F455094

General Info

Members Datasets Scaffolds Average Seq Length
497 230 497 472

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0027225|Ga0496108_0027225_697_2289
Length 522
Sequence LSSRRDNVWLATGLDIGIAARPILTFVGKGLLKMNQTHGNMPQLDPDGARLPIKLDSTSNGEFSPVPLSPVNHAANRLAHEAATQNAKRLALSRRKFLISACGAASTLLAFNSANAAAGRTGGFFDLLPEAALEPELAQAQIGRVAGEFIFDVQGHFVDPNGPWLQKLPPGSKPLSQMPKTGCALAAEPGAHSYLRCLGPDEFLKDVFLDSDTDMMVLSFVPSKPDAEPLTIQGADAVRQIIDRMEGMHRLLLHGRVNPNQAGDLERMDELKERWGVSAWKTYTQFGPGGNGYFLSDNIGMQFIEKARKLGVKVICVHKGLPFGKQSYQHSQCSDIGIVAKRFPDVSFLVYHSGFVTSVPERAFQGKGADDGIDTLIRSLIDNEVAPNSNVYAELGSTWRYLMRDPDAAAHVLGKLVKYCGENNVLWGTDSIWYGSPQDQIQAFRTFQIAPELRAKHNYAEIFGLNAARVYSISADEVKKFISRDPIAHRRLAYREHPEPHFLTYGPKTRREFLRLPGAGQP

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
164 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
165 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
166 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
172 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 1.41
Rhizosphere 98.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10004448 3300005290 Bacteria 5775
2 Ga0065715_10010134 3300005293 Bacteria 2229
3 Ga0065707_10001376 3300005295 Bacteria 9433
4 Ga0070676_10062759 3300005328 Bacteria 2212
5 Ga0070690_100000821 3300005330 Bacteria 15752
6 Ga0070670_100002109 3300005331 Bacteria 16314
7 Ga0070670_100132299 3300005331 Bacteria 2154
8 Ga0070677_10002468 3300005333 Bacteria 5918
9 Ga0070677_10002894 3300005333 Bacteria 5518
10 Ga0068869_100000793 3300005334 Bacteria 18058
11 Ga0070666_10003005 3300005335 Bacteria 10226
12 Ga0070680_100000848 3300005336 Bacteria 21664
13 Ga0070680_100007079 3300005336 Bacteria 8551
14 Ga0070682_100002531 3300005337 Bacteria 10088
15 Ga0068868_100010696 3300005338 Bacteria 6651
16 Ga0068868_100077292 3300005338 Bacteria 2663
17 Ga0070689_100001388 3300005340 Bacteria 15412
18 Ga0070691_10000265 3300005341 Bacteria 18244
19 Ga0070691_10053427 3300005341 Bacteria 1933
20 Ga0070687_100000208 3300005343 Bacteria 20470
21 Ga0070687_100010147 3300005343 Bacteria 4060
22 Ga0070661_100018968 3300005344 Bacteria 4898
23 Ga0070692_10002651 3300005345 Bacteria 6998
24 Ga0070668_100000930 3300005347 Bacteria 20445
25 Ga0070668_100007219 3300005347 Bacteria 8238
26 Ga0070668_100008511 3300005347 Bacteria 7620
27 Ga0070669_100003100 3300005353 Bacteria 11960
28 Ga0070669_100005308 3300005353 Bacteria 9304
29 Ga0070669_100013742 3300005353 Bacteria 5755
30 Ga0070669_100140328 3300005353 Bacteria 1862
31 Ga0070675_100023304 3300005354 Bacteria 4948
32 Ga0070675_100151540 3300005354 Bacteria 1988
33 Ga0070671_100011800 3300005355 Bacteria 7028
34 Ga0070674_100001080 3300005356 Bacteria 14294
35 Ga0070674_100001586 3300005356 Bacteria 12175
36 Ga0070674_100039709 3300005356 Bacteria 3179
37 Ga0070667_100028097 3300005367 Bacteria 4682
38 Ga0070714_100006810 3300005435 Bacteria 8855
39 Ga0070701_10001391 3300005438 Bacteria 8948
40 Ga0070705_100010613 3300005440 Bacteria 4618
41 Ga0070705_100019355 3300005440 Bacteria 3583
42 Ga0070705_100088175 3300005440 Bacteria 1925
43 Ga0070700_100001676 3300005441 Bacteria 11104
44 Ga0070700_100020077 3300005441 Bacteria 3865
45 Ga0070694_100001476 3300005444 Bacteria 13783
46 Ga0070694_100161698 3300005444 Bacteria 1643
47 Ga0070678_100135775 3300005456 Bacteria 1961
48 Ga0070662_100060891 3300005457 Bacteria 2754
49 Ga0070681_10014537 3300005458 Bacteria 7832
50 Ga0070681_10039128 3300005458 Bacteria 4754
51 Ga0068867_100000914 3300005459 Bacteria 20051
52 Ga0068867_100002009 3300005459 Bacteria 14210
53 Ga0068867_100002292 3300005459 Bacteria 13451
54 Ga0068867_100021401 3300005459 Bacteria 4615
55 Ga0070699_100111193 3300005518 Bacteria 2405
56 Ga0070679_100016251 3300005530 Bacteria 7171
57 Ga0070697_100117825 3300005536 Bacteria 2218
58 Ga0068853_100038138 3300005539 Bacteria 4092
59 Ga0070672_100003911 3300005543 Bacteria 9703
60 Ga0070672_100053531 3300005543 Bacteria 3155
61 Ga0070686_100001775 3300005544 Bacteria 12048
62 Ga0070695_100000546 3300005545 Bacteria 19898
63 Ga0070696_100132364 3300005546 Bacteria 1816
64 Ga0070693_100000463 3300005547 Bacteria 18199
65 Ga0070704_100000523 3300005549 Bacteria 18349
66 Ga0068855_100024210 3300005563 Bacteria 7267
67 Ga0068855_100072500 3300005563 Bacteria 4003
68 Ga0070664_100046359 3300005564 Bacteria 3671
69 Ga0068857_100149398 3300005577 Bacteria 2116
70 Ga0068854_100008871 3300005578 Bacteria 6473
71 Ga0068856_100012529 3300005614 Bacteria 8209
72 Ga0068852_100058280 3300005616 Bacteria 3345
73 Ga0068859_100001632 3300005617 Bacteria 22919
74 Ga0068864_100047010 3300005618 Bacteria 3705
75 Ga0068864_100081962 3300005618 Bacteria 2830
76 Ga0068864_100109931 3300005618 Bacteria 2454
77 Ga0068866_10000096 3300005718 Bacteria 36786
78 Ga0068866_10021117 3300005718 Bacteria 2995
79 Ga0068861_100000483 3300005719 Bacteria 23160
80 Ga0068861_100002848 3300005719 Bacteria 11380
81 Ga0068861_100034549 3300005719 Bacteria 3739
82 Ga0068870_10048693 3300005840 Bacteria 2233
83 Ga0068870_10051988 3300005840 Bacteria 2171
84 Ga0068863_100004763 3300005841 Bacteria 13368
85 Ga0068858_100001587 3300005842 Bacteria 23201
86 Ga0068858_100136379 3300005842 Bacteria 2302
87 Ga0068860_100001404 3300005843 Bacteria 26110
88 Ga0068860_100011015 3300005843 Bacteria 8916
89 Ga0068860_100184020 3300005843 Bacteria 2020
90 Ga0068862_100000705 3300005844 Bacteria 34116
91 Ga0068862_100023060 3300005844 Bacteria 5213
92 Ga0081455_10000626 3300005937 Bacteria 45898
93 Ga0081538_10051664 3300005981 Bacteria 2465
94 Ga0081538_10075547 3300005981 Bacteria 1827
95 Ga0081539_10001648 3300005985 Bacteria 36250
96 Ga0075366_10062944 3300006195 Bacteria 2205
97 Ga0097621_100002758 3300006237 Bacteria 12012
98 Ga0097621_100014240 3300006237 Bacteria 5948
99 Ga0075428_100015084 3300006844 Bacteria 8584
100 Ga0075428_100033208 3300006844 Bacteria 5698
101 Ga0075428_100063500 3300006844 Bacteria 4043
102 Ga0075428_100084909 3300006844 Bacteria 3453
103 Ga0075430_100032243 3300006846 Bacteria 4448
104 Ga0075430_100141001 3300006846 Bacteria 2007
105 Ga0075430_100240720 3300006846 Bacteria 1499
106 Ga0075431_100006973 3300006847 Bacteria 11237
107 Ga0075431_100016079 3300006847 Bacteria 7593
108 Ga0075431_100043332 3300006847 Bacteria 4644
109 Ga0075431_100100336 3300006847 Bacteria 2987
110 Ga0075433_10003943 3300006852 Bacteria 11490
111 Ga0075433_10085086 3300006852 Bacteria 2792
112 Ga0075434_100006459 3300006871 Bacteria 10745
113 Ga0075434_100036873 3300006871 Bacteria 4837
114 Ga0075434_100083778 3300006871 Bacteria 3187
115 Ga0075434_100220729 3300006871 Bacteria 1915
116 Ga0075429_100000151 3300006880 Bacteria 43094
117 Ga0075429_100045942 3300006880 Bacteria 3800
118 Ga0075429_100111306 3300006880 Bacteria 2393
119 Ga0068865_100003349 3300006881 Bacteria 9599
120 Ga0068865_100005029 3300006881 Bacteria 7999
121 Ga0068865_100007073 3300006881 Bacteria 6891
122 Ga0075436_100000888 3300006914 Bacteria 19869
123 Ga0075436_100014554 3300006914 Bacteria 5392
124 Ga0075436_100021203 3300006914 Bacteria 4458
125 Ga0097620_100001632 3300006931 Bacteria 22919
126 Ga0075435_100006886 3300007076 Bacteria 8068
127 Ga0075435_100035493 3300007076 Bacteria 3957
128 Ga0111539_10000511 3300009094 Bacteria 49322
129 Ga0111539_10014995 3300009094 Bacteria 9657
130 Ga0111539_10071034 3300009094 Bacteria 4108
131 Ga0111539_10072891 3300009094 Bacteria 4049
132 Ga0111539_10117470 3300009094 Bacteria 3118
133 Ga0105245_10000086 3300009098 Bacteria 93019
134 Ga0105245_10218808 3300009098 Bacteria 1836
135 Ga0114129_10007243 3300009147 Bacteria 15794
136 Ga0114129_10008130 3300009147 Bacteria 14953
137 Ga0114129_10013162 3300009147 Bacteria 11787
138 Ga0114129_10059248 3300009147 Bacteria 5354
139 Ga0114129_10274767 3300009147 Bacteria 2253
140 Ga0105243_10001549 3300009148 Bacteria 20112
141 Ga0105243_10012928 3300009148 Bacteria 6308
142 Ga0105243_10016015 3300009148 Bacteria 5672
143 Ga0105243_10041362 3300009148 Bacteria 3605
144 Ga0105241_10013200 3300009174 Bacteria 6057
145 Ga0105242_10006900 3300009176 Bacteria 8761
146 Ga0105242_10066496 3300009176 Bacteria 2977
147 Ga0105242_10111429 3300009176 Bacteria 2333
148 Ga0105248_10028359 3300009177 Bacteria 6237
149 Ga0105248_10046313 3300009177 Bacteria 4874
150 Ga0105249_10001346 3300009553 Bacteria 21478
151 Ga0105249_10002073 3300009553 Bacteria 17370
152 Ga0105249_10003354 3300009553 Bacteria 13859
153 Ga0105249_10200511 3300009553 Bacteria 1952
154 Ga0105239_10033680 3300010375 Bacteria 5625
155 Ga0157370_10007039 3300013104 Bacteria 12278
156 Ga0157374_10048803 3300013296 Bacteria 3929
157 Ga0157378_10001676 3300013297 Bacteria 19965
158 Ga0157378_10145750 3300013297 Bacteria 2202
159 Ga0163162_10034076 3300013306 Bacteria 5065
160 Ga0163162_10195641 3300013306 Bacteria 2150
161 Ga0157375_10005685 3300013308 Bacteria 10851
162 Ga0157375_10018432 3300013308 Bacteria 6330
163 Ga0157375_10048409 3300013308 Bacteria 4158
164 Ga0157380_10000812 3300014326 Bacteria 19571
165 Ga0157380_10000866 3300014326 Bacteria 19019
166 Ga0157380_10006520 3300014326 Bacteria 8230
167 Ga0157379_10011235 3300014968 Bacteria 7801
168 Ga0157379_10148606 3300014968 Bacteria 2113
169 Ga0157376_10001287 3300014969 Bacteria 16515
170 Ga0157376_10024468 3300014969 Bacteria 4742
171 Ga0163161_10003077 3300017792 Bacteria 11767
172 Ga0163161_10012183 3300017792 Bacteria 5963
173 Ga0207697_10007970 3300025315 Bacteria 4678
174 Ga0207653_10004329 3300025885 Bacteria 4462
175 Ga0207653_10018942 3300025885 Bacteria 2168
176 Ga0207682_10012782 3300025893 Bacteria 3275
177 Ga0207682_10014988 3300025893 Bacteria 3018
178 Ga0207642_10005182 3300025899 Bacteria 4244
179 Ga0207688_10022220 3300025901 Bacteria 3470
180 Ga0207680_10000938 3300025903 Bacteria 13768
181 Ga0207645_10001987 3300025907 Bacteria 16443
182 Ga0207645_10002283 3300025907 Bacteria 15208
183 Ga0207645_10058910 3300025907 Bacteria 2452
184 Ga0207643_10050666 3300025908 Bacteria 2355
185 Ga0207684_10164979 3300025910 Bacteria 1908
186 Ga0207684_10193044 3300025910 Bacteria 1756
187 Ga0207654_10010610 3300025911 Bacteria 4691
188 Ga0207707_10085268 3300025912 Bacteria 2760
189 Ga0207660_10001397 3300025917 Bacteria 16219
190 Ga0207662_10000360 3300025918 Bacteria 20465
191 Ga0207652_10031077 3300025921 Bacteria 4481
192 Ga0207681_10000543 3300025923 Bacteria 25987
193 Ga0207681_10001540 3300025923 Bacteria 14853
194 Ga0207681_10058503 3300025923 Bacteria 2639
195 Ga0207650_10000597 3300025925 Bacteria 28883
196 Ga0207650_10001219 3300025925 Bacteria 18863
197 Ga0207659_10000680 3300025926 Bacteria 20195
198 Ga0207659_10005695 3300025926 Bacteria 7584
199 Ga0207687_10002515 3300025927 Bacteria 12429
200 Ga0207687_10031706 3300025927 Bacteria 3574
201 Ga0207664_10015573 3300025929 Bacteria 5525
202 Ga0207664_10040349 3300025929 Bacteria 3629
203 Ga0207644_10078924 3300025931 Bacteria 2427
204 Ga0207706_10000654 3300025933 Bacteria 36592
205 Ga0207706_10038064 3300025933 Bacteria 4268
206 Ga0207686_10017500 3300025934 Bacteria 4040
207 Ga0207709_10006567 3300025935 Bacteria 6529
208 Ga0207709_10008516 3300025935 Bacteria 5671
209 Ga0207670_10004321 3300025936 Bacteria 7633
210 Ga0207669_10004723 3300025937 Bacteria 6031
211 Ga0207669_10015581 3300025937 Bacteria 3837
212 Ga0207669_10015830 3300025937 Bacteria 3814
213 Ga0207704_10000193 3300025938 Bacteria 31520
214 Ga0207704_10001054 3300025938 Bacteria 12253
215 Ga0207704_10007899 3300025938 Bacteria 5054
216 Ga0207665_10084313 3300025939 Bacteria 2193
217 Ga0207691_10000049 3300025940 Bacteria 94813
218 Ga0207691_10001712 3300025940 Bacteria 21616
219 Ga0207691_10068920 3300025940 Bacteria 3196
220 Ga0207711_10013423 3300025941 Bacteria 6805
221 Ga0207689_10000653 3300025942 Bacteria 33050
222 Ga0207689_10009925 3300025942 Bacteria 8210
223 Ga0207679_10004574 3300025945 Bacteria 8617
224 Ga0207667_10003225 3300025949 Bacteria 20154
225 Ga0207651_10001254 3300025960 Bacteria 11424
226 Ga0207651_10094277 3300025960 Bacteria 2201
227 Ga0207712_10003982 3300025961 Bacteria 9322
228 Ga0207712_10004335 3300025961 Bacteria 8963
229 Ga0207712_10007290 3300025961 Bacteria 6976
230 Ga0207668_10015198 3300025972 Bacteria 4778
231 Ga0207668_10020829 3300025972 Bacteria 4174
232 Ga0207658_10002782 3300025986 Bacteria 12585
233 Ga0207658_10044400 3300025986 Bacteria 3236
234 Ga0207677_10002512 3300026023 Bacteria 9613
235 Ga0207703_10002550 3300026035 Bacteria 15730
236 Ga0207703_10019873 3300026035 Bacteria 5250
237 Ga0207708_10000664 3300026075 Bacteria 26380
238 Ga0207708_10002917 3300026075 Bacteria 12593
239 Ga0207708_10027481 3300026075 Bacteria 4308
240 Ga0207708_10098317 3300026075 Bacteria 2262
241 Ga0207702_10013359 3300026078 Bacteria 6829
242 Ga0207641_10003372 3300026088 Bacteria 14180
243 Ga0207641_10006912 3300026088 Bacteria 9493
244 Ga0207641_10129764 3300026088 Bacteria 2262
245 Ga0207648_10000145 3300026089 Bacteria 70734
246 Ga0207648_10000701 3300026089 Bacteria 37529
247 Ga0207648_10001737 3300026089 Bacteria 23844
248 Ga0207648_10031573 3300026089 Bacteria 4683
249 Ga0207674_10181842 3300026116 Bacteria 2054
250 Ga0207675_100000868 3300026118 Bacteria 30104
251 Ga0207675_100003197 3300026118 Bacteria 16070
252 Ga0207675_100004275 3300026118 Bacteria 13802
253 Ga0207675_100107135 3300026118 Bacteria 2635
254 Ga0207683_10000610 3300026121 Bacteria 32987
255 Ga0207683_10244411 3300026121 Bacteria 1637
256 Ga0207698_10094549 3300026142 Bacteria 2458
257 Ga0210002_1002389 3300027617 Bacteria 2707
258 Ga0209971_1012373 3300027682 Bacteria 2018
259 Ga0209974_10008285 3300027876 Bacteria 3557
260 Ga0209974_10019646 3300027876 Bacteria 2240
261 Ga0207428_10018349 3300027907 Bacteria 5978
262 Ga0207428_10021078 3300027907 Bacteria 5522
263 Ga0268265_10001398 3300028380 Bacteria 20454
264 Ga0268265_10002069 3300028380 Bacteria 15664
265 Ga0268265_10034316 3300028380 Bacteria 3697
266 Ga0268265_10125523 3300028380 Bacteria 2123
267 Ga0268264_10001193 3300028381 Bacteria 25104
268 Ga0268264_10003041 3300028381 Bacteria 14539
269 Ga0307408_100020290 3300031548 Bacteria 4484
270 Ga0307408_100025150 3300031548 Bacteria 4075
271 Ga0307408_100026481 3300031548 Bacteria 3984
272 Ga0307405_10006024 3300031731 Bacteria 5923
273 Ga0307413_10000725 3300031824 Bacteria 11336
274 Ga0307410_10003182 3300031852 Bacteria 8175
275 Ga0307410_10018226 3300031852 Bacteria 4238
276 Ga0307410_10179305 3300031852 Bacteria 1603
277 Ga0307406_10015058 3300031901 Bacteria 4466
278 Ga0307407_10012312 3300031903 Bacteria 4107
279 Ga0307407_10073916 3300031903 Bacteria 2038
280 Ga0307412_10036385 3300031911 Bacteria 3153
281 Ga0307409_100015091 3300031995 Bacteria 5054
282 Ga0307416_100001308 3300032002 Bacteria 13432
283 Ga0307416_100053481 3300032002 Bacteria 3240
284 Ga0307416_100094241 3300032002 Bacteria 2581
285 Ga0307416_100343343 3300032002 Bacteria 1507
286 Ga0307411_10068861 3300032005 Bacteria 2387
287 Ga0307415_100002224 3300032126 Bacteria 9613
288 Ga0373938_0001962 3300034957 Bacteria 3294
289 Ga0373936_0011550 3300035113 Bacteria 3346
290 Ga0373941_0006689 3300035115 Bacteria 2788
291 Ga0373943_0001695 3300035170 Bacteria 9996
292 Ga0373962_0013512 3300035242 Bacteria 2070
293 Ga0373931_0025588 3300035691 Bacteria 2997
294 Ga0373935_0046938 3300035692 Bacteria 2729
295 Ga0373947_0014482 3300035725 Bacteria 4525
296 Ga0373947_0069034 3300035725 Unclassified 2162
297 Ga0373925_0004375 3300037068 Bacteria 10677
298 Ga0439447_019952 3300041407 Bacteria 1782
299 Ga0439441_000282 3300042001 Bacteria 5057
300 Ga0450920_004026 3300042122 Bacteria 2570
301 Ga0450923_003606 3300042125 Bacteria 2356
302 Ga0439446_0000329 3300042156 Bacteria 9141
303 Ga0439446_0007754 3300042156 Bacteria 2829
304 Ga0450908_001096 3300042184 Bacteria 5263
305 Ga0439434_0000014 3300042435 Bacteria 44727
306 Ga0439435_0000015 3300042436 Bacteria 19149
307 Ga0439435_0018376 3300042436 Bacteria 1778
308 Ga0439444_0000344 3300042437 Bacteria 4929
309 Ga0439460_0000680 3300042461 Bacteria 7513
310 Ga0439460_0008952 3300042461 Bacteria 2532
311 Ga0451577_0211946 3300042876 Bacteria 1750
312 Ga0495632_0032462 3300046519 Bacteria 2689
313 Ga0495643_0043201 3300046522 Bacteria 2454
314 Ga0495663_0005029 3300046525 Bacteria 3693
315 Ga0495625_0023214 3300046660 Bacteria 4740
316 Ga0495649_0001871 3300046694 Bacteria 15405
317 Ga0495660_0029130 3300046810 Bacteria 3117
318 Ga0495615_0003039 3300048090 Bacteria 2771
319 Ga0496106_0066387 3300048909 Bacteria 2748
320 Ga0496108_0027225 3300048911 Bacteria 4718
321 Ga0496109_0075585 3300048912 Bacteria 3097
322 Ga0496109_0131950 3300048912 Bacteria 2332
323 Ga0496112_0032572 3300048915 Bacteria 5062
324 Ga0496114_0002016 3300048917 Bacteria 15455
325 Ga0496114_0017259 3300048917 Bacteria 5824
326 Ga0501298_017364 3300049521 Bacteria 1313
327 Ga0501031_0006946 3300049568 Bacteria 7392
328 Ga0501032_0015971 3300049569 Bacteria 5285
329 Ga0501032_0063214 3300049569 Bacteria 2478
330 Ga0501032_0065106 3300049569 Bacteria 2439
331 Ga0501033_0000063 3300049570 Bacteria 101552
332 Ga0501033_0004916 3300049570 Bacteria 10636
333 Ga0501033_0058037 3300049570 Bacteria 2860
334 Ga0501034_0003919 3300049571 Bacteria 16712
335 Ga0501034_0011311 3300049571 Bacteria 9257
336 Ga0501034_0101397 3300049571 Bacteria 2872
337 Ga0501036_0003793 3300049572 Bacteria 12121
338 Ga0501036_0020791 3300049572 Bacteria 5512
339 Ga0501036_0030268 3300049572 Bacteria 4575
340 Ga0501036_0033547 3300049572 Bacteria 4341
341 Ga0501037_0014666 3300049573 Bacteria 5764
342 Ga0501037_0069977 3300049573 Bacteria 2554
343 Ga0501037_0071099 3300049573 Bacteria 2532
344 Ga0501038_0009140 3300049574 Bacteria 9092
345 Ga0501038_0030535 3300049574 Bacteria 4767
346 Ga0501038_0058000 3300049574 Bacteria 3321
347 Ga0501038_0062146 3300049574 Bacteria 3191
348 Ga0501039_0007025 3300049575 Bacteria 8572
349 Ga0501039_0016691 3300049575 Bacteria 5626
350 Ga0501039_0109910 3300049575 Bacteria 2155
351 Ga0501039_0138576 3300049575 Bacteria 1911
352 Ga0501040_0008812 3300049576 Bacteria 6554
353 Ga0501040_0013563 3300049576 Bacteria 5359
354 Ga0501040_0014751 3300049576 Bacteria 5156
355 Ga0501040_0019093 3300049576 Bacteria 4557
356 Ga0501040_0036564 3300049576 Bacteria 3333
357 Ga0501040_0054398 3300049576 Bacteria 2744
358 Ga0501040_0071401 3300049576 Bacteria 2397
359 Ga0501041_0001490 3300049577 Bacteria 12974
360 Ga0501041_0004007 3300049577 Bacteria 8500
361 Ga0501041_0034690 3300049577 Bacteria 3055
362 Ga0501041_0046424 3300049577 Bacteria 2642
363 Ga0501042_0000787 3300049578 Bacteria 17377
364 Ga0501042_0001286 3300049578 Bacteria 14601
365 Ga0501042_0009521 3300049578 Bacteria 6479
366 Ga0501042_0063374 3300049578 Bacteria 2642
367 Ga0501042_0094783 3300049578 Bacteria 2144
368 Ga0501043_0015042 3300049579 Bacteria 6060
369 Ga0501043_0028639 3300049579 Bacteria 4372
370 Ga0501043_0060484 3300049579 Bacteria 2973
371 Ga0501046_0064140 3300049580 Bacteria 2868
372 Ga0501047_0001237 3300049581 Bacteria 25278
373 Ga0501047_0036841 3300049581 Bacteria 4727
374 Ga0501048_0002654 3300049582 Bacteria 13664
375 Ga0501048_0009796 3300049582 Bacteria 7184
376 Ga0501048_0014823 3300049582 Bacteria 5765
377 Ga0501048_0030555 3300049582 Bacteria 3897
378 Ga0501068_0001065 3300049584 Bacteria 14494
379 Ga0501068_0001308 3300049584 Bacteria 13201
380 Ga0501068_0015552 3300049584 Bacteria 4372
381 Ga0501068_0015990 3300049584 Bacteria 4322
382 Ga0501068_0017483 3300049584 Bacteria 4147
383 Ga0501068_0025420 3300049584 Bacteria 3483
384 Ga0501068_0041545 3300049584 Bacteria 2764
385 Ga0501068_0066961 3300049584 Bacteria 2188
386 Ga0501069_0065908 3300049585 Bacteria 2025
387 Ga0501070_0050479 3300049586 Bacteria 3454
388 Ga0501071_0025721 3300049587 Bacteria 4124
389 Ga0501071_0034763 3300049587 Bacteria 3589
390 Ga0501071_0038214 3300049587 Bacteria 3430
391 Ga0501071_0040790 3300049587 Bacteria 3323
392 Ga0501071_0088284 3300049587 Bacteria 2275
393 Ga0501072_0012106 3300049588 Bacteria 6589
394 Ga0501072_0014907 3300049588 Bacteria 5958
395 Ga0501072_0038819 3300049588 Bacteria 3737
396 Ga0501072_0105573 3300049588 Bacteria 2240
397 Ga0501073_0029253 3300049589 Bacteria 3936
398 Ga0501074_0019582 3300049590 Bacteria 4912
399 Ga0501074_0032259 3300049590 Bacteria 3795
400 Ga0501074_0120151 3300049590 Bacteria 1879
401 Ga0501075_0001763 3300049591 Bacteria 14222
402 Ga0501075_0001848 3300049591 Bacteria 13974
403 Ga0501075_0002598 3300049591 Bacteria 12060
404 Ga0501075_0007485 3300049591 Bacteria 7571
405 Ga0501075_0022820 3300049591 Bacteria 4575
406 Ga0501076_0000216 3300049592 Bacteria 34890
407 Ga0501076_0000866 3300049592 Bacteria 19677
408 Ga0501076_0001441 3300049592 Bacteria 15989
409 Ga0501076_0004879 3300049592 Bacteria 9588
410 Ga0501076_0015573 3300049592 Bacteria 5751
411 Ga0501076_0088757 3300049592 Bacteria 2485
412 Ga0501076_0175169 3300049592 Bacteria 1748
413 Ga0501077_0029068 3300049593 Bacteria 3513
414 Ga0501077_0045445 3300049593 Bacteria 2790
415 Ga0501079_0001260 3300049741 Bacteria 17758
416 Ga0501079_0007020 3300049741 Bacteria 8494
417 Ga0501079_0012484 3300049741 Bacteria 6484
418 Ga0501079_0014891 3300049741 Bacteria 5928
419 Ga0501079_0016202 3300049741 Bacteria 5697
420 Ga0501079_0040734 3300049741 Bacteria 3584
421 Ga0501079_0073265 3300049741 Bacteria 2647
422 Ga0501080_0004357 3300049742 Bacteria 12569
423 Ga0501080_0004409 3300049742 Bacteria 12510
424 Ga0501080_0005976 3300049742 Bacteria 10905
425 Ga0501080_0006492 3300049742 Bacteria 10502
426 Ga0501080_0010958 3300049742 Bacteria 8298
427 Ga0501080_0021797 3300049742 Bacteria 5935
428 Ga0501080_0094997 3300049742 Bacteria 2768
429 Ga0501081_0003465 3300049743 Bacteria 10073
430 Ga0501081_0007062 3300049743 Bacteria 7301
431 Ga0501081_0008725 3300049743 Bacteria 6588
432 Ga0501081_0013127 3300049743 Bacteria 5448
433 Ga0501081_0013873 3300049743 Bacteria 5303
434 Ga0501081_0026741 3300049743 Bacteria 3893
435 Ga0501081_0052870 3300049743 Bacteria 2804
436 Ga0501081_0064077 3300049743 Bacteria 2552
437 Ga0501081_0111668 3300049743 Bacteria 1940
438 Ga0501083_0029000 3300049744 Bacteria 3811
439 Ga0501083_0034078 3300049744 Bacteria 3483
440 Ga0501035_0000465 3300049822 Bacteria 45334
441 Ga0501035_0008116 3300049822 Bacteria 9784
442 Ga0501035_0052227 3300049822 Bacteria 3658
443 Ga0501035_0115011 3300049822 Bacteria 2355
444 Ga0501044_0061488 3300049823 Bacteria 3842
445 Ga0501044_0084951 3300049823 Bacteria 3198
446 Ga0501044_0174776 3300049823 Bacteria 2117
447 Ga0501045_0010055 3300049824 Bacteria 6616
448 Ga0501045_0018482 3300049824 Bacteria 4958
449 nmdc:mga05p37_17021_c1 3300050507 Bacteria 8430
450 nmdc:mga05p37_44094_c1 3300050507 Bacteria 5488
451 nmdc:mga05p37_5572_c1 3300050507 Bacteria 14804
452 nmdc:mga05p37_7988_c1 3300050507 Bacteria 12491
453 nmdc:mga05p37_840_c1 3300050507 Bacteria 34480
454 nmdc:mga09592_14784_c1 3300050508 Bacteria 6371
455 nmdc:mga09592_149623_c1 3300050508 Bacteria 2014
456 nmdc:mga09592_24890_c1 3300050508 Bacteria 4951
457 nmdc:mga09592_5_c1 3300050508 Bacteria 130353
458 nmdc:mga0qj67_13493_c1 3300050509 Bacteria 6161
459 nmdc:mga0qj67_3056_c1 3300050509 Bacteria 12027
460 nmdc:mga0qj67_43967_c1 3300050509 Bacteria 3518
461 nmdc:mga06r32_132503_c1 3300050510 Bacteria 2465
462 nmdc:mga06r32_21338_c1 3300050510 Bacteria 5979
463 nmdc:mga06r32_36089_c1 3300050510 Bacteria 4669
464 nmdc:mga06r32_37691_c1 3300050510 Bacteria 4573
465 nmdc:mga06r32_40488_c1 3300050510 Bacteria 4424
466 nmdc:mga06r32_88216_c1 3300050510 Bacteria 3028
467 nmdc:mga08y16_28803_c1 3300050511 Bacteria 5854
468 nmdc:mga08y16_415008_c1 3300050511 Bacteria 1376
469 nmdc:mga08y16_51934_c1 3300050511 Bacteria 4289
470 nmdc:mga0n895_138320_c1 3300050512 Bacteria 2463
471 nmdc:mga0n895_307612_c1 3300050512 Bacteria 1606
472 nmdc:mga0n895_333654_c1 3300050512 Bacteria 1536
473 nmdc:mga0n895_34638_c1 3300050512 Bacteria 4863
474 nmdc:mga0n895_744_c1 3300050512 Bacteria 23046
475 nmdc:mga0n895_78424_c1 3300050512 Bacteria 3288
476 nmdc:mga0rr50_7835_c1 3300050513 Bacteria 6621
477 nmdc:mga08x19_11022_c1 3300050514 Bacteria 5439
478 nmdc:mga08x19_31174_c1 3300050514 Bacteria 3352
479 nmdc:mga08x19_68942_c1 3300050514 Bacteria 2303
480 nmdc:mga0a205_103_c1 3300050515 Bacteria 48342
481 nmdc:mga0a205_133973_c1 3300050515 Bacteria 2378
482 nmdc:mga0a205_45254_c1 3300050515 Bacteria 4244
483 nmdc:mga0a205_907_c1 3300050515 Bacteria 24381
484 Ga0501084_0007322 3300054114 Bacteria 9090
485 Ga0501084_0014078 3300054114 Bacteria 6623
486 Ga0501084_0087260 3300054114 Bacteria 2619
487 Ga0501082_0006838 3300060353 Bacteria 9861
488 Ga0501082_0026121 3300060353 Bacteria 5033
489 Ga0501082_0027719 3300060353 Bacteria 4876
490 Ga0501082_0029533 3300060353 Bacteria 4723
491 Ga0501082_0030231 3300060353 Bacteria 4668
492 Ga0501082_0036868 3300060353 Bacteria 4212
493 Ga0501082_0168726 3300060353 Bacteria 1902
494 Ga0530510_0000558 3300061734 Bacteria 23955
495 Ga0530510_0001122 3300061734 Bacteria 17801
496 Ga0530510_0009224 3300061734 Bacteria 6916
497 Ga0530510_0060006 3300061734 Bacteria 2752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049521 Ga0501298_017364 Ga0501298_017364_35_1213 382
2 3300050512 nmdc:mga0n895_307612_c1 nmdc:mga0n895_307612_c1_19_1251 410
3 3300027876 Ga0209974_10019646 Ga0209974_100196462 415
4 3300006844 Ga0075428_100084909 Ga0075428_1000849093 423
5 3300042436 Ga0439435_0018376 Ga0439435_0018376_416_1744 423
6 3300050511 nmdc:mga08y16_415008_c1 nmdc:mga08y16_415008_c1_77_1348 423
7 3300005340 Ga0070689_100001388 Ga0070689_1000013887 424
8 3300025936 Ga0207670_10004321 Ga0207670_100043215 424
9 3300005440 Ga0070705_100019355 Ga0070705_1000193552 428
10 3300005444 Ga0070694_100161698 Ga0070694_1001616981 428
11 3300048090 Ga0495615_0003039 Ga0495615_0003039_1461_2759 431
12 3300006914 Ga0075436_100014554 Ga0075436_1000145544 433
13 3300050514 nmdc:mga08x19_11022_c1 nmdc:mga08x19_11022_c1_1591_2949 433
14 3300028380 Ga0268265_10125523 Ga0268265_101255231 434
15 3300050512 nmdc:mga0n895_333654_c1 nmdc:mga0n895_333654_c1_66_1418 435
16 3300031548 Ga0307408_100020290 Ga0307408_1000202905 437
17 3300032002 Ga0307416_100094241 Ga0307416_1000942413 437
18 3300032002 Ga0307416_100343343 Ga0307416_1003433431 437
19 3300025939 Ga0207665_10084313 Ga0207665_100843132 439
20 3300025929 Ga0207664_10040349 Ga0207664_100403495 441
21 3300050510 nmdc:mga06r32_132503_c1 nmdc:mga06r32_132503_c1_1130_2455 441
22 3300005985 Ga0081539_10001648 Ga0081539_100016484 442
23 3300042001 Ga0439441_000282 Ga0439441_000282_2506_3909 442
24 3300046519 Ga0495632_0032462 Ga0495632_0032462_1052_2425 443
25 3300046660 Ga0495625_0023214 Ga0495625_0023214_2385_3758 443
26 3300046694 Ga0495649_0001871 Ga0495649_0001871_12793_14166 443
27 3300046810 Ga0495660_0029130 Ga0495660_0029130_1333_2706 443
28 3300048917 Ga0496114_0002016 Ga0496114_0002016_517_1866 443
29 3300006846 Ga0075430_100240720 Ga0075430_1002407202 446
30 3300035691 Ga0373931_0025588 Ga0373931_0025588_659_2047 447
31 3300049587 Ga0501071_0088284 Ga0501071_0088284_476_1822 447
32 3300006844 Ga0075428_100033208 Ga0075428_1000332086 448
33 3300006847 Ga0075431_100100336 Ga0075431_1001003363 448
34 3300009094 Ga0111539_10072891 Ga0111539_100728915 448
35 3300009147 Ga0114129_10013162 Ga0114129_1001316212 448
36 3300027907 Ga0207428_10021078 Ga0207428_100210785 448
37 3300049576 Ga0501040_0014751 Ga0501040_0014751_2552_3901 448
38 3300050507 nmdc:mga05p37_17021_c1 nmdc:mga05p37_17021_c1_4528_5910 448
39 3300050508 nmdc:mga09592_24890_c1 nmdc:mga09592_24890_c1_1791_3173 448
40 3300050509 nmdc:mga0qj67_3056_c1 nmdc:mga0qj67_3056_c1_10243_11592 448
41 3300050510 nmdc:mga06r32_40488_c1 nmdc:mga06r32_40488_c1_1606_2955 448
42 3300005328 Ga0070676_10062759 Ga0070676_100627593 449
43 3300005345 Ga0070692_10002651 Ga0070692_1000265112 449
44 3300005347 Ga0070668_100008511 Ga0070668_1000085115 449
45 3300005353 Ga0070669_100003100 Ga0070669_10000310012 449
46 3300005356 Ga0070674_100039709 Ga0070674_1000397093 449
47 3300005459 Ga0068867_100002292 Ga0068867_10000229212 449
48 3300005719 Ga0068861_100000483 Ga0068861_10000048327 449
49 3300006880 Ga0075429_100111306 Ga0075429_1001113063 449
50 3300006881 Ga0068865_100005029 Ga0068865_1000050293 449
51 3300009148 Ga0105243_10012928 Ga0105243_100129284 449
52 3300009176 Ga0105242_10111429 Ga0105242_101114292 449
53 3300009553 Ga0105249_10001346 Ga0105249_1000134625 449
54 3300014326 Ga0157380_10006520 Ga0157380_1000652012 449
55 3300025907 Ga0207645_10058910 Ga0207645_100589103 449
56 3300025923 Ga0207681_10000543 Ga0207681_1000054316 449
57 3300025935 Ga0207709_10006567 Ga0207709_100065676 449
58 3300025937 Ga0207669_10015830 Ga0207669_100158303 449
59 3300025938 Ga0207704_10001054 Ga0207704_100010549 449
60 3300025961 Ga0207712_10004335 Ga0207712_1000433510 449
61 3300026075 Ga0207708_10002917 Ga0207708_1000291712 449
62 3300026089 Ga0207648_10001737 Ga0207648_1000173720 449
63 3300026118 Ga0207675_100004275 Ga0207675_1000042759 449
64 3300028380 Ga0268265_10002069 Ga0268265_100020694 449
65 3300042461 Ga0439460_0000680 Ga0439460_0000680_3219_4571 449
66 3300005330 Ga0070690_100000821 Ga0070690_1000008215 450
67 3300005334 Ga0068869_100000793 Ga0068869_10000079315 450
68 3300005336 Ga0070680_100000848 Ga0070680_10000084810 450
69 3300005337 Ga0070682_100002531 Ga0070682_1000025317 450
70 3300005338 Ga0068868_100010696 Ga0068868_1000106965 450
71 3300005341 Ga0070691_10000265 Ga0070691_100002655 450
72 3300005343 Ga0070687_100000208 Ga0070687_10000020810 450
73 3300005438 Ga0070701_10001391 Ga0070701_100013913 450
74 3300005441 Ga0070700_100001676 Ga0070700_1000016765 450
75 3300005444 Ga0070694_100001476 Ga0070694_1000014766 450
76 3300005458 Ga0070681_10039128 Ga0070681_100391286 450
77 3300005459 Ga0068867_100000914 Ga0068867_10000091413 450
78 3300005530 Ga0070679_100016251 Ga0070679_1000162517 450
79 3300005544 Ga0070686_100001775 Ga0070686_1000017758 450
80 3300005545 Ga0070695_100000546 Ga0070695_10000054619 450
81 3300005547 Ga0070693_100000463 Ga0070693_1000004636 450
82 3300005549 Ga0070704_100000523 Ga0070704_1000005233 450
83 3300005563 Ga0068855_100072500 Ga0068855_1000725002 450
84 3300005578 Ga0068854_100008871 Ga0068854_1000088714 450
85 3300005614 Ga0068856_100012529 Ga0068856_1000125293 450
86 3300005617 Ga0068859_100001632 Ga0068859_10000163216 450
87 3300005718 Ga0068866_10000096 Ga0068866_1000009640 450
88 3300005840 Ga0068870_10051988 Ga0068870_100519882 450
89 3300005843 Ga0068860_100011015 Ga0068860_1000110151 450
90 3300005844 Ga0068862_100000705 Ga0068862_10000070530 450
91 3300006237 Ga0097621_100002758 Ga0097621_1000027586 450
92 3300006881 Ga0068865_100003349 Ga0068865_1000033493 450
93 3300006931 Ga0097620_100001632 Ga0097620_10000163212 450
94 3300009098 Ga0105245_10000086 Ga0105245_1000008611 450
95 3300009148 Ga0105243_10001549 Ga0105243_100015499 450
96 3300009174 Ga0105241_10013200 Ga0105241_100132002 450
97 3300009177 Ga0105248_10046313 Ga0105248_100463132 450
98 3300009553 Ga0105249_10003354 Ga0105249_100033548 450
99 3300013297 Ga0157378_10001676 Ga0157378_100016769 450
100 3300013308 Ga0157375_10048409 Ga0157375_100484093 450
101 3300014969 Ga0157376_10001287 Ga0157376_100012875 450
102 3300025885 Ga0207653_10004329 Ga0207653_100043294 450
103 3300025911 Ga0207654_10010610 Ga0207654_100106103 450
104 3300025917 Ga0207660_10001397 Ga0207660_100013976 450
105 3300025918 Ga0207662_10000360 Ga0207662_1000036010 450
106 3300025921 Ga0207652_10031077 Ga0207652_100310774 450
107 3300025927 Ga0207687_10002515 Ga0207687_100025152 450
108 3300025938 Ga0207704_10000193 Ga0207704_1000019338 450
109 3300025942 Ga0207689_10000653 Ga0207689_100006539 450
110 3300025949 Ga0207667_10003225 Ga0207667_1000322511 450
111 3300025961 Ga0207712_10007290 Ga0207712_100072902 450
112 3300026023 Ga0207677_10002512 Ga0207677_100025124 450
113 3300026035 Ga0207703_10019873 Ga0207703_100198731 450
114 3300026075 Ga0207708_10000664 Ga0207708_1000066416 450
115 3300026078 Ga0207702_10013359 Ga0207702_100133592 450
116 3300026088 Ga0207641_10129764 Ga0207641_101297643 450
117 3300026089 Ga0207648_10000145 Ga0207648_1000014511 450
118 3300026118 Ga0207675_100003197 Ga0207675_1000031974 450
119 3300028380 Ga0268265_10001398 Ga0268265_1000139813 450
120 3300028381 Ga0268264_10003041 Ga0268264_100030419 450
121 3300005338 Ga0068868_100077292 Ga0068868_1000772922 452
122 3300035113 Ga0373936_0011550 Ga0373936_0011550_136_1539 452
123 3300035170 Ga0373943_0001695 Ga0373943_0001695_5895_7298 452
124 3300035692 Ga0373935_0046938 Ga0373935_0046938_309_1712 452
125 3300035725 Ga0373947_0014482 Ga0373947_0014482_2810_4213 452
126 3300037068 Ga0373925_0004375 Ga0373925_0004375_3579_4982 452
127 3300050509 nmdc:mga0qj67_13493_c1 nmdc:mga0qj67_13493_c1_1043_2437 452
128 3300005618 Ga0068864_100047010 Ga0068864_1000470103 453
129 3300005843 Ga0068860_100184020 Ga0068860_1001840202 453
130 3300006871 Ga0075434_100006459 Ga0075434_1000064597 453
131 3300009094 Ga0111539_10014995 Ga0111539_100149953 453
132 3300050512 nmdc:mga0n895_34638_c1 nmdc:mga0n895_34638_c1_14_1414 453
133 3300050514 nmdc:mga08x19_68942_c1 nmdc:mga08x19_68942_c1_49_1449 453
134 3300050515 nmdc:mga0a205_907_c1 nmdc:mga0a205_907_c1_3450_4850 453
135 3300005331 Ga0070670_100132299 Ga0070670_1001322992 454
136 3300005333 Ga0070677_10002468 Ga0070677_100024681 454
137 3300005333 Ga0070677_10002894 Ga0070677_100028943 454
138 3300005335 Ga0070666_10003005 Ga0070666_100030053 454
139 3300005343 Ga0070687_100010147 Ga0070687_1000101472 454
140 3300005347 Ga0070668_100000930 Ga0070668_1000009307 454
141 3300005353 Ga0070669_100005308 Ga0070669_1000053085 454
142 3300005353 Ga0070669_100013742 Ga0070669_1000137421 454
143 3300005353 Ga0070669_100140328 Ga0070669_1001403281 454
144 3300005354 Ga0070675_100023304 Ga0070675_1000233043 454
145 3300005354 Ga0070675_100151540 Ga0070675_1001515402 454
146 3300005355 Ga0070671_100011800 Ga0070671_1000118002 454
147 3300005356 Ga0070674_100001080 Ga0070674_10000108016 454
148 3300005356 Ga0070674_100001586 Ga0070674_1000015865 454
149 3300005367 Ga0070667_100028097 Ga0070667_1000280973 454
150 3300005441 Ga0070700_100020077 Ga0070700_1000200772 454
151 3300005459 Ga0068867_100002009 Ga0068867_10000200916 454
152 3300005459 Ga0068867_100021401 Ga0068867_1000214013 454
153 3300005543 Ga0070672_100003911 Ga0070672_1000039116 454
154 3300005543 Ga0070672_100053531 Ga0070672_1000535314 454
155 3300005616 Ga0068852_100058280 Ga0068852_1000582803 454
156 3300005618 Ga0068864_100081962 Ga0068864_1000819622 454
157 3300005718 Ga0068866_10021117 Ga0068866_100211172 454
158 3300005719 Ga0068861_100002848 Ga0068861_1000028483 454
159 3300005719 Ga0068861_100034549 Ga0068861_1000345491 454
160 3300005840 Ga0068870_10048693 Ga0068870_100486931 454
161 3300005841 Ga0068863_100004763 Ga0068863_1000047639 454
162 3300005842 Ga0068858_100001587 Ga0068858_10000158710 454
163 3300005843 Ga0068860_100001404 Ga0068860_1000014046 454
164 3300006195 Ga0075366_10062944 Ga0075366_100629441 454
165 3300006237 Ga0097621_100014240 Ga0097621_1000142407 454
166 3300006881 Ga0068865_100007073 Ga0068865_1000070733 454
167 3300009148 Ga0105243_10016015 Ga0105243_100160155 454
168 3300009176 Ga0105242_10006900 Ga0105242_100069007 454
169 3300009177 Ga0105248_10028359 Ga0105248_100283593 454
170 3300009553 Ga0105249_10002073 Ga0105249_1000207318 454
171 3300013297 Ga0157378_10145750 Ga0157378_101457501 454
172 3300013306 Ga0163162_10034076 Ga0163162_100340764 454
173 3300013308 Ga0157375_10005685 Ga0157375_100056852 454
174 3300013308 Ga0157375_10018432 Ga0157375_100184325 454
175 3300014326 Ga0157380_10000812 Ga0157380_100008124 454
176 3300014968 Ga0157379_10011235 Ga0157379_100112356 454
177 3300017792 Ga0163161_10003077 Ga0163161_100030772 454
178 3300017792 Ga0163161_10012183 Ga0163161_100121834 454
179 3300025893 Ga0207682_10012782 Ga0207682_100127823 454
180 3300025893 Ga0207682_10014988 Ga0207682_100149883 454
181 3300025899 Ga0207642_10005182 Ga0207642_100051821 454
182 3300025903 Ga0207680_10000938 Ga0207680_1000093811 454
183 3300025907 Ga0207645_10002283 Ga0207645_100022834 454
184 3300025908 Ga0207643_10050666 Ga0207643_100506661 454
185 3300025923 Ga0207681_10001540 Ga0207681_100015409 454
186 3300025925 Ga0207650_10001219 Ga0207650_100012192 454
187 3300025926 Ga0207659_10000680 Ga0207659_100006801 454
188 3300025926 Ga0207659_10005695 Ga0207659_100056953 454
189 3300025927 Ga0207687_10031706 Ga0207687_100317063 454
190 3300025931 Ga0207644_10078924 Ga0207644_100789242 454
191 3300025933 Ga0207706_10000654 Ga0207706_1000065414 454
192 3300025934 Ga0207686_10017500 Ga0207686_100175002 454
193 3300025935 Ga0207709_10008516 Ga0207709_100085162 454
194 3300025937 Ga0207669_10004723 Ga0207669_100047233 454
195 3300025937 Ga0207669_10015581 Ga0207669_100155812 454
196 3300025938 Ga0207704_10007899 Ga0207704_100078992 454
197 3300025940 Ga0207691_10000049 Ga0207691_1000004984 454
198 3300025940 Ga0207691_10001712 Ga0207691_1000171214 454
199 3300025940 Ga0207691_10068920 Ga0207691_100689204 454
200 3300025941 Ga0207711_10013423 Ga0207711_100134232 454
201 3300025942 Ga0207689_10009925 Ga0207689_100099253 454
202 3300025960 Ga0207651_10001254 Ga0207651_100012542 454
203 3300025960 Ga0207651_10094277 Ga0207651_100942771 454
204 3300025961 Ga0207712_10003982 Ga0207712_100039825 454
205 3300025972 Ga0207668_10015198 Ga0207668_100151983 454
206 3300025986 Ga0207658_10002782 Ga0207658_100027828 454
207 3300025986 Ga0207658_10044400 Ga0207658_100444003 454
208 3300026035 Ga0207703_10002550 Ga0207703_100025505 454
209 3300026088 Ga0207641_10003372 Ga0207641_100033724 454
210 3300026089 Ga0207648_10000701 Ga0207648_100007012 454
211 3300026089 Ga0207648_10031573 Ga0207648_100315733 454
212 3300026118 Ga0207675_100000868 Ga0207675_10000086815 454
213 3300026118 Ga0207675_100107135 Ga0207675_1001071352 454
214 3300026121 Ga0207683_10000610 Ga0207683_1000061036 454
215 3300026142 Ga0207698_10094549 Ga0207698_100945492 454
216 3300028381 Ga0268264_10001193 Ga0268264_100011936 454
217 3300031852 Ga0307410_10179305 Ga0307410_101793051 454
218 3300041407 Ga0439447_019952 Ga0439447_019952_294_1667 454
219 3300046522 Ga0495643_0043201 Ga0495643_0043201_539_1912 454
220 3300046525 Ga0495663_0005029 Ga0495663_0005029_2094_3467 454
221 3300005842 Ga0068858_100136379 Ga0068858_1001363792 455
222 3300049575 Ga0501039_0007025 Ga0501039_0007025_2436_3806 455
223 3300049576 Ga0501040_0019093 Ga0501040_0019093_594_1964 455
224 3300049577 Ga0501041_0004007 Ga0501041_0004007_267_1637 455
225 3300049582 Ga0501048_0009796 Ga0501048_0009796_3519_4889 455
226 3300049591 Ga0501075_0001763 Ga0501075_0001763_10098_11468 455
227 3300049592 Ga0501076_0001441 Ga0501076_0001441_12659_14029 455
228 3300049741 Ga0501079_0007020 Ga0501079_0007020_6124_7494 455
229 3300049742 Ga0501080_0006492 Ga0501080_0006492_3745_5115 455
230 3300061734 Ga0530510_0000558 Ga0530510_0000558_6538_7908 455
231 3300006914 Ga0075436_100000888 Ga0075436_1000008884 456
232 3300007076 Ga0075435_100006886 Ga0075435_1000068868 456
233 3300034957 Ga0373938_0001962 Ga0373938_0001962_102_1514 457
234 3300005440 Ga0070705_100088175 Ga0070705_1000881752 459
235 3300006871 Ga0075434_100220729 Ga0075434_1002207292 459
236 3300006914 Ga0075436_100021203 Ga0075436_1000212032 459
237 3300050512 nmdc:mga0n895_138320_c1 nmdc:mga0n895_138320_c1_380_1759 459
238 3300050514 nmdc:mga08x19_31174_c1 nmdc:mga08x19_31174_c1_1477_2856 459
239 3300042435 Ga0439434_0000014 Ga0439434_0000014_27429_28874 462
240 3300042436 Ga0439435_0000015 Ga0439435_0000015_12019_13464 462
241 3300049743 Ga0501081_0052870 Ga0501081_0052870_1356_2744 462
242 3300027876 Ga0209974_10008285 Ga0209974_100082851 467
243 3300014968 Ga0157379_10148606 Ga0157379_101486061 468
244 3300049584 Ga0501068_0015990 Ga0501068_0015990_2624_4102 475
245 3300049589 Ga0501073_0029253 Ga0501073_0029253_1900_3378 475
246 3300049741 Ga0501079_0073265 Ga0501079_0073265_658_2136 475
247 3300049742 Ga0501080_0094997 Ga0501080_0094997_600_2078 475
248 3300049587 Ga0501071_0034763 Ga0501071_0034763_207_1637 476
249 3300049588 Ga0501072_0105573 Ga0501072_0105573_350_1780 476
250 3300049591 Ga0501075_0007485 Ga0501075_0007485_1553_2983 476
251 3300049741 Ga0501079_0014891 Ga0501079_0014891_2578_4008 476
252 3300049742 Ga0501080_0004409 Ga0501080_0004409_2065_3495 476
253 3300025912 Ga0207707_10085268 Ga0207707_100852681 477
254 3300049577 Ga0501041_0034690 Ga0501041_0034690_451_1926 477
255 3300049578 Ga0501042_0063374 Ga0501042_0063374_320_1795 477
256 3300049584 Ga0501068_0025420 Ga0501068_0025420_753_2228 477
257 3300049587 Ga0501071_0040790 Ga0501071_0040790_1622_3097 477
258 3300049591 Ga0501075_0002598 Ga0501075_0002598_9450_10925 477
259 3300049592 Ga0501076_0015573 Ga0501076_0015573_3192_4667 477
260 3300049741 Ga0501079_0016202 Ga0501079_0016202_374_1849 477
261 3300049742 Ga0501080_0021797 Ga0501080_0021797_3872_5347 477
262 3300049743 Ga0501081_0003465 Ga0501081_0003465_1064_2539 477
263 3300060353 Ga0501082_0030231 Ga0501082_0030231_665_2140 477
264 3300061734 Ga0530510_0060006 Ga0530510_0060006_201_1676 477
265 3300005347 Ga0070668_100007219 Ga0070668_1000072196 479
266 3300005844 Ga0068862_100023060 Ga0068862_1000230603 479
267 3300025972 Ga0207668_10020829 Ga0207668_100208293 479
268 3300028380 Ga0268265_10034316 Ga0268265_100343163 479
269 3300042461 Ga0439460_0008952 Ga0439460_0008952_380_1861 479
270 3300042876 Ga0451577_0211946 Ga0451577_0211946_259_1740 479
271 3300048911 Ga0496108_0027225 Ga0496108_0027225_697_2289 480
272 3300048912 Ga0496109_0075585 Ga0496109_0075585_844_2436 480
273 3300048917 Ga0496114_0017259 Ga0496114_0017259_1616_3208 480
274 3300049571 Ga0501034_0101397 Ga0501034_0101397_1199_2674 480
275 3300049573 Ga0501037_0014666 Ga0501037_0014666_374_1849 480
276 3300049573 Ga0501037_0071099 Ga0501037_0071099_929_2422 480
277 3300049584 Ga0501068_0017483 Ga0501068_0017483_102_1577 480
278 3300049585 Ga0501069_0065908 Ga0501069_0065908_396_1871 480
279 3300049823 Ga0501044_0061488 Ga0501044_0061488_1436_2911 480
280 3300054114 Ga0501084_0087260 Ga0501084_0087260_517_1992 480
281 3300060353 Ga0501082_0036868 Ga0501082_0036868_2139_3614 480
282 3300005518 Ga0070699_100111193 Ga0070699_1001111932 485
283 3300049569 Ga0501032_0063214 Ga0501032_0063214_374_1852 485
284 3300049579 Ga0501043_0028639 Ga0501043_0028639_915_2393 485
285 3300049581 Ga0501047_0001237 Ga0501047_0001237_16968_18446 485
286 3300009553 Ga0105249_10200511 Ga0105249_102005112 486
287 3300026088 Ga0207641_10006912 Ga0207641_100069128 486
288 3300049576 Ga0501040_0036564 Ga0501040_0036564_1500_2966 486
289 3300049578 Ga0501042_0009521 Ga0501042_0009521_2472_3938 486
290 3300049584 Ga0501068_0041545 Ga0501068_0041545_243_1709 486
291 3300049592 Ga0501076_0175169 Ga0501076_0175169_40_1506 486
292 3300049593 Ga0501077_0045445 Ga0501077_0045445_1257_2723 486
293 3300049741 Ga0501079_0040734 Ga0501079_0040734_2036_3502 486
294 3300049742 Ga0501080_0010958 Ga0501080_0010958_4242_5708 486
295 3300049743 Ga0501081_0013873 Ga0501081_0013873_41_1507 486
296 3300049743 Ga0501081_0064077 Ga0501081_0064077_1058_2524 486
297 3300060353 Ga0501082_0006838 Ga0501082_0006838_2529_3995 486
298 3300006844 Ga0075428_100063500 Ga0075428_1000635002 487
299 3300006852 Ga0075433_10003943 Ga0075433_100039437 487
300 3300006871 Ga0075434_100083778 Ga0075434_1000837783 487
301 3300009094 Ga0111539_10000511 Ga0111539_1000051117 487
302 3300009094 Ga0111539_10071034 Ga0111539_100710342 487
303 3300009147 Ga0114129_10274767 Ga0114129_102747672 487
304 3300026116 Ga0207674_10181842 Ga0207674_101818422 487
305 3300027907 Ga0207428_10018349 Ga0207428_100183492 487
306 3300049576 Ga0501040_0054398 Ga0501040_0054398_213_1682 487
307 3300049584 Ga0501068_0015552 Ga0501068_0015552_524_1996 487
308 3300049587 Ga0501071_0038214 Ga0501071_0038214_1147_2619 487
309 3300049588 Ga0501072_0038819 Ga0501072_0038819_1494_2963 487
310 3300049592 Ga0501076_0088757 Ga0501076_0088757_142_1611 487
311 3300049743 Ga0501081_0026741 Ga0501081_0026741_887_2356 487
312 3300050511 nmdc:mga08y16_28803_c1 nmdc:mga08y16_28803_c1_1089_2561 487
313 3300050512 nmdc:mga0n895_744_c1 nmdc:mga0n895_744_c1_2162_3634 487
314 3300050513 nmdc:mga0rr50_7835_c1 nmdc:mga0rr50_7835_c1_132_1604 487
315 3300050515 nmdc:mga0a205_103_c1 nmdc:mga0a205_103_c1_20299_21771 487
316 3300060353 Ga0501082_0168726 Ga0501082_0168726_276_1745 487
317 3300005435 Ga0070714_100006810 Ga0070714_1000068104 488
318 3300013104 Ga0157370_10007039 Ga0157370_100070399 488
319 3300025929 Ga0207664_10015573 Ga0207664_100155732 488
320 3300048912 Ga0496109_0131950 Ga0496109_0131950_633_2114 488
321 3300049569 Ga0501032_0015971 Ga0501032_0015971_107_1591 488
322 3300049570 Ga0501033_0000063 Ga0501033_0000063_77109_78593 488
323 3300049570 Ga0501033_0004916 Ga0501033_0004916_6562_8046 488
324 3300049571 Ga0501034_0011311 Ga0501034_0011311_3883_5367 488
325 3300049572 Ga0501036_0020791 Ga0501036_0020791_2690_4174 488
326 3300049574 Ga0501038_0009140 Ga0501038_0009140_7403_8887 488
327 3300049574 Ga0501038_0062146 Ga0501038_0062146_699_2183 488
328 3300049579 Ga0501043_0015042 Ga0501043_0015042_4576_6042 488
329 3300049579 Ga0501043_0060484 Ga0501043_0060484_1299_2783 488
330 3300049581 Ga0501047_0036841 Ga0501047_0036841_2916_4400 488
331 3300049582 Ga0501048_0002654 Ga0501048_0002654_9252_10736 488
332 3300049584 Ga0501068_0001065 Ga0501068_0001065_8220_9704 488
333 3300049822 Ga0501035_0000465 Ga0501035_0000465_679_2163 488
334 3300049822 Ga0501035_0008116 Ga0501035_0008116_5415_6899 488
335 3300049822 Ga0501035_0115011 Ga0501035_0115011_143_1627 488
336 3300049823 Ga0501044_0084951 Ga0501044_0084951_1539_3023 488
337 3300049823 Ga0501044_0174776 Ga0501044_0174776_277_1761 488
338 3300049578 Ga0501042_0094783 Ga0501042_0094783_621_2099 489
339 3300049743 Ga0501081_0007062 Ga0501081_0007062_1423_2901 489
340 3300006847 Ga0075431_100043332 Ga0075431_1000433325 490
341 3300009148 Ga0105243_10041362 Ga0105243_100413623 490
342 3300009176 Ga0105242_10066496 Ga0105242_100664962 490
343 3300014326 Ga0157380_10000866 Ga0157380_1000086613 490
344 3300026075 Ga0207708_10027481 Ga0207708_100274811 490
345 3300027617 Ga0210002_1002389 Ga0210002_10023892 490
346 3300027682 Ga0209971_1012373 Ga0209971_10123732 490
347 3300031548 Ga0307408_100026481 Ga0307408_1000264813 490
348 3300031731 Ga0307405_10006024 Ga0307405_100060241 490
349 3300031852 Ga0307410_10018226 Ga0307410_100182262 490
350 3300031901 Ga0307406_10015058 Ga0307406_100150582 490
351 3300031903 Ga0307407_10073916 Ga0307407_100739162 490
352 3300031911 Ga0307412_10036385 Ga0307412_100363853 490
353 3300032002 Ga0307416_100001308 Ga0307416_1000013082 490
354 3300032005 Ga0307411_10068861 Ga0307411_100688612 490
355 3300042122 Ga0450920_004026 Ga0450920_004026_176_1657 490
356 3300042125 Ga0450923_003606 Ga0450923_003606_82_1563 490
357 3300042156 Ga0439446_0000329 Ga0439446_0000329_3477_4958 490
358 3300042156 Ga0439446_0007754 Ga0439446_0007754_591_2072 490
359 3300042184 Ga0450908_001096 Ga0450908_001096_1987_3468 490
360 3300042437 Ga0439444_0000344 Ga0439444_0000344_2271_3752 490
361 3300049568 Ga0501031_0006946 Ga0501031_0006946_1641_3122 490
362 3300049569 Ga0501032_0065106 Ga0501032_0065106_24_1496 490
363 3300049571 Ga0501034_0003919 Ga0501034_0003919_5398_6870 490
364 3300049572 Ga0501036_0003793 Ga0501036_0003793_6847_8328 490
365 3300049572 Ga0501036_0030268 Ga0501036_0030268_1271_2746 490
366 3300049574 Ga0501038_0058000 Ga0501038_0058000_1079_2560 490
367 3300049575 Ga0501039_0109910 Ga0501039_0109910_32_1513 490
368 3300049575 Ga0501039_0138576 Ga0501039_0138576_96_1568 490
369 3300049576 Ga0501040_0013563 Ga0501040_0013563_993_2474 490
370 3300049577 Ga0501041_0046424 Ga0501041_0046424_1047_2528 490
371 3300049578 Ga0501042_0001286 Ga0501042_0001286_2701_4182 490
372 3300049582 Ga0501048_0014823 Ga0501048_0014823_1938_3419 490
373 3300049584 Ga0501068_0001308 Ga0501068_0001308_6811_8283 490
374 3300049584 Ga0501068_0066961 Ga0501068_0066961_68_1549 490
375 3300049586 Ga0501070_0050479 Ga0501070_0050479_1860_3332 490
376 3300049587 Ga0501071_0025721 Ga0501071_0025721_2589_4070 490
377 3300049588 Ga0501072_0014907 Ga0501072_0014907_2970_4442 490
378 3300049590 Ga0501074_0019582 Ga0501074_0019582_179_1651 490
379 3300049590 Ga0501074_0120151 Ga0501074_0120151_274_1749 490
380 3300049591 Ga0501075_0001848 Ga0501075_0001848_16_1491 490
381 3300049592 Ga0501076_0000216 Ga0501076_0000216_1867_3342 490
382 3300049592 Ga0501076_0004879 Ga0501076_0004879_1837_3318 490
383 3300049741 Ga0501079_0012484 Ga0501079_0012484_2939_4414 490
384 3300049742 Ga0501080_0004357 Ga0501080_0004357_4619_6091 490
385 3300049742 Ga0501080_0005976 Ga0501080_0005976_5308_6783 490
386 3300049743 Ga0501081_0013127 Ga0501081_0013127_2140_3621 490
387 3300049744 Ga0501083_0034078 Ga0501083_0034078_69_1541 490
388 3300049824 Ga0501045_0018482 Ga0501045_0018482_1819_3294 490
389 3300050510 nmdc:mga06r32_37691_c1 nmdc:mga06r32_37691_c1_239_1777 490
390 3300054114 Ga0501084_0007322 Ga0501084_0007322_5430_6905 490
391 3300060353 Ga0501082_0026121 Ga0501082_0026121_3169_4650 490
392 3300060353 Ga0501082_0027719 Ga0501082_0027719_2993_4468 490
393 3300061734 Ga0530510_0009224 Ga0530510_0009224_2447_3922 490
394 3300005290 Ga0065712_10004448 Ga0065712_100044482 491
395 3300005293 Ga0065715_10010134 Ga0065715_100101342 491
396 3300005295 Ga0065707_10001376 Ga0065707_100013766 491
397 3300005331 Ga0070670_100002109 Ga0070670_1000021097 491
398 3300005336 Ga0070680_100007079 Ga0070680_1000070795 491
399 3300005341 Ga0070691_10053427 Ga0070691_100534271 491
400 3300005344 Ga0070661_100018968 Ga0070661_1000189684 491
401 3300005440 Ga0070705_100010613 Ga0070705_1000106132 491
402 3300005456 Ga0070678_100135775 Ga0070678_1001357752 491
403 3300005457 Ga0070662_100060891 Ga0070662_1000608913 491
404 3300005458 Ga0070681_10014537 Ga0070681_100145377 491
405 3300005536 Ga0070697_100117825 Ga0070697_1001178252 491
406 3300005539 Ga0068853_100038138 Ga0068853_1000381381 491
407 3300005546 Ga0070696_100132364 Ga0070696_1001323642 491
408 3300005563 Ga0068855_100024210 Ga0068855_1000242106 491
409 3300005564 Ga0070664_100046359 Ga0070664_1000463593 491
410 3300005577 Ga0068857_100149398 Ga0068857_1001493982 491
411 3300005618 Ga0068864_100109931 Ga0068864_1001099312 491
412 3300005937 Ga0081455_10000626 Ga0081455_1000062613 491
413 3300005981 Ga0081538_10051664 Ga0081538_100516642 491
414 3300005981 Ga0081538_10075547 Ga0081538_100755472 491
415 3300006844 Ga0075428_100015084 Ga0075428_1000150845 491
416 3300006846 Ga0075430_100032243 Ga0075430_1000322433 491
417 3300006846 Ga0075430_100141001 Ga0075430_1001410011 491
418 3300006847 Ga0075431_100006973 Ga0075431_1000069734 491
419 3300006847 Ga0075431_100016079 Ga0075431_1000160795 491
420 3300006852 Ga0075433_10085086 Ga0075433_100850862 491
421 3300006871 Ga0075434_100036873 Ga0075434_1000368731 491
422 3300006880 Ga0075429_100000151 Ga0075429_10000015123 491
423 3300006880 Ga0075429_100045942 Ga0075429_1000459425 491
424 3300007076 Ga0075435_100035493 Ga0075435_1000354933 491
425 3300009094 Ga0111539_10117470 Ga0111539_101174702 491
426 3300009098 Ga0105245_10218808 Ga0105245_102188082 491
427 3300009147 Ga0114129_10007243 Ga0114129_100072432 491
428 3300009147 Ga0114129_10008130 Ga0114129_100081308 491
429 3300009147 Ga0114129_10059248 Ga0114129_100592486 491
430 3300010375 Ga0105239_10033680 Ga0105239_100336804 491
431 3300013296 Ga0157374_10048803 Ga0157374_100488032 491
432 3300013306 Ga0163162_10195641 Ga0163162_101956412 491
433 3300014969 Ga0157376_10024468 Ga0157376_100244682 491
434 3300025315 Ga0207697_10007970 Ga0207697_100079704 491
435 3300025885 Ga0207653_10018942 Ga0207653_100189422 491
436 3300025901 Ga0207688_10022220 Ga0207688_100222204 491
437 3300025907 Ga0207645_10001987 Ga0207645_100019878 491
438 3300025910 Ga0207684_10164979 Ga0207684_101649792 491
439 3300025910 Ga0207684_10193044 Ga0207684_101930442 491
440 3300025923 Ga0207681_10058503 Ga0207681_100585032 491
441 3300025925 Ga0207650_10000597 Ga0207650_1000059717 491
442 3300025933 Ga0207706_10038064 Ga0207706_100380642 491
443 3300025945 Ga0207679_10004574 Ga0207679_100045747 491
444 3300026075 Ga0207708_10098317 Ga0207708_100983172 491
445 3300026121 Ga0207683_10244411 Ga0207683_102444111 491
446 3300031548 Ga0307408_100025150 Ga0307408_1000251502 491
447 3300031824 Ga0307413_10000725 Ga0307413_100007254 491
448 3300031852 Ga0307410_10003182 Ga0307410_100031826 491
449 3300031903 Ga0307407_10012312 Ga0307407_100123123 491
450 3300031995 Ga0307409_100015091 Ga0307409_1000150914 491
451 3300032002 Ga0307416_100053481 Ga0307416_1000534811 491
452 3300032126 Ga0307415_100002224 Ga0307415_1000022245 491
453 3300035115 Ga0373941_0006689 Ga0373941_0006689_515_1990 491
454 3300035242 Ga0373962_0013512 Ga0373962_0013512_580_2055 491
455 3300035725 Ga0373947_0069034 Ga0373947_0069034_432_1907 491
456 3300048909 Ga0496106_0066387 Ga0496106_0066387_1071_2546 491
457 3300048915 Ga0496112_0032572 Ga0496112_0032572_3197_4672 491
458 3300049570 Ga0501033_0058037 Ga0501033_0058037_1010_2485 491
459 3300049572 Ga0501036_0033547 Ga0501036_0033547_62_1537 491
460 3300049573 Ga0501037_0069977 Ga0501037_0069977_749_2224 491
461 3300049574 Ga0501038_0030535 Ga0501038_0030535_2101_3576 491
462 3300049575 Ga0501039_0016691 Ga0501039_0016691_3035_4510 491
463 3300049576 Ga0501040_0008812 Ga0501040_0008812_2982_4457 491
464 3300049576 Ga0501040_0071401 Ga0501040_0071401_473_1948 491
465 3300049577 Ga0501041_0001490 Ga0501041_0001490_10407_11882 491
466 3300049578 Ga0501042_0000787 Ga0501042_0000787_14072_15547 491
467 3300049580 Ga0501046_0064140 Ga0501046_0064140_357_1832 491
468 3300049582 Ga0501048_0030555 Ga0501048_0030555_2087_3562 491
469 3300049588 Ga0501072_0012106 Ga0501072_0012106_2104_3579 491
470 3300049590 Ga0501074_0032259 Ga0501074_0032259_741_2216 491
471 3300049591 Ga0501075_0022820 Ga0501075_0022820_2092_3567 491
472 3300049592 Ga0501076_0000866 Ga0501076_0000866_10013_11488 491
473 3300049593 Ga0501077_0029068 Ga0501077_0029068_983_2458 491
474 3300049741 Ga0501079_0001260 Ga0501079_0001260_2107_3582 491
475 3300049743 Ga0501081_0008725 Ga0501081_0008725_3020_4495 491
476 3300049743 Ga0501081_0111668 Ga0501081_0111668_36_1511 491
477 3300049744 Ga0501083_0029000 Ga0501083_0029000_1296_2771 491
478 3300049822 Ga0501035_0052227 Ga0501035_0052227_960_2435 491
479 3300049824 Ga0501045_0010055 Ga0501045_0010055_2090_3565 491
480 3300050507 nmdc:mga05p37_44094_c1 nmdc:mga05p37_44094_c1_2740_4215 491
481 3300050507 nmdc:mga05p37_5572_c1 nmdc:mga05p37_5572_c1_8969_10444 491
482 3300050507 nmdc:mga05p37_7988_c1 nmdc:mga05p37_7988_c1_8377_9852 491
483 3300050507 nmdc:mga05p37_840_c1 nmdc:mga05p37_840_c1_13431_14906 491
484 3300050508 nmdc:mga09592_14784_c1 nmdc:mga09592_14784_c1_1264_2739 491
485 3300050508 nmdc:mga09592_149623_c1 nmdc:mga09592_149623_c1_148_1623 491
486 3300050508 nmdc:mga09592_5_c1 nmdc:mga09592_5_c1_42701_44176 491
487 3300050509 nmdc:mga0qj67_43967_c1 nmdc:mga0qj67_43967_c1_929_2404 491
488 3300050510 nmdc:mga06r32_21338_c1 nmdc:mga06r32_21338_c1_3648_5123 491
489 3300050510 nmdc:mga06r32_36089_c1 nmdc:mga06r32_36089_c1_2647_4122 491
490 3300050510 nmdc:mga06r32_88216_c1 nmdc:mga06r32_88216_c1_387_1862 491
491 3300050511 nmdc:mga08y16_51934_c1 nmdc:mga08y16_51934_c1_846_2321 491
492 3300050512 nmdc:mga0n895_78424_c1 nmdc:mga0n895_78424_c1_1325_2800 491
493 3300050515 nmdc:mga0a205_133973_c1 nmdc:mga0a205_133973_c1_451_1926 491
494 3300050515 nmdc:mga0a205_45254_c1 nmdc:mga0a205_45254_c1_2065_3540 491
495 3300054114 Ga0501084_0014078 Ga0501084_0014078_3053_4528 491
496 3300060353 Ga0501082_0029533 Ga0501082_0029533_2190_3665 491
497 3300061734 Ga0530510_0001122 Ga0530510_0001122_14226_15701 491

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

151

473

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.6708 109 438
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.6583 109 438
7osv-assembly1.cif.gz_A denovotim6-sb, a de novo designed tim barrel with a salt-bridge cluster (crystal form 1) 0.6232 170 387
3pnu-assembly1.cif.gz_A 2.4 angstrom crystal structure of dihydroorotase (pyrc) from campylobacter jejuni. 0.5951 108 440
7ca0-assembly1.cif.gz_A crystal structure of dihydroorotase in complex with 5-fluoroorotic acid from saccharomyces cerevisiae 0.5938 108 444
ID Description Score Start End Superfamily
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7097 110 438 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7089 123 439 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7066 123 439 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6942 110 438 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.604 111 440 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2D4TD23-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9779 335 433
AF-A9G961-F1-model_v4 Twin-arginine translocation signal domain-containing protein 0.9751 10 73
AF-A0A3B8Z4A5-F1-model_v4 Amidohydrolase 0.9571 6 100 GO:0016787
AF-A0A2S6R215-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9505 1 416 GO:0016787
AF-A0A1G5TJE2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9492 6 482 GO:0016787

Feature Viewer

pLDDT pTM Quality
81.86 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map