ga0209974_10010773 3300027876 Bacteria 3081
289 Ga0209974_10013906 3300027876 Bacteria 2681
290 Ga0268265_10299631 3300028380 Bacteria 1447
291 Ga0268264_10001919 3300028381 Bacteria 18762
292 Ga0268264_10053353 3300028381 Bacteria 3372
293 Ga0265318_10002144 3300028577 Bacteria 10723
294 Ga0265338_10117676 3300028800 Bacteria 2126
295 Ga0307511_10000065 3300030521 Bacteria 88859
296 Ga0265330_10002013 3300031235 Bacteria 11281
297 Ga0265332_10000199 3300031238 Bacteria 48650
298 Ga0265332_10015971 3300031238 Bacteria 3313
299 Ga0265325_10022307 3300031241 Bacteria 3470
300 Ga0265329_10000991 3300031242 Bacteria 14171
301 Ga0265339_10140691 3300031249 Bacteria 1228
302 Ga0265331_10001027 3300031250 Bacteria 21785
303 Ga0265331_10009792 3300031250 Bacteria 5345
304 Ga0265327_10003598 3300031251 Bacteria 14622
305 Ga0265316_10010249 3300031344 Bacteria 8554
306 Ga0265316_10019983 3300031344 Bacteria 5713
307 Ga0316575_10012610 3300031665 Bacteria 3147
308 Ga0265314_10012115 3300031711 Bacteria 7063
309 Ga0265342_10006173 3300031712 Bacteria 8962
310 Ga0316578_10016899 3300031728 Unclassified 3959
311 Ga0373926_0012145 3300035083 Bacteria 2909
312 Ga0373934_0018143 3300035086 Bacteria 2691
313 Ga0373923_0065631 3300035111 Bacteria 1550
314 Ga0373936_0008966 3300035113 Bacteria 3771
315 Ga0373936_0073665 3300035113 Bacteria 1412
316 Ga0373953_0006425 3300035117 Bacteria 3871
317 Ga0373954_0002637 3300035118 Bacteria 7547
318 Ga0373954_0006094 3300035118 Bacteria 5247
319 Ga0373954_0009416 3300035118 Bacteria 4296
320 Ga0373954_0012647 3300035118 Bacteria 3755
321 Ga0373956_0000018 3300035119 Bacteria 50671
322 Ga0373957_0007711 3300035120 Bacteria 3455
323 Ga0373957_0069024 3300035120 Bacteria 1380
324 Ga0373946_0012569 3300035171 Bacteria 3171
325 Ga0373955_0001648 3300035172 Bacteria 9553
326 Ga0373955_0002161 3300035172 Bacteria 8506
327 Ga0373955_0007644 3300035172 Bacteria 4980
328 Ga0316574_0037874 3300035398 Bacteria 2959
329 Ga0373924_0001847 3300035410 Bacteria 7006
330 Ga0373935_0098001 3300035692 Bacteria 1929
331 Ga0373933_0000035 3300035724 Bacteria 82702
332 Ga0373933_0000832 3300035724 Bacteria 18866
333 Ga0373947_0191392 3300035725 Bacteria 1335
334 Ga0373937_0001048 3300036401 Bacteria 23373
335 Ga0373937_0002135 3300036401 Bacteria 16540
336 Ga0373937_0024477 3300036401 Bacteria 5446
337 Ga0373937_0377429 3300036401 Bacteria 1344
338 Ga0316582_0152006 3300036647 Bacteria 1565
339 Ga0395905_0411355 3300037471 Bacteria 1248
340 Ga0436364_0374996 3300037853 Bacteria 6606
341 Ga0436364_0576120 3300037853 Bacteria 27783
342 Ga0436364_1209713 3300037853 Bacteria 1066
343 Ga0400483_146919 3300039062 Bacteria 2567
344 Ga0400483_211488 3300039062 Bacteria 1356
345 Ga0436365_0017926 3300039437 Bacteria 5872
346 Ga0436362_0682656 3300039453 Bacteria 1902
347 Ga0439464_0001416 3300042439 Bacteria 5637
348 Ga0439460_0061955 3300042461 Bacteria 1143
349 Ga0451576_0095780 3300045051 Bacteria 3087
350 Ga0495592_0001428 3300046454 Bacteria 16575
351 Ga0495629_0003053 3300046459 Bacteria 12729
352 Ga0495629_0165636 3300046459 Bacteria 1535
353 Ga0495641_0034875 3300046461 Bacteria 2375
354 Ga0495651_0000350 3300046462 Bacteria 35585
355 Ga0495651_0000476 3300046462 Bacteria 30843
356 Ga0495651_0006469 3300046462 Bacteria 8958
357 Ga0495653_0000900 3300046463 Bacteria 23000
358 Ga0495653_0007068 3300046463 Bacteria 9210
359 Ga0495580_0229960 3300046472 Bacteria 1273
360 Ga0495582_0017891 3300046473 Bacteria 3874
361 Ga0495639_0003619 3300046475 Bacteria 6661
362 Ga0495662_0015857 3300046476 Bacteria 3657
363 Ga0495664_0000685 3300046477 Bacteria 17239
364 Ga0495608_0005364 3300046511 Bacteria 9158
365 Ga0495608_0006821 3300046511 Bacteria 8096
366 Ga0495618_0101518 3300046514 Bacteria 1841
367 Ga0495620_0057021 3300046515 Bacteria 1641
368 Ga0495628_0001118 3300046516 Bacteria 24530
369 Ga0495628_0013837 3300046516 Bacteria 6779
370 Ga0495628_0013977 3300046516 Bacteria 6739
371 Ga0495652_0000469 3300046529 Bacteria 47242
372 Ga0495652_0002547 3300046529 Bacteria 18683
373 Ga0495640_0003500 3300046533 Bacteria 12633
374 Ga0495586_0001410 3300046535 Bacteria 13299
375 Ga0495587_0016992 3300046536 Bacteria 4523
376 Ga0495645_0000044 3300046543 Bacteria 90950
377 Ga0495667_0000641 3300046559 Bacteria 22253
378 Ga0495667_0053997 3300046559 Bacteria 2645
379 Ga0495667_0110917 3300046559 Bacteria 1772
380 Ga0495634_0006920 3300046642 Bacteria 8571
381 Ga0495635_0002907 3300046663 Bacteria 11768
382 Ga0495635_0053722 3300046663 Bacteria 2775
383 Ga0495657_0014595 3300046675 Bacteria 5764
384 Ga0495599_0000684 3300046678 Bacteria 19253
385 Ga0495599_0001448 3300046678 Bacteria 13611
386 Ga0495599_0061940 3300046678 Bacteria 2337
387 Ga0495599_0071417 3300046678 Bacteria 2167
388 Ga0495623_0011647 3300046679 Bacteria 5697
389 Ga0495646_0078021 3300046680 Bacteria 1936
390 Ga0495658_0003277 3300046683 Bacteria 8044
391 Ga0495658_0020147 3300046683 Bacteria 3495
392 Ga0495658_0189520 3300046683 Bacteria 1278
393 Ga0495669_0082810 3300046684 Bacteria 1474
394 Ga0495613_0028133 3300046689 Bacteria 4182
395 Ga0495613_0042051 3300046689 Bacteria 3382
396 Ga0495624_0011667 3300046690 Bacteria 6035
397 Ga0495600_0011543 3300046809 Bacteria 5508
398 Ga0495600_0047265 3300046809 Bacteria 2807
399 Ga0495674_0005934 3300047319 Bacteria 11722
400 Ga0495674_0008528 3300047319 Bacteria 9755
401 Ga0495672_0057821 3300047320 Bacteria 2251
402 Ga0495680_0000363 3300047322 Bacteria 50862
403 Ga0495675_0006056 3300047444 Bacteria 7403
404 Ga0495684_0066523 3300047471 Bacteria 2740
405 Ga0495684_0073224 3300047471 Bacteria 2602
406 Ga0495593_0011918 3300047673 Bacteria 4986
407 Ga0496102_0317651 3300048905 Bacteria 1467
408 Ga0496104_0217789 3300048907 Bacteria 1821
409 Ga0496108_0419873 3300048911 Bacteria 1168
410 Ga0496109_0257933 3300048912 Bacteria 1642
411 Ga0496111_0125358 3300048914 Bacteria 1898
412 Ga0496112_0210440 3300048915 Bacteria 1902
413 Ga0496115_0065497 3300048918 Bacteria 2935
414 Ga0501031_0252125 3300049568 Bacteria 1147
415 Ga0501032_0098516 3300049569 Unclassified 1937
416 Ga0501033_0097677 3300049570 Unclassified 2145
417 Ga0501034_0064295 3300049571 Bacteria 3683
418 Ga0501034_0159847 3300049571 Unclassified 2225
419 Ga0501036_0105458 3300049572 Bacteria 2384
420 Ga0501036_0206462 3300049572 Bacteria 1651
421 Ga0501039_0119358 3300049575 Bacteria 2066
422 Ga0501040_0013684 3300049576 Bacteria 5336
423 Ga0501041_0005857 3300049577 Bacteria 7186
424 Ga0501041_0040199 3300049577 Bacteria 2838
425 Ga0501042_0002819 3300049578 Bacteria 10768
426 Ga0501043_0061705 3300049579 Unclassified 2943
427 Ga0501046_0066745 3300049580 Unclassified 2803
428 Ga0501046_0071356 3300049580 Bacteria 2699
429 Ga0501046_0183786 3300049580 Bacteria 1562
430 Ga0501047_0005005 3300049581 Bacteria 12437
431 Ga0501048_0042882 3300049582 Bacteria 3239
432 Ga0501048_0091849 3300049582 Bacteria 2141
433 Ga0501048_0154482 3300049582 Bacteria 1623
434 Ga0501068_0017092 3300049584 Bacteria 4192
435 Ga0501069_0131941 3300049585 Bacteria 1431
436 Ga0501070_0080799 3300049586 Bacteria 2689
437 Ga0501070_0275788 3300049586 Bacteria 1372
438 Ga0501071_0020981 3300049587 Bacteria 4547
439 Ga0501071_0046908 3300049587 Bacteria 3103
440 Ga0501071_0193166 3300049587 Bacteria 1527
441 Ga0501072_0002669 3300049588 Bacteria 13374
442 Ga0501072_0011738 3300049588 Bacteria 6694
443 Ga0501072_0109024 3300049588 Bacteria 2203
444 Ga0501072_0114894 3300049588 Bacteria 2143
445 Ga0501072_0255964 3300049588 Bacteria 1394
446 Ga0501075_0034527 3300049591 Bacteria 3766
447 Ga0501075_0065321 3300049591 Bacteria 2745
448 Ga0501075_0132970 3300049591 Bacteria 1895
449 Ga0501076_0003456 3300049592 Bacteria 11084
450 Ga0501076_0114587 3300049592 Bacteria 2181
451 Ga0501077_0028017 3300049593 Bacteria 3580
452 Ga0501077_0058600 3300049593 Bacteria 2445
453 Ga0501077_0059055 3300049593 Bacteria 2435
454 Ga0501079_0000323 3300049741 Bacteria 30084
455 Ga0501079_0071414 3300049741 Bacteria 2682
456 Ga0501079_0180111 3300049741 Bacteria 1649
457 Ga0501079_0310683 3300049741 Bacteria 1233
458 Ga0501080_0005501 3300049742 Bacteria 11306
459 Ga0501080_0115390 3300049742 Bacteria 2490
460 Ga0501081_0180129 3300049743 Bacteria 1528
461 Ga0501035_0168905 3300049822 Unclassified 1890
462 Ga0501035_0206842 3300049822 Bacteria 1681
463 Ga0501044_0142942 3300049823 Bacteria 2380
464 Ga0501044_0320945 3300049823 Bacteria 1473
465 Ga0501045_0005023 3300049824 Bacteria 9166
466 Ga0501045_0013107 3300049824 Bacteria 5848
467 Ga0501045_0234664 3300049824 Bacteria 1365
468 nmdc:mga00v17_145073_c1 3300050491 Bacteria 1523
469 nmdc:mga05p37_303718_c1 3300050507 Bacteria 1895
470 nmdc:mga09592_106255_c1 3300050508 Bacteria 2407
471 nmdc:mga09592_9460_c1 3300050508 Bacteria 7920
472 nmdc:mga0qj67_23645_c1 3300050509 Bacteria 4728
473 nmdc:mga0qj67_7198_c1 3300050509 Bacteria 8214
474 nmdc:mga06r32_109074_c1 3300050510 Bacteria 2722
475 nmdc:mga06r32_184958_c1 3300050510 Bacteria 2070
476 nmdc:mga06r32_44791_c1 3300050510 Bacteria 4215
477 nmdc:mga06r32_7623_c1 3300050510 Bacteria 9733
478 nmdc:mga08y16_185854_c1 3300050511 Bacteria 2157
479 nmdc:mga08y16_21112_c1 3300050511 Bacteria 6875
480 nmdc:mga08y16_501678_c1 3300050511 Bacteria 1233
481 nmdc:mga0n895_28770_c1 3300050512 Bacteria 5290
482 nmdc:mga0rr50_152820_c1 3300050513 Bacteria 1867
483 Ga0495601_0003774 3300053077 Bacteria 8721
484 Ga0495601_0006586 3300053077 Bacteria 6793
485 Ga0495601_0094160 3300053077 Bacteria 1930
486 Ga0495612_0065550 3300053078 Bacteria 1508
487 Ga0495595_0000296 3300053084 Bacteria 19337
488 Ga0495619_0003061 3300053085 Bacteria 10857
489 Ga0495619_0006623 3300053085 Bacteria 7330
490 Ga0495619_0012058 3300053085 Bacteria 5445
491 Ga0500646_0000771 3300053090 Bacteria 8997
492 Ga0500604_0000329 3300053151 Bacteria 13186
493 Ga0501084_0213223 3300054114 Bacteria 1629
494 Ga0501082_0035298 3300060353 Bacteria 4310
495 Ga0501082_0095879 3300060353 Bacteria 2564
496 Ga0501082_0155250 3300060353 Bacteria 1988
497 Ga0530510_0000769 3300061734 Bacteria 20843
498 Ga0530510_0006623 3300061734 Bacteria 8077

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006881 Ga0068865_100001154 Ga0068865_1000011542 269
2 3300025938 Ga0207704_10002332 Ga0207704_100023323 269
3 3300026095 Ga0207676_10277507 Ga0207676_102775072 288
4 3300005546 Ga0070696_100000665 Ga0070696_1000006659 302
5 3300009176 Ga0105242_10020100 Ga0105242_100201002 311
6 3300009176 Ga0105242_10020636 Ga0105242_100206363 311
7 3300009545 Ga0105237_10012555 Ga0105237_100125554 311
8 3300010375 Ga0105239_10032279 Ga0105239_100322793 311
9 3300013105 Ga0157369_10140409 Ga0157369_101404093 311
10 3300013296 Ga0157374_10084500 Ga0157374_100845003 311
11 3300013307 Ga0157372_10409253 Ga0157372_104092532 311
12 3300014325 Ga0163163_10549662 Ga0163163_105496621 311
13 3300014968 Ga0157379_10280751 Ga0157379_102807512 311
14 3300035117 Ga0373953_0006425 Ga0373953_0006425_2208_3257 311
15 3300035118 Ga0373954_0006094 Ga0373954_0006094_1667_2716 311
16 3300035120 Ga0373957_0007711 Ga0373957_0007711_1834_2883 311
17 3300035172 Ga0373955_0007644 Ga0373955_0007644_2539_3588 311
18 3300036401 Ga0373937_0024477 Ga0373937_0024477_1638_2687 311
19 3300046559 Ga0495667_0110917 Ga0495667_0110917_331_1380 311
20 3300046689 Ga0495613_0028133 Ga0495613_0028133_2519_3568 311
21 3300047471 Ga0495684_0066523 Ga0495684_0066523_870_1919 311
22 3300049578 Ga0501042_0002819 Ga0501042_0002819_9742_10740 313
23 3300009553 Ga0105249_10255269 Ga0105249_102552691 314
24 3300009177 Ga0105248_10176321 Ga0105248_101763212 317
25 3300005334 Ga0068869_100145861 Ga0068869_1001458612 318
26 3300005535 Ga0070684_100032420 Ga0070684_1000324203 318
27 3300005539 Ga0068853_100026587 Ga0068853_1000265873 318
28 3300005841 Ga0068863_100100664 Ga0068863_1001006643 318
29 3300005843 Ga0068860_100075949 Ga0068860_1000759492 318
30 3300025914 Ga0207671_10027627 Ga0207671_100276273 318
31 3300025927 Ga0207687_10045993 Ga0207687_100459933 318
32 3300025934 Ga0207686_10018281 Ga0207686_100182813 318
33 3300025941 Ga0207711_10374443 Ga0207711_103744431 318
34 3300025944 Ga0207661_10204886 Ga0207661_102048862 318
35 3300026035 Ga0207703_10303139 Ga0207703_103031391 318
36 3300026041 Ga0207639_10057461 Ga0207639_100574612 318
37 3300028381 Ga0268264_10053353 Ga0268264_100533532 318
38 3300025961 Ga0207712_10093856 Ga0207712_100938562 321
39 3300046472 Ga0495580_0229960 Ga0495580_0229960_198_1253 321
40 3300009093 Ga0105240_10000780 Ga0105240_100007805 322
41 3300006846 Ga0075430_100029137 Ga0075430_1000291372 323
42 3300006847 Ga0075431_100000307 Ga0075431_10000030732 323
43 3300006880 Ga0075429_100155755 Ga0075429_1001557552 323
44 3300050508 nmdc:mga09592_106255_c1 nmdc:mga09592_106255_c1_1313_2386 323
45 3300050509 nmdc:mga0qj67_23645_c1 nmdc:mga0qj67_23645_c1_3368_4441 323
46 3300050510 nmdc:mga06r32_7623_c1 nmdc:mga06r32_7623_c1_4060_5133 323
47 3300037853 Ga0436364_1209713 Ga0436364_1209713_29_1009 324
48 3300050511 nmdc:mga08y16_185854_c1 nmdc:mga08y16_185854_c1_1152_2132 325
49 3300020070 Ga0206356_11215269 Ga0206356_112152691 327
50 3300049585 Ga0501069_0131941 Ga0501069_0131941_57_1052 327
51 3300049575 Ga0501039_0119358 Ga0501039_0119358_924_1991 329
52 3300028800 Ga0265338_10117676 Ga0265338_101176763 330
53 3300049568 Ga0501031_0252125 Ga0501031_0252125_28_1089 332
54 3300049572 Ga0501036_0206462 Ga0501036_0206462_463_1524 332
55 3300049576 Ga0501040_0013684 Ga0501040_0013684_3045_4106 332
56 3300049577 Ga0501041_0005857 Ga0501041_0005857_5369_6430 332
57 3300049580 Ga0501046_0071356 Ga0501046_0071356_1003_2064 332
58 3300049582 Ga0501048_0091849 Ga0501048_0091849_301_1362 332
59 3300049587 Ga0501071_0046908 Ga0501071_0046908_110_1171 332
60 3300049588 Ga0501072_0002669 Ga0501072_0002669_1989_3050 332
61 3300049592 Ga0501076_0114587 Ga0501076_0114587_1090_2151 332
62 3300049741 Ga0501079_0000323 Ga0501079_0000323_2044_3105 332
63 3300049742 Ga0501080_0115390 Ga0501080_0115390_1111_2172 332
64 3300049824 Ga0501045_0005023 Ga0501045_0005023_348_1409 332
65 3300060353 Ga0501082_0035298 Ga0501082_0035298_906_1967 332
66 3300061734 Ga0530510_0000769 Ga0530510_0000769_19742_20803 332
67 3300021441 Ga0213871_10040563 Ga0213871_100405632 333
68 3300036401 Ga0373937_0377429 Ga0373937_0377429_23_1030 334
69 3300039062 Ga0400483_211488 Ga0400483_211488_68_1138 336
70 3300042439 Ga0439464_0001416 Ga0439464_0001416_2679_3746 337
71 3300005353 Ga0070669_100011878 Ga0070669_1000118787 341
72 3300005354 Ga0070675_100065732 Ga0070675_1000657321 341
73 3300005365 Ga0070688_100161747 Ga0070688_1001617471 341
74 3300005441 Ga0070700_100045274 Ga0070700_1000452742 341
75 3300005466 Ga0070685_10084102 Ga0070685_100841022 341
76 3300005618 Ga0068864_100351120 Ga0068864_1003511201 341
77 3300006237 Ga0097621_100083200 Ga0097621_1000832003 341
78 3300006358 Ga0068871_100020011 Ga0068871_1000200113 341
79 3300009148 Ga0105243_10100544 Ga0105243_101005442 341
80 3300013297 Ga0157378_10029647 Ga0157378_100296472 341
81 3300014326 Ga0157380_10103126 Ga0157380_101031262 341
82 3300025907 Ga0207645_10166156 Ga0207645_101661561 341
83 3300025942 Ga0207689_10005226 Ga0207689_100052265 341
84 3300026075 Ga0207708_10240464 Ga0207708_102404642 341
85 3300026088 Ga0207641_10116983 Ga0207641_101169833 341
86 3300026118 Ga0207675_100007847 Ga0207675_1000078477 341
87 3300026121 Ga0207683_10014757 Ga0207683_100147575 341
88 3300028380 Ga0268265_10299631 Ga0268265_102996312 341
89 3300031235 Ga0265330_10002013 Ga0265330_100020135 341
90 3300031238 Ga0265332_10000199 Ga0265332_100001999 341
91 3300031241 Ga0265325_10022307 Ga0265325_100223073 341
92 3300031242 Ga0265329_10000991 Ga0265329_100009914 341
93 3300031249 Ga0265339_10140691 Ga0265339_101406911 341
94 3300031250 Ga0265331_10001027 Ga0265331_100010276 341
95 3300031251 Ga0265327_10003598 Ga0265327_100035986 341
96 3300031344 Ga0265316_10010249 Ga0265316_100102497 341
97 3300031712 Ga0265342_10006173 Ga0265342_100061739 341
98 3300005459 Ga0068867_100007220 Ga0068867_1000072202 342
99 3300007265 Ga0099794_10021420 Ga0099794_100214201 342
100 3300026089 Ga0207648_10094046 Ga0207648_100940462 342
101 3300035083 Ga0373926_0012145 Ga0373926_0012145_1718_2749 342
102 3300035113 Ga0373936_0008966 Ga0373936_0008966_2177_3208 342
103 3300035171 Ga0373946_0012569 Ga0373946_0012569_220_1251 342
104 3300035172 Ga0373955_0002161 Ga0373955_0002161_3247_4278 342
105 3300046461 Ga0495641_0034875 Ga0495641_0034875_1278_2309 342
106 3300046462 Ga0495651_0006469 Ga0495651_0006469_2452_3483 342
107 3300046463 Ga0495653_0007068 Ga0495653_0007068_2748_3779 342
108 3300046473 Ga0495582_0017891 Ga0495582_0017891_502_1533 342
109 3300046475 Ga0495639_0003619 Ga0495639_0003619_1044_2075 342
110 3300046476 Ga0495662_0015857 Ga0495662_0015857_1275_2306 342
111 3300046511 Ga0495608_0006821 Ga0495608_0006821_5637_6668 342
112 3300046516 Ga0495628_0013837 Ga0495628_0013837_4085_5116 342
113 3300046535 Ga0495586_0001410 Ga0495586_0001410_1269_2300 342
114 3300046642 Ga0495634_0006920 Ga0495634_0006920_1429_2460 342
115 3300046663 Ga0495635_0002907 Ga0495635_0002907_1248_2279 342
116 3300046683 Ga0495658_0003277 Ga0495658_0003277_1031_2062 342
117 3300046689 Ga0495613_0042051 Ga0495613_0042051_1780_2811 342
118 3300046809 Ga0495600_0011543 Ga0495600_0011543_345_1376 342
119 3300047319 Ga0495674_0008528 Ga0495674_0008528_1631_2662 342
120 3300047444 Ga0495675_0006056 Ga0495675_0006056_1153_2184 342
121 3300053077 Ga0495601_0003774 Ga0495601_0003774_5640_6671 342
122 3300053085 Ga0495619_0012058 Ga0495619_0012058_1269_2300 342
123 3300049593 Ga0501077_0059055 Ga0501077_0059055_916_2040 343
124 3300005329 Ga0070683_100019858 Ga0070683_1000198581 345
125 3300005339 Ga0070660_100016015 Ga0070660_1000160152 345
126 3300005344 Ga0070661_100000620 Ga0070661_10000062016 345
127 3300005435 Ga0070714_100002858 Ga0070714_1000028582 345
128 3300005458 Ga0070681_10026284 Ga0070681_100262842 345
129 3300005535 Ga0070684_100009360 Ga0070684_1000093602 345
130 3300005577 Ga0068857_100003360 Ga0068857_1000033602 345
131 3300005578 Ga0068854_100001488 Ga0068854_1000014883 345
132 3300005614 Ga0068856_100019529 Ga0068856_1000195294 345
133 3300009093 Ga0105240_10001181 Ga0105240_1000118120 345
134 3300009551 Ga0105238_10039131 Ga0105238_100391314 345
135 3300013100 Ga0157373_10031559 Ga0157373_100315592 345
136 3300013104 Ga0157370_10014726 Ga0157370_100147265 345
137 3300013307 Ga0157372_10000854 Ga0157372_100008542 345
138 3300025912 Ga0207707_10077546 Ga0207707_100775462 345
139 3300025913 Ga0207695_10008281 Ga0207695_100082812 345
140 3300025919 Ga0207657_10002918 Ga0207657_1000291812 345
141 3300025920 Ga0207649_10013764 Ga0207649_100137644 345
142 3300025929 Ga0207664_10003432 Ga0207664_100034322 345
143 3300025944 Ga0207661_10016498 Ga0207661_100164985 345
144 3300025949 Ga0207667_10025128 Ga0207667_100251282 345
145 3300025981 Ga0207640_10004727 Ga0207640_100047276 345
146 3300026078 Ga0207702_10002279 Ga0207702_100022798 345
147 3300026116 Ga0207674_10000022 Ga0207674_1000002283 345
148 3300037471 Ga0395905_0411355 Ga0395905_0411355_54_1160 345
149 3300046515 Ga0495620_0057021 Ga0495620_0057021_251_1294 346
150 3300046684 Ga0495669_0082810 Ga0495669_0082810_171_1214 346
151 3300027364 Ga0209967_1000767 Ga0209967_10007673 347
152 3300027378 Ga0209981_1000591 Ga0209981_10005915 347
153 3300027395 Ga0209996_1003604 Ga0209996_10036043 347
154 3300027462 Ga0210000_1000081 Ga0210000_10000815 347
155 3300027471 Ga0209995_1000402 Ga0209995_10004025 347
156 3300027543 Ga0209999_1000253 Ga0209999_10002532 347
157 3300049584 Ga0501068_0017092 Ga0501068_0017092_2286_3338 347
158 3300049587 Ga0501071_0020981 Ga0501071_0020981_2759_3811 347
159 3300049588 Ga0501072_0109024 Ga0501072_0109024_216_1268 347
160 3300049588 Ga0501072_0255964 Ga0501072_0255964_105_1223 347
161 3300049742 Ga0501080_0005501 Ga0501080_0005501_1594_2646 347
162 3300048907 Ga0496104_0217789 Ga0496104_0217789_720_1769 348
163 3300048915 Ga0496112_0210440 Ga0496112_0210440_722_1771 348
164 3300049588 Ga0501072_0011738 Ga0501072_0011738_3750_4805 348
165 3300049591 Ga0501075_0132970 Ga0501075_0132970_114_1169 348
166 3300049593 Ga0501077_0058600 Ga0501077_0058600_223_1278 348
167 3300049741 Ga0501079_0071414 Ga0501079_0071414_824_1879 348
168 3300049822 Ga0501035_0206842 Ga0501035_0206842_368_1423 348
169 3300060353 Ga0501082_0095879 Ga0501082_0095879_59_1114 348
170 3300061734 Ga0530510_0006623 Ga0530510_0006623_1485_2540 348
171 3300005440 Ga0070705_100104155 Ga0070705_1001041552 349
172 3300005615 Ga0070702_100056568 Ga0070702_1000565682 349
173 3300006844 Ga0075428_100049674 Ga0075428_1000496743 349
174 3300006847 Ga0075431_100065250 Ga0075431_1000652503 349
175 3300006852 Ga0075433_10093495 Ga0075433_100934952 349
176 3300025928 Ga0207700_10091169 Ga0207700_100911692 349
177 3300025939 Ga0207665_10089010 Ga0207665_100890102 349
178 3300027526 Ga0209968_1000708 Ga0209968_10007082 349
179 3300035086 Ga0373934_0018143 Ga0373934_0018143_1515_2573 349
180 3300035118 Ga0373954_0002637 Ga0373954_0002637_1958_3016 349
181 3300035410 Ga0373924_0001847 Ga0373924_0001847_3494_4552 349
182 3300046477 Ga0495664_0000685 Ga0495664_0000685_5668_6726 349
183 3300046514 Ga0495618_0101518 Ga0495618_0101518_589_1647 349
184 3300046516 Ga0495628_0001118 Ga0495628_0001118_21205_22263 349
185 3300046516 Ga0495628_0013977 Ga0495628_0013977_1498_2556 349
186 3300046529 Ga0495652_0000469 Ga0495652_0000469_17675_18733 349
187 3300046543 Ga0495645_0000044 Ga0495645_0000044_37908_38966 349
188 3300046559 Ga0495667_0053997 Ga0495667_0053997_1008_2066 349
189 3300046675 Ga0495657_0014595 Ga0495657_0014595_1396_2454 349
190 3300046678 Ga0495599_0000684 Ga0495599_0000684_15317_16375 349
191 3300046678 Ga0495599_0001448 Ga0495599_0001448_8665_9723 349
192 3300047471 Ga0495684_0073224 Ga0495684_0073224_1381_2439 349
193 3300049591 Ga0501075_0065321 Ga0501075_0065321_806_1963 349
194 3300049741 Ga0501079_0310683 Ga0501079_0310683_13_1128 349
195 3300050510 nmdc:mga06r32_44791_c1 nmdc:mga06r32_44791_c1_1354_2430 349
196 3300053077 Ga0495601_0094160 Ga0495601_0094160_580_1638 349
197 3300039453 Ga0436362_0682656 Ga0436362_0682656_364_1443 350
198 3300047320 Ga0495672_0057821 Ga0495672_0057821_1033_2097 350
199 3300005329 Ga0070683_100230770 Ga0070683_1002307702 351
200 3300005434 Ga0070709_10012776 Ga0070709_100127764 351
201 3300005435 Ga0070714_100066309 Ga0070714_1000663093 351
202 3300005437 Ga0070710_10022267 Ga0070710_100222673 351
203 3300006163 Ga0070715_10032185 Ga0070715_100321852 351
204 3300021388 Ga0213875_10000040 Ga0213875_1000004025 351
205 3300025898 Ga0207692_10047048 Ga0207692_100470481 351
206 3300025905 Ga0207685_10019450 Ga0207685_100194502 351
207 3300025906 Ga0207699_10009723 Ga0207699_100097232 351
208 3300025926 Ga0207659_10087782 Ga0207659_100877823 351
209 3300025929 Ga0207664_10031758 Ga0207664_100317582 351
210 3300025933 Ga0207706_10117659 Ga0207706_101176592 351
211 3300025944 Ga0207661_10073400 Ga0207661_100734002 351
212 3300026116 Ga0207674_10235329 Ga0207674_102353292 351
213 3300026142 Ga0207698_10199550 Ga0207698_101995502 351
214 3300048914 Ga0496111_0125358 Ga0496111_0125358_461_1525 351
215 3300005549 Ga0070704_100002392 Ga0070704_1000023922 352
216 3300005564 Ga0070664_100037070 Ga0070664_1000370704 352
217 3300006846 Ga0075430_100021232 Ga0075430_1000212325 352
218 3300006847 Ga0075431_100093908 Ga0075431_1000939082 352
219 3300006852 Ga0075433_10062535 Ga0075433_100625353 352
220 3300021388 Ga0213875_10005885 Ga0213875_100058851 352
221 3300025917 Ga0207660_10104852 Ga0207660_101048521 352
222 3300025945 Ga0207679_10021618 Ga0207679_100216183 352
223 3300027876 Ga0209974_10010773 Ga0209974_100107733 352
224 3300037853 Ga0436364_0374996 Ga0436364_0374996_215_1285 352
225 3300049571 Ga0501034_0064295 Ga0501034_0064295_368_1435 352
226 3300049572 Ga0501036_0105458 Ga0501036_0105458_1242_2312 352
227 3300049580 Ga0501046_0183786 Ga0501046_0183786_291_1361 352
228 3300049582 Ga0501048_0154482 Ga0501048_0154482_305_1375 352
229 3300049587 Ga0501071_0193166 Ga0501071_0193166_283_1353 352
230 3300049741 Ga0501079_0180111 Ga0501079_0180111_120_1190 352
231 3300049743 Ga0501081_0180129 Ga0501081_0180129_188_1258 352
232 3300049824 Ga0501045_0234664 Ga0501045_0234664_241_1311 352
233 3300050509 nmdc:mga0qj67_7198_c1 nmdc:mga0qj67_7198_c1_918_1985 352
234 3300050510 nmdc:mga06r32_184958_c1 nmdc:mga06r32_184958_c1_652_1719 352
235 3300050512 nmdc:mga0n895_28770_c1 nmdc:mga0n895_28770_c1_976_2109 352
236 3300054114 Ga0501084_0213223 Ga0501084_0213223_413_1483 352
237 2162886012 MBSR1b_contig_3467282 MBSR1b_0401.00007520 353
238 3300005295 Ga0065707_10213590 Ga0065707_102135901 353
239 3300005328 Ga0070676_10024851 Ga0070676_100248513 353
240 3300005330 Ga0070690_100061882 Ga0070690_1000618824 353
241 3300005331 Ga0070670_100027589 Ga0070670_1000275894 353
242 3300005331 Ga0070670_100033992 Ga0070670_1000339922 353
243 3300005331 Ga0070670_100050283 Ga0070670_1000502833 353
244 3300005334 Ga0068869_100000160 Ga0068869_1000001608 353
245 3300005335 Ga0070666_10110978 Ga0070666_101109782 353
246 3300005335 Ga0070666_10216737 Ga0070666_102167372 353
247 3300005336 Ga0070680_100119054 Ga0070680_1001190541 353
248 3300005338 Ga0068868_100014921 Ga0068868_1000149213 353
249 3300005338 Ga0068868_100113707 Ga0068868_1001137073 353
250 3300005340 Ga0070689_100072365 Ga0070689_1000723653 353
251 3300005343 Ga0070687_100004543 Ga0070687_1000045434 353
252 3300005353 Ga0070669_100031053 Ga0070669_1000310532 353
253 3300005353 Ga0070669_100083135 Ga0070669_1000831351 353
254 3300005354 Ga0070675_100029112 Ga0070675_1000291122 353
255 3300005354 Ga0070675_100060594 Ga0070675_1000605944 353
256 3300005354 Ga0070675_100115292 Ga0070675_1001152922 353
257 3300005354 Ga0070675_100209625 Ga0070675_1002096252 353
258 3300005355 Ga0070671_100044932 Ga0070671_1000449322 353
259 3300005364 Ga0070673_100048813 Ga0070673_1000488133 353
260 3300005364 Ga0070673_100060663 Ga0070673_1000606633 353
261 3300005365 Ga0070688_100018714 Ga0070688_1000187143 353
262 3300005366 Ga0070659_100102397 Ga0070659_1001023971 353
263 3300005367 Ga0070667_100015642 Ga0070667_1000156424 353
264 3300005367 Ga0070667_100260164 Ga0070667_1002601641 353
265 3300005436 Ga0070713_100002510 Ga0070713_1000025106 353
266 3300005438 Ga0070701_10040097 Ga0070701_100400973 353
267 3300005444 Ga0070694_100041782 Ga0070694_1000417822 353
268 3300005445 Ga0070708_100103017 Ga0070708_1001030172 353
269 3300005458 Ga0070681_10025486 Ga0070681_100254864 353
270 3300005459 Ga0068867_100006924 Ga0068867_1000069242 353
271 3300005467 Ga0070706_100126961 Ga0070706_1001269613 353
272 3300005468 Ga0070707_100154860 Ga0070707_1001548603 353
273 3300005471 Ga0070698_100019996 Ga0070698_1000199962 353
274 3300005536 Ga0070697_100121823 Ga0070697_1001218232 353
275 3300005543 Ga0070672_100021376 Ga0070672_1000213763 353
276 3300005543 Ga0070672_100093417 Ga0070672_1000934172 353
277 3300005544 Ga0070686_100038807 Ga0070686_1000388072 353
278 3300005545 Ga0070695_100051247 Ga0070695_1000512472 353
279 3300005546 Ga0070696_100090148 Ga0070696_1000901482 353
280 3300005547 Ga0070693_100013949 Ga0070693_1000139493 353
281 3300005548 Ga0070665_100080002 Ga0070665_1000800023 353
282 3300005549 Ga0070704_100002331 Ga0070704_1000023316 353
283 3300005549 Ga0070704_100005685 Ga0070704_1000056855 353
284 3300005549 Ga0070704_100059794 Ga0070704_1000597942 353
285 3300005564 Ga0070664_100060500 Ga0070664_1000605004 353
286 3300005564 Ga0070664_100083104 Ga0070664_1000831042 353
287 3300005564 Ga0070664_100235648 Ga0070664_1002356481 353
288 3300005577 Ga0068857_100017599 Ga0068857_1000175992 353
289 3300005578 Ga0068854_100221530 Ga0068854_1002215301 353
290 3300005615 Ga0070702_100017930 Ga0070702_1000179303 353
291 3300005617 Ga0068859_100002394 Ga0068859_1000023942 353
292 3300005618 Ga0068864_100000395 Ga0068864_1000003952 353
293 3300005618 Ga0068864_100041019 Ga0068864_1000410193 353
294 3300005618 Ga0068864_100104294 Ga0068864_1001042942 353
295 3300005618 Ga0068864_100159062 Ga0068864_1001590622 353
296 3300005718 Ga0068866_10020734 Ga0068866_100207342 353
297 3300005719 Ga0068861_100003084 Ga0068861_1000030848 353
298 3300005719 Ga0068861_100213841 Ga0068861_1002138411 353
299 3300005834 Ga0068851_10055598 Ga0068851_100555981 353
300 3300005840 Ga0068870_10003450 Ga0068870_100034504 353
301 3300005841 Ga0068863_100005560 Ga0068863_1000055607 353
302 3300005841 Ga0068863_100079538 Ga0068863_1000795382 353
303 3300005841 Ga0068863_100083864 Ga0068863_1000838642 353
304 3300005841 Ga0068863_100087535 Ga0068863_1000875353 353
305 3300005842 Ga0068858_100022939 Ga0068858_1000229394 353
306 3300005843 Ga0068860_100015795 Ga0068860_1000157956 353
307 3300005844 Ga0068862_100096637 Ga0068862_1000966372 353
308 3300005937 Ga0081455_10004832 Ga0081455_100048326 353
309 3300005981 Ga0081538_10001845 Ga0081538_1000184516 353
310 3300005981 Ga0081538_10049794 Ga0081538_100497942 353
311 3300006038 Ga0075365_10162406 Ga0075365_101624061 353
312 3300006178 Ga0075367_10134375 Ga0075367_101343752 353
313 3300006186 Ga0075369_10089691 Ga0075369_100896911 353
314 3300006195 Ga0075366_10025324 Ga0075366_100253244 353
315 3300006237 Ga0097621_100029643 Ga0097621_1000296433 353
316 3300006358 Ga0068871_100049355 Ga0068871_1000493553 353
317 3300006844 Ga0075428_100000638 Ga0075428_1000006389 353
318 3300006844 Ga0075428_100129532 Ga0075428_1001295321 353
319 3300006847 Ga0075431_100386998 Ga0075431_1003869981 353
320 3300006880 Ga0075429_100011701 Ga0075429_1000117012 353
321 3300006914 Ga0075436_100110908 Ga0075436_1001109082 353
322 3300006931 Ga0097620_100002394 Ga0097620_10000239417 353
323 3300007076 Ga0075435_100010857 Ga0075435_1000108575 353
324 3300007076 Ga0075435_100129221 Ga0075435_1001292212 353
325 3300007265 Ga0099794_10077562 Ga0099794_100775621 353
326 3300007788 Ga0099795_10022112 Ga0099795_100221121 353
327 3300009094 Ga0111539_10004193 Ga0111539_100041931 353
328 3300009098 Ga0105245_10165719 Ga0105245_101657192 353
329 3300009147 Ga0114129_10186839 Ga0114129_101868392 353
330 3300009148 Ga0105243_10022371 Ga0105243_100223714 353
331 3300009148 Ga0105243_10206130 Ga0105243_102061301 353
332 3300009176 Ga0105242_10001652 Ga0105242_1000165215 353
333 3300009176 Ga0105242_10036038 Ga0105242_100360382 353
334 3300009177 Ga0105248_10002497 Ga0105248_100024976 353
335 3300009177 Ga0105248_10030740 Ga0105248_100307408 353
336 3300009177 Ga0105248_10047007 Ga0105248_100470072 353
337 3300009553 Ga0105249_10155903 Ga0105249_101559031 353
338 3300009553 Ga0105249_10521545 Ga0105249_105215452 353
339 3300010159 Ga0099796_10019895 Ga0099796_100198951 353
340 3300011119 Ga0105246_10142919 Ga0105246_101429192 353
341 3300013100 Ga0157373_10065965 Ga0157373_100659653 353
342 3300013297 Ga0157378_10047322 Ga0157378_100473222 353
343 3300013297 Ga0157378_10113521 Ga0157378_101135214 353
344 3300013306 Ga0163162_10198498 Ga0163162_101984982 353
345 3300013308 Ga0157375_10126126 Ga0157375_101261262 353
346 3300013308 Ga0157375_10349952 Ga0157375_103499521 353
347 3300014325 Ga0163163_10002115 Ga0163163_100021157 353
348 3300014325 Ga0163163_10345885 Ga0163163_103458852 353
349 3300014326 Ga0157380_10093664 Ga0157380_100936643 353
350 3300014326 Ga0157380_10198046 Ga0157380_101980461 353
351 3300014326 Ga0157380_10273328 Ga0157380_102733282 353
352 3300014745 Ga0157377_10135912 Ga0157377_101359121 353
353 3300014968 Ga0157379_10000271 Ga0157379_100002711 353
354 3300014968 Ga0157379_10123706 Ga0157379_101237062 353
355 3300014969 Ga0157376_10298615 Ga0157376_102986151 353
356 3300025271 Ga0207666_1004719 Ga0207666_10047192 353
357 3300025893 Ga0207682_10003567 Ga0207682_100035674 353
358 3300025903 Ga0207680_10064210 Ga0207680_100642102 353
359 3300025907 Ga0207645_10009698 Ga0207645_100096982 353
360 3300025908 Ga0207643_10007625 Ga0207643_100076254 353
361 3300025908 Ga0207643_10010434 Ga0207643_100104343 353
362 3300025912 Ga0207707_10008295 Ga0207707_100082952 353
363 3300025923 Ga0207681_10155868 Ga0207681_101558682 353
364 3300025924 Ga0207694_10115496 Ga0207694_101154962 353
365 3300025924 Ga0207694_10227255 Ga0207694_102272552 353
366 3300025925 Ga0207650_10069764 Ga0207650_100697642 353
367 3300025926 Ga0207659_10089485 Ga0207659_100894853 353
368 3300025928 Ga0207700_10000183 Ga0207700_1000018317 353
369 3300025931 Ga0207644_10029749 Ga0207644_100297492 353
370 3300025931 Ga0207644_10169447 Ga0207644_101694472 353
371 3300025933 Ga0207706_10014132 Ga0207706_100141321 353
372 3300025933 Ga0207706_10141215 Ga0207706_101412152 353
373 3300025934 Ga0207686_10134323 Ga0207686_101343232 353
374 3300025935 Ga0207709_10023739 Ga0207709_100237393 353
375 3300025936 Ga0207670_10074064 Ga0207670_100740642 353
376 3300025936 Ga0207670_10208982 Ga0207670_102089821 353
377 3300025937 Ga0207669_10112900 Ga0207669_101129002 353
378 3300025938 Ga0207704_10086822 Ga0207704_100868222 353
379 3300025940 Ga0207691_10052989 Ga0207691_100529892 353
380 3300025940 Ga0207691_10058790 Ga0207691_100587903 353
381 3300025940 Ga0207691_10087427 Ga0207691_100874275 353
382 3300025940 Ga0207691_10225028 Ga0207691_102250281 353
383 3300025941 Ga0207711_10143421 Ga0207711_101434212 353
384 3300025942 Ga0207689_10000028 Ga0207689_1000002825 353
385 3300025942 Ga0207689_10104579 Ga0207689_101045792 353
386 3300025945 Ga0207679_10178582 Ga0207679_101785823 353
387 3300025945 Ga0207679_10221061 Ga0207679_102210611 353
388 3300025949 Ga0207667_10460832 Ga0207667_104608321 353
389 3300025960 Ga0207651_10352229 Ga0207651_103522291 353
390 3300025972 Ga0207668_10034187 Ga0207668_100341872 353
391 3300025986 Ga0207658_10108881 Ga0207658_101088812 353
392 3300026023 Ga0207677_10027767 Ga0207677_100277674 353
393 3300026035 Ga0207703_10002194 Ga0207703_1000219416 353
394 3300026035 Ga0207703_10009843 Ga0207703_100098434 353
395 3300026075 Ga0207708_10283093 Ga0207708_102830931 353
396 3300026088 Ga0207641_10074726 Ga0207641_100747261 353
397 3300026088 Ga0207641_10154440 Ga0207641_101544402 353
398 3300026089 Ga0207648_10001620 Ga0207648_1000162014 353
399 3300026089 Ga0207648_10024004 Ga0207648_100240042 353
400 3300026089 Ga0207648_10116949 Ga0207648_101169492 353
401 3300026095 Ga0207676_10005681 Ga0207676_100056818 353
402 3300026095 Ga0207676_10006221 Ga0207676_100062212 353
403 3300026095 Ga0207676_10062858 Ga0207676_100628582 353
404 3300026095 Ga0207676_10173982 Ga0207676_101739822 353
405 3300026116 Ga0207674_10105321 Ga0207674_101053212 353
406 3300026118 Ga0207675_100001456 Ga0207675_1000014568 353
407 3300026121 Ga0207683_10007883 Ga0207683_1000788311 353
408 3300026142 Ga0207698_10012587 Ga0207698_100125872 353
409 3300027876 Ga0209974_10013906 Ga0209974_100139062 353
410 3300028381 Ga0268264_10001919 Ga0268264_1000191917 353
411 3300028577 Ga0265318_10002144 Ga0265318_100021441 353
412 3300030521 Ga0307511_10000065 Ga0307511_1000006549 353
413 3300031238 Ga0265332_10015971 Ga0265332_100159713 353
414 3300031250 Ga0265331_10009792 Ga0265331_100097926 353
415 3300031344 Ga0265316_10019983 Ga0265316_100199835 353
416 3300031665 Ga0316575_10012610 Ga0316575_100126104 353
417 3300031711 Ga0265314_10012115 Ga0265314_100121152 353
418 3300031728 Ga0316578_10016899 Ga0316578_100168992 353
419 3300035111 Ga0373923_0065631 Ga0373923_0065631_103_1176 353
420 3300035113 Ga0373936_0073665 Ga0373936_0073665_193_1266 353
421 3300035118 Ga0373954_0009416 Ga0373954_0009416_192_1262 353
422 3300035118 Ga0373954_0012647 Ga0373954_0012647_889_1962 353
423 3300035119 Ga0373956_0000018 Ga0373956_0000018_22935_24005 353
424 3300035120 Ga0373957_0069024 Ga0373957_0069024_61_1134 353
425 3300035172 Ga0373955_0001648 Ga0373955_0001648_131_1204 353
426 3300035398 Ga0316574_0037874 Ga0316574_0037874_1560_2627 353
427 3300035692 Ga0373935_0098001 Ga0373935_0098001_822_1895 353
428 3300035724 Ga0373933_0000035 Ga0373933_0000035_24780_25850 353
429 3300035724 Ga0373933_0000832 Ga0373933_0000832_10874_11947 353
430 3300035725 Ga0373947_0191392 Ga0373947_0191392_67_1140 353
431 3300036401 Ga0373937_0001048 Ga0373937_0001048_14954_16027 353
432 3300036401 Ga0373937_0002135 Ga0373937_0002135_12912_13982 353
433 3300036647 Ga0316582_0152006 Ga0316582_0152006_302_1369 353
434 3300037853 Ga0436364_0576120 Ga0436364_0576120_23809_24885 353
435 3300039062 Ga0400483_146919 Ga0400483_146919_708_1778 353
436 3300039437 Ga0436365_0017926 Ga0436365_0017926_563_1633 353
437 3300042461 Ga0439460_0061955 Ga0439460_0061955_58_1125 353
438 3300045051 Ga0451576_0095780 Ga0451576_0095780_588_1658 353
439 3300046454 Ga0495592_0001428 Ga0495592_0001428_1309_2382 353
440 3300046459 Ga0495629_0003053 Ga0495629_0003053_385_1458 353
441 3300046459 Ga0495629_0165636 Ga0495629_0165636_355_1425 353
442 3300046462 Ga0495651_0000350 Ga0495651_0000350_24060_25130 353
443 3300046462 Ga0495651_0000476 Ga0495651_0000476_1575_2648 353
444 3300046463 Ga0495653_0000900 Ga0495653_0000900_7976_9049 353
445 3300046511 Ga0495608_0005364 Ga0495608_0005364_1047_2120 353
446 3300046529 Ga0495652_0002547 Ga0495652_0002547_12043_13116 353
447 3300046533 Ga0495640_0003500 Ga0495640_0003500_11210_12283 353
448 3300046536 Ga0495587_0016992 Ga0495587_0016992_2484_3557 353
449 3300046559 Ga0495667_0000641 Ga0495667_0000641_19248_20321 353
450 3300046663 Ga0495635_0053722 Ga0495635_0053722_46_1119 353
451 3300046678 Ga0495599_0061940 Ga0495599_0061940_208_1281 353
452 3300046678 Ga0495599_0071417 Ga0495599_0071417_829_1899 353
453 3300046679 Ga0495623_0011647 Ga0495623_0011647_1433_2506 353
454 3300046680 Ga0495646_0078021 Ga0495646_0078021_201_1274 353
455 3300046683 Ga0495658_0020147 Ga0495658_0020147_763_1833 353
456 3300046683 Ga0495658_0189520 Ga0495658_0189520_180_1250 353
457 3300046690 Ga0495624_0011667 Ga0495624_0011667_3853_4926 353
458 3300046809 Ga0495600_0047265 Ga0495600_0047265_1678_2751 353
459 3300047319 Ga0495674_0005934 Ga0495674_0005934_5631_6704 353
460 3300047322 Ga0495680_0000363 Ga0495680_0000363_33322_34395 353
461 3300047673 Ga0495593_0011918 Ga0495593_0011918_2040_3113 353
462 3300048905 Ga0496102_0317651 Ga0496102_0317651_178_1248 353
463 3300048911 Ga0496108_0419873 Ga0496108_0419873_43_1113 353
464 3300048912 Ga0496109_0257933 Ga0496109_0257933_247_1317 353
465 3300048918 Ga0496115_0065497 Ga0496115_0065497_1782_2852 353
466 3300049569 Ga0501032_0098516 Ga0501032_0098516_494_1585 353
467 3300049570 Ga0501033_0097677 Ga0501033_0097677_81_1172 353
468 3300049571 Ga0501034_0159847 Ga0501034_0159847_169_1239 353
469 3300049577 Ga0501041_0040199 Ga0501041_0040199_1447_2613 353
470 3300049579 Ga0501043_0061705 Ga0501043_0061705_1613_2704 353
471 3300049580 Ga0501046_0066745 Ga0501046_0066745_1018_2109 353
472 3300049581 Ga0501047_0005005 Ga0501047_0005005_7076_8167 353
473 3300049582 Ga0501048_0042882 Ga0501048_0042882_966_2132 353
474 3300049586 Ga0501070_0080799 Ga0501070_0080799_726_1805 353
475 3300049586 Ga0501070_0275788 Ga0501070_0275788_110_1189 353
476 3300049588 Ga0501072_0114894 Ga0501072_0114894_973_2043 353
477 3300049591 Ga0501075_0034527 Ga0501075_0034527_301_1467 353
478 3300049592 Ga0501076_0003456 Ga0501076_0003456_94_1260 353
479 3300049593 Ga0501077_0028017 Ga0501077_0028017_1038_2204 353
480 3300049822 Ga0501035_0168905 Ga0501035_0168905_136_1227 353
481 3300049823 Ga0501044_0142942 Ga0501044_0142942_934_2025 353
482 3300049823 Ga0501044_0320945 Ga0501044_0320945_74_1144 353
483 3300049824 Ga0501045_0013107 Ga0501045_0013107_89_1159 353
484 3300050491 nmdc:mga00v17_145073_c1 nmdc:mga00v17_145073_c1_437_1510 353
485 3300050507 nmdc:mga05p37_303718_c1 nmdc:mga05p37_303718_c1_349_1419 353
486 3300050508 nmdc:mga09592_9460_c1 nmdc:mga09592_9460_c1_2142_3212 353
487 3300050510 nmdc:mga06r32_109074_c1 nmdc:mga06r32_109074_c1_1175_2248 353
488 3300050511 nmdc:mga08y16_21112_c1 nmdc:mga08y16_21112_c1_2355_3425 353
489 3300050511 nmdc:mga08y16_501678_c1 nmdc:mga08y16_501678_c1_117_1187 353
490 3300050513 nmdc:mga0rr50_152820_c1 nmdc:mga0rr50_152820_c1_260_1330 353
491 3300053077 Ga0495601_0006586 Ga0495601_0006586_567_1640 353
492 3300053078 Ga0495612_0065550 Ga0495612_0065550_360_1433 353
493 3300053084 Ga0495595_0000296 Ga0495595_0000296_4134_5207 353
494 3300053085 Ga0495619_0003061 Ga0495619_0003061_9664_10737 353
495 3300053085 Ga0495619_0006623 Ga0495619_0006623_4585_5655 353
496 3300053090 Ga0500646_0000771 Ga0500646_0000771_5904_6980 353
497 3300053151 Ga0500604_0000329 Ga0500604_0000329_976_2052 353
498 3300060353 Ga0501082_0155250 Ga0501082_0155250_454_1620 353

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zix-assembly2.cif.gz_B crystal structure of ketopantoate reductase from pseudomonas aeruginosa bound to nadp+ 0.7707 4 349
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.7683 1 350
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.7637 1 350
3i83-assembly1.cif.gz_A crystal structure of 2-dehydropantoate 2-reductase from methylococcus capsulatus 0.7624 4 353
5hws-assembly1.cif.gz_D crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ 0.7561 1 347
ID Description Score Start End Superfamily
5zikA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.7891 225 346 1.10.1040.10
5zikA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.7778 225 346 1.10.1040.10
5hwsD02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.7601 232 346 1.10.1040.10
3egoB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.7575 227 345 1.10.1040.10
3ghyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7401 1 221 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537CP80-F1-model_v4 Uncharacterized protein 0.9945 242 352
AF-A0A381Q2U3-F1-model_v4 Uncharacterized protein 0.9944 23 353
AF-A0A537NZE7-F1-model_v4 Uncharacterized protein 0.9916 241 352
AF-A0A536ZVG5-F1-model_v4 Uncharacterized protein 0.9915 240 352
AF-A0A381Q2U3-F1-model_v4 Uncharacterized protein 0.9884 23 353

Feature Viewer

pLDDT pTM Quality
94.91 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map