F455081

General Info

Members Datasets Scaffolds Average Seq Length
497 257 476 246

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0249081|Ga0495618_0249081_226_1086
Length 286
Sequence VKKKIEKIKVTEQGNVPKVSPPKAEDLEGAGAEGAIDINCDMGEAIGNPALPAGRDEMIMSFISSANIACGYHAGNETIIRQTIQLAQKNNVAVGAHPSFFDKENFGRTEVNLPADEIYDIIILQLRLIKKIAKQQHAKLHHVKPHGALYNMSGKDPIIANAIANAVKDFDEDLILFGLSGSHSIKEAGLLNLKTASEVFADRTYQDDGSLTPRSQTNALIEDPAKSVIQALQMIKEGTVTSVNGNKISITADTVCIHGDGKNAIEFAKAIHEALQKEGFKIKAAE

Samples

Sample ID Description Type Environment
1 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
2 2643221732 Bacillus sp. Root239 Isolate Unclassified
3 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
4 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
5 2842882022 Bacillus sp. R-71893 Isolate Unclassified
6 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
7 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
8 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
9 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
10 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
11 2919720352 Priestia megaterium 4340 Isolate Unclassified
12 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
13 2929004312 Priestia megaterium 1104 Isolate Unclassified
14 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
15 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
16 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
17 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
243 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
244 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 8022792930 Bacillus sp. Xin Isolate Rhizosphere
255 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
256 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
257 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.77
Metatranscriptomes 0
Isolates 4.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 4.23
Rhizosphere 83.7
Stem 0
Stem Tuber 0
Unclassified 6.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001420 3300003187 Bacteria 16379
2 JGI25151J46595_10002119 3300003187 Bacteria 12377
3 rootH2_10024155 3300003320 Bacteria 19843
4 rootH2_10319767 3300003320 Bacteria 1494
5 rootL2_10094034 3300003322 Bacteria 2936
6 rootL2_10108260 3300003322 Unclassified 2349
7 rootH1_10017103 3300003323 Bacteria 28716
8 rootH1_10035991 3300003323 Bacteria 16103
9 rootH1_10230939 3300003323 Bacteria 2084
10 rootH1_10340350 3300003323 Bacteria 1286
11 Ga0055528_1003292 3300003790 Bacteria 8212
12 Ga0065165_1005778 3300005262 Bacteria 6767
13 Ga0065712_10147099 3300005290 Bacteria 1364
14 Ga0065715_10146333 3300005293 Bacteria 1784
15 Ga0065707_10184777 3300005295 Bacteria 1395
16 Ga0070658_10073431 3300005327 Bacteria 2805
17 Ga0070676_10076056 3300005328 Bacteria 2026
18 Ga0070676_10639609 3300005328 Viruses 771
19 Ga0070683_100001393 3300005329 Bacteria 18553
20 Ga0070683_100050104 3300005329 Bacteria 3864
21 Ga0070683_100322716 3300005329 Bacteria 1470
22 Ga0070690_100134608 3300005330 Bacteria 1672
23 Ga0070670_100054817 3300005331 Bacteria 3423
24 Ga0070670_100621900 3300005331 Unclassified 967
25 Ga0070677_10239442 3300005333 Bacteria 895
26 Ga0068869_100037162 3300005334 Bacteria 3462
27 Ga0068869_100041343 3300005334 Unclassified 3301
28 Ga0070666_10026432 3300005335 Bacteria 3792
29 Ga0070666_10171681 3300005335 Bacteria 1519
30 Ga0070666_10174048 3300005335 Unclassified 1508
31 Ga0070682_100000012 3300005337 Bacteria 265658
32 Ga0070682_100026369 3300005337 Bacteria 3477
33 Ga0070682_100684937 3300005337 Bacteria 820
34 Ga0068868_100004132 3300005338 Bacteria 10146
35 Ga0068868_100005469 3300005338 Bacteria 8930
36 Ga0068868_100056270 3300005338 Bacteria 3106
37 Ga0068868_100094229 3300005338 Unclassified 2415
38 Ga0068868_100099700 3300005338 Bacteria 2350
39 Ga0068868_100228430 3300005338 Bacteria 1560
40 Ga0070660_100005266 3300005339 Bacteria 8945
41 Ga0070660_100191718 3300005339 Unclassified 1656
42 Ga0070689_100038560 3300005340 Unclassified 3656
43 Ga0070689_100079398 3300005340 Bacteria 2574
44 Ga0070689_100172211 3300005340 Bacteria 1754
45 Ga0070661_100000700 3300005344 Bacteria 24597
46 Ga0070661_100003416 3300005344 Bacteria 10966
47 Ga0070661_100350549 3300005344 Bacteria 1158
48 Ga0070668_100016255 3300005347 Bacteria 5566
49 Ga0070669_100007779 3300005353 Bacteria 7656
50 Ga0070675_100018008 3300005354 Bacteria 5622
51 Ga0070675_100019755 3300005354 Bacteria 5372
52 Ga0070675_100248885 3300005354 Unclassified 1555
53 Ga0070671_100007945 3300005355 Bacteria 8484
54 Ga0070671_100013881 3300005355 Bacteria 6498
55 Ga0070671_100041427 3300005355 Unclassified 3827
56 Ga0070674_100008870 3300005356 Bacteria 6003
57 Ga0070673_100019923 3300005364 Bacteria 4828
58 Ga0070673_100035730 3300005364 Unclassified 3770
59 Ga0070673_100085947 3300005364 Bacteria 2562
60 Ga0070673_100090429 3300005364 Bacteria 2500
61 Ga0070688_100015683 3300005365 Bacteria 4318
62 Ga0070659_100009106 3300005366 Bacteria 7281
63 Ga0070659_100032184 3300005366 Bacteria 4066
64 Ga0070667_100004183 3300005367 Bacteria 12184
65 Ga0070667_100075401 3300005367 Bacteria 2879
66 Ga0070667_100098735 3300005367 Unclassified 2520
67 Ga0070667_100157892 3300005367 Bacteria 1996
68 Ga0070701_10226070 3300005438 Bacteria 1118
69 Ga0070663_100461560 3300005455 Bacteria 1049
70 Ga0070662_100006409 3300005457 Bacteria 7584
71 Ga0070662_100022083 3300005457 Bacteria 4352
72 Ga0070662_100039869 3300005457 Bacteria 3343
73 Ga0070662_100187862 3300005457 Bacteria 1632
74 Ga0070681_10064172 3300005458 Bacteria 3644
75 Ga0070681_10304831 3300005458 Bacteria 1502
76 Ga0070681_10519514 3300005458 Bacteria 1104
77 Ga0068867_100040148 3300005459 Bacteria 3413
78 Ga0068867_100154066 3300005459 Bacteria 1807
79 Ga0068867_100222971 3300005459 Unclassified 1520
80 Ga0070685_10178542 3300005466 Bacteria 1365
81 Ga0070698_100252560 3300005471 Bacteria 1696
82 Ga0070679_100013971 3300005530 Bacteria 7695
83 Ga0070679_100525426 3300005530 Bacteria 1127
84 Ga0070684_100117524 3300005535 Bacteria 2390
85 Ga0070684_100285018 3300005535 Bacteria 1514
86 Ga0068853_100015743 3300005539 Bacteria 6211
87 Ga0068853_100017442 3300005539 Bacteria 5925
88 Ga0068853_100036056 3300005539 Bacteria 4203
89 Ga0068853_100340071 3300005539 Bacteria 1394
90 Ga0068853_100516188 3300005539 Bacteria 1129
91 Ga0070672_100042845 3300005543 Bacteria 3486
92 Ga0070672_100070131 3300005543 Unclassified 2784
93 Ga0070672_100130702 3300005543 Bacteria 2063
94 Ga0070672_100220793 3300005543 Unclassified 1590
95 Ga0070672_100241208 3300005543 Unclassified 1520
96 Ga0070686_100040163 3300005544 Bacteria 2918
97 Ga0070695_100227279 3300005545 Unclassified 1347
98 Ga0070665_100000031 3300005548 Bacteria 333365
99 Ga0070704_100701606 3300005549 Bacteria 897
100 Ga0068855_100007582 3300005563 Bacteria 13129
101 Ga0068855_100028580 3300005563 Bacteria 6671
102 Ga0068855_100063838 3300005563 Unclassified 4296
103 Ga0068855_100189333 3300005563 Bacteria 2322
104 Ga0068855_100245627 3300005563 Bacteria 1998
105 Ga0068855_100451875 3300005563 Bacteria 1402
106 Ga0070664_100005564 3300005564 Bacteria 10120
107 Ga0070664_100016199 3300005564 Bacteria 6109
108 Ga0070664_100074704 3300005564 Bacteria 2909
109 Ga0070664_100082492 3300005564 Bacteria 2773
110 Ga0070664_100246631 3300005564 Bacteria 1604
111 Ga0070664_100499196 3300005564 Bacteria 1121
112 Ga0068857_100003941 3300005577 Bacteria 12494
113 Ga0068857_100017630 3300005577 Bacteria 6261
114 Ga0068857_100047104 3300005577 Bacteria 3827
115 Ga0068857_100065080 3300005577 Bacteria 3241
116 Ga0068857_100112015 3300005577 Unclassified 2453
117 Ga0068857_100166170 3300005577 Bacteria 2004
118 Ga0068854_100098102 3300005578 Bacteria 2192
119 Ga0068854_100245329 3300005578 Bacteria 1428
120 Ga0068854_100363306 3300005578 Unclassified 1188
121 Ga0068856_100075154 3300005614 Bacteria 3347
122 Ga0068856_100473026 3300005614 Bacteria 1274
123 Ga0068852_100004088 3300005616 Bacteria 10268
124 Ga0068852_100087619 3300005616 Bacteria 2778
125 Ga0068859_100013961 3300005617 Bacteria 8056
126 Ga0068859_100130180 3300005617 Unclassified 2587
127 Ga0068859_100190805 3300005617 Bacteria 2133
128 Ga0068859_100872356 3300005617 Bacteria 985
129 Ga0068864_100048748 3300005618 Bacteria 3642
130 Ga0068864_100154998 3300005618 Bacteria 2078
131 Ga0068864_100290271 3300005618 Bacteria 1529
132 Ga0068864_100290672 3300005618 Bacteria 1528
133 Ga0068864_100292944 3300005618 Bacteria 1521
134 Ga0068864_100540399 3300005618 Bacteria 1125
135 Ga0068861_100002332 3300005719 Bacteria 12331
136 Ga0068851_10046563 3300005834 Bacteria 2194
137 Ga0068851_10065052 3300005834 Bacteria 1875
138 Ga0068851_10203630 3300005834 Bacteria 1106
139 Ga0068870_10193849 3300005840 Bacteria 1228
140 Ga0068863_100016141 3300005841 Bacteria 7164
141 Ga0068863_100367197 3300005841 Bacteria 1404
142 Ga0068858_100327988 3300005842 Bacteria 1464
143 Ga0068858_100400748 3300005842 Bacteria 1318
144 Ga0068860_100030299 3300005843 Bacteria 5204
145 Ga0068860_100053482 3300005843 Unclassified 3839
146 Ga0068860_100072941 3300005843 Bacteria 3263
147 Ga0068860_100226041 3300005843 Bacteria 1818
148 Ga0068860_101000242 3300005843 Unclassified 854
149 Ga0068862_100083954 3300005844 Bacteria 2766
150 Ga0068862_100187025 3300005844 Bacteria 1862
151 Ga0068862_100462952 3300005844 Bacteria 1197
152 Ga0075366_10063296 3300006195 Bacteria 2199
153 Ga0097621_100000036 3300006237 Bacteria 67999
154 Ga0097621_100050834 3300006237 Bacteria 3371
155 Ga0097621_100063614 3300006237 Bacteria 3033
156 Ga0097621_100401761 3300006237 Bacteria 1227
157 Ga0097621_100619650 3300006237 Bacteria 990
158 Ga0068871_100000032 3300006358 Bacteria 73078
159 Ga0068871_100012622 3300006358 Bacteria 6238
160 Ga0068871_100016455 3300006358 Bacteria 5570
161 Ga0068871_100062444 3300006358 Unclassified 3044
162 Ga0068871_100737079 3300006358 Unclassified 905
163 Ga0068865_100045823 3300006881 Bacteria 2999
164 Ga0068865_100348412 3300006881 Bacteria 1199
165 Ga0097620_100013961 3300006931 Bacteria 8056
166 Ga0097620_100130180 3300006931 Unclassified 2587
167 Ga0097620_100190808 3300006931 Bacteria 2133
168 Ga0097620_100872324 3300006931 Bacteria 985
169 Ga0105251_10013407 3300009011 Bacteria 4589
170 Ga0105250_10004788 3300009092 Bacteria 6170
171 Ga0111539_10122725 3300009094 Bacteria 3045
172 Ga0105247_10056073 3300009101 Unclassified 2433
173 Ga0105247_10122455 3300009101 Bacteria 1687
174 Ga0105247_10209545 3300009101 Bacteria 1314
175 Ga0114129_10015792 3300009147 Bacteria 10735
176 Ga0105241_10199962 3300009174 Bacteria 1669
177 Ga0105241_10587437 3300009174 Unclassified 1004
178 Ga0105242_10007956 3300009176 Bacteria 8166
179 Ga0105242_10018955 3300009176 Bacteria 5389
180 Ga0105242_10080593 3300009176 Unclassified 2721
181 Ga0105242_10208181 3300009176 Unclassified 1741
182 Ga0105242_10296735 3300009176 Bacteria 1473
183 Ga0105248_10057123 3300009177 Unclassified 4380
184 Ga0105248_11123747 3300009177 Bacteria 888
185 Ga0105237_10132199 3300009545 Bacteria 2490
186 Ga0105238_10119441 3300009551 Unclassified 2616
187 Ga0105249_10003194 3300009553 Bacteria 14183
188 Ga0105249_10073440 3300009553 Unclassified 3164
189 Ga0105249_10166444 3300009553 Bacteria 2134
190 Ga0105249_10232241 3300009553 Unclassified 1820
191 Ga0105249_10414820 3300009553 Bacteria 1379
192 Ga0105249_10534229 3300009553 Bacteria 1222
193 Ga0105239_10001192 3300010375 Bacteria 35572
194 Ga0105246_10025518 3300011119 Bacteria 3853
195 Ga0105246_10125187 3300011119 Unclassified 1911
196 Ga0157373_10027104 3300013100 Bacteria 4134
197 Ga0157373_10110561 3300013100 Bacteria 1932
198 Ga0157371_10028168 3300013102 Bacteria 4070
199 Ga0157371_10067388 3300013102 Bacteria 2534
200 Ga0157371_10226790 3300013102 Bacteria 1342
201 Ga0157371_10326562 3300013102 Bacteria 1114
202 Ga0157370_10057896 3300013104 Bacteria 3683
203 Ga0157370_10070798 3300013104 Unclassified 3292
204 Ga0157369_10010532 3300013105 Bacteria 10524
205 Ga0157369_10103952 3300013105 Unclassified 3026
206 Ga0157374_10000002 3300013296 Bacteria 1054226
207 Ga0157374_10028260 3300013296 Bacteria 5066
208 Ga0157374_10059289 3300013296 Bacteria 3578
209 Ga0157374_10075848 3300013296 Bacteria 3178
210 Ga0157374_10099088 3300013296 Bacteria 2791
211 Ga0157374_10113291 3300013296 Bacteria 2610
212 Ga0157378_10007331 3300013297 Bacteria 9634
213 Ga0157378_10012239 3300013297 Bacteria 7513
214 Ga0157378_10016010 3300013297 Bacteria 6567
215 Ga0157378_10242619 3300013297 Unclassified 1722
216 Ga0157378_10873904 3300013297 Bacteria 928
217 Ga0163162_10000167 3300013306 Bacteria 60620
218 Ga0163162_10001828 3300013306 Bacteria 20026
219 Ga0163162_10026814 3300013306 Bacteria 5697
220 Ga0163162_10042818 3300013306 Unclassified 4533
221 Ga0163162_10069572 3300013306 Unclassified 3571
222 Ga0163162_10128471 3300013306 Bacteria 2642
223 Ga0163162_10366370 3300013306 Bacteria 1574
224 Ga0163162_10558987 3300013306 Unclassified 1272
225 Ga0157372_10091647 3300013307 Bacteria 3457
226 Ga0157372_10188958 3300013307 Unclassified 2385
227 Ga0157372_10214053 3300013307 Bacteria 2233
228 Ga0157372_10309332 3300013307 Bacteria 1839
229 Ga0157372_10445279 3300013307 Unclassified 1510
230 Ga0157375_10000067 3300013308 Bacteria 110313
231 Ga0157375_10143036 3300013308 Bacteria 2520
232 Ga0157375_10146105 3300013308 Bacteria 2495
233 Ga0157375_10210811 3300013308 Bacteria 2100
234 Ga0157375_10339856 3300013308 Bacteria 1667
235 Ga0157375_10540870 3300013308 Bacteria 1327
236 Ga0157375_10709141 3300013308 Unclassified 1159
237 Ga0163163_10001587 3300014325 Bacteria 19117
238 Ga0163163_10105540 3300014325 Bacteria 2843
239 Ga0163163_10114434 3300014325 Bacteria 2728
240 Ga0157380_10070077 3300014326 Bacteria 2832
241 Ga0157377_10003672 3300014745 Bacteria 6963
242 Ga0157377_10005666 3300014745 Bacteria 5886
243 Ga0157379_10011904 3300014968 Bacteria 7602
244 Ga0157379_10038921 3300014968 Unclassified 4242
245 Ga0157379_10140951 3300014968 Bacteria 2173
246 Ga0157379_10145643 3300014968 Unclassified 2136
247 Ga0157376_10000874 3300014969 Bacteria 19764
248 Ga0157376_10003940 3300014969 Bacteria 10269
249 Ga0157376_10074455 3300014969 Bacteria 2894
250 Ga0163161_10003173 3300017792 Bacteria 11597
251 Ga0163161_10010716 3300017792 Bacteria 6349
252 Ga0163161_10037101 3300017792 Bacteria 3493
253 Ga0209437_101014 3300025233 Bacteria 9707
254 Ga0209673_1005807 3300025273 Bacteria 6124
255 Ga0209130_1002569 3300025284 Bacteria 8844
256 Ga0209025_1001333 3300025294 Bacteria 33361
257 Ga0209025_1001933 3300025294 Bacteria 23996
258 Ga0209025_1010964 3300025294 Bacteria 6056
259 Ga0207697_10035585 3300025315 Bacteria 2038
260 Ga0207656_10070309 3300025321 Bacteria 1554
261 Ga0207696_1039328 3300025711 Bacteria 1392
262 Ga0207655_1047176 3300025728 Bacteria 1780
263 Ga0207713_1015758 3300025735 Bacteria 3864
264 Ga0207682_10053661 3300025893 Unclassified 1672
265 Ga0207682_10184605 3300025893 Bacteria 954
266 Ga0207680_10156521 3300025903 Unclassified 1524
267 Ga0207647_10034826 3300025904 Unclassified 3211
268 Ga0207645_10114227 3300025907 Bacteria 1750
269 Ga0207707_10048730 3300025912 Bacteria 3690
270 Ga0207707_10369596 3300025912 Bacteria 1234
271 Ga0207671_10080519 3300025914 Bacteria 2441
272 Ga0207657_10008310 3300025919 Bacteria 10562
273 Ga0207657_10167559 3300025919 Unclassified 1781
274 Ga0207649_10001123 3300025920 Bacteria 16235
275 Ga0207649_10330703 3300025920 Bacteria 1122
276 Ga0207652_10077626 3300025921 Bacteria 2898
277 Ga0207681_10003075 3300025923 Bacteria 10485
278 Ga0207694_10064947 3300025924 Unclassified 2845
279 Ga0207650_10038354 3300025925 Bacteria 3498
280 Ga0207659_10030111 3300025926 Unclassified 3705
281 Ga0207659_10037849 3300025926 Bacteria 3352
282 Ga0207659_10098873 3300025926 Bacteria 2195
283 Ga0207644_10023105 3300025931 Bacteria 4255
284 Ga0207644_10027909 3300025931 Unclassified 3902
285 Ga0207644_10068187 3300025931 Unclassified 2595
286 Ga0207690_10003439 3300025932 Bacteria 9449
287 Ga0207690_10140376 3300025932 Bacteria 1779
288 Ga0207706_10001373 3300025933 Bacteria 24327
289 Ga0207706_10016620 3300025933 Bacteria 6641
290 Ga0207706_10017036 3300025933 Bacteria 6555
291 Ga0207706_10041996 3300025933 Unclassified 4052
292 Ga0207706_10082824 3300025933 Bacteria 2820
293 Ga0207686_10621135 3300025934 Unclassified 852
294 Ga0207670_10275290 3300025936 Unclassified 1310
295 Ga0207691_10017291 3300025940 Bacteria 6839
296 Ga0207691_10055044 3300025940 Unclassified 3627
297 Ga0207691_10301869 3300025940 Bacteria 1376
298 Ga0207691_10538308 3300025940 Bacteria 991
299 Ga0207711_10054059 3300025941 Bacteria 3444
300 Ga0207689_10057184 3300025942 Unclassified 3208
301 Ga0207689_10489238 3300025942 Unclassified 1030
302 Ga0207661_10001802 3300025944 Bacteria 14637
303 Ga0207661_10059752 3300025944 Bacteria 3073
304 Ga0207661_10250826 3300025944 Bacteria 1573
305 Ga0207679_10000768 3300025945 Bacteria 21047
306 Ga0207679_10012834 3300025945 Bacteria 5478
307 Ga0207679_10038248 3300025945 Bacteria 3417
308 Ga0207679_10070675 3300025945 Bacteria 2631
309 Ga0207679_10190618 3300025945 Bacteria 1704
310 Ga0207667_10008843 3300025949 Bacteria 11920
311 Ga0207667_10391299 3300025949 Bacteria 1416
312 Ga0207667_10410123 3300025949 Bacteria 1379
313 Ga0207667_10649862 3300025949 Bacteria 1060
314 Ga0207651_10068231 3300025960 Bacteria 2506
315 Ga0207651_10187496 3300025960 Unclassified 1647
316 Ga0207712_10042337 3300025961 Unclassified 3135
317 Ga0207712_10048725 3300025961 Bacteria 2948
318 Ga0207712_10225509 3300025961 Bacteria 1501
319 Ga0207712_10614603 3300025961 Bacteria 941
320 Ga0207668_10151619 3300025972 Bacteria 1795
321 Ga0207640_10159245 3300025981 Bacteria 1668
322 Ga0207640_10261369 3300025981 Bacteria 1349
323 Ga0207658_10087994 3300025986 Bacteria 2400
324 Ga0207658_10096254 3300025986 Unclassified 2308
325 Ga0207658_10142945 3300025986 Unclassified 1939
326 Ga0207658_10264163 3300025986 Bacteria 1468
327 Ga0207677_10004209 3300026023 Bacteria 7705
328 Ga0207677_10009892 3300026023 Bacteria 5376
329 Ga0207677_10067814 3300026023 Bacteria 2501
330 Ga0207677_10266812 3300026023 Unclassified 1398
331 Ga0207677_10426843 3300026023 Bacteria 1130
332 Ga0207703_10049939 3300026035 Bacteria 3383
333 Ga0207703_10050397 3300026035 Unclassified 3370
334 Ga0207639_10000365 3300026041 Bacteria 31332
335 Ga0207639_10016811 3300026041 Bacteria 5182
336 Ga0207639_10029347 3300026041 Bacteria 4025
337 Ga0207639_10046303 3300026041 Bacteria 3281
338 Ga0207702_10115614 3300026078 Bacteria 2393
339 Ga0207702_10453033 3300026078 Bacteria 1245
340 Ga0207641_10010477 3300026088 Bacteria 7613
341 Ga0207641_10017352 3300026088 Bacteria 5893
342 Ga0207641_10337564 3300026088 Bacteria 1433
343 Ga0207648_10015759 3300026089 Bacteria 6934
344 Ga0207648_10104363 3300026089 Unclassified 2486
345 Ga0207648_10211885 3300026089 Bacteria 1720
346 Ga0207648_10341409 3300026089 Bacteria 1348
347 Ga0207648_10820132 3300026089 Bacteria 867
348 Ga0207676_10245210 3300026095 Bacteria 1610
349 Ga0207676_10704242 3300026095 Bacteria 979
350 Ga0207674_10005900 3300026116 Bacteria 14502
351 Ga0207674_10018901 3300026116 Bacteria 7472
352 Ga0207674_10192846 3300026116 Unclassified 1987
353 Ga0207674_10323012 3300026116 Bacteria 1493
354 Ga0207675_100000051 3300026118 Bacteria 83288
355 Ga0207683_10020692 3300026121 Bacteria 5629
356 Ga0207683_10071366 3300026121 Unclassified 3070
357 Ga0207698_10180666 3300026142 Bacteria 1869
358 Ga0207428_10061235 3300027907 Bacteria 2980
359 Ga0268266_10000088 3300028379 Bacteria 199029
360 Ga0268265_10467897 3300028380 Unclassified 1181
361 Ga0268264_10304129 3300028381 Bacteria 1502
362 Ga0307517_10000658 3300028786 Bacteria 59357
363 Ga0265327_10000361 3300031251 Bacteria 86574
364 Ga0307513_10072544 3300031456 Bacteria 3588
365 Ga0307509_10031297 3300031507 Bacteria 5876
366 Ga0307408_100057628 3300031548 Unclassified 2821
367 Ga0307508_10101932 3300031616 Unclassified 2467
368 Ga0307516_10003121 3300031730 Bacteria 21554
369 Ga0307410_10156791 3300031852 Bacteria 1701
370 Ga0307406_10102331 3300031901 Unclassified 1954
371 Ga0307406_10812865 3300031901 Bacteria 790
372 Ga0307407_10015437 3300031903 Unclassified 3775
373 Ga0307416_100341806 3300032002 Bacteria 1510
374 Ga0373945_0108609 3300035116 Bacteria 1093
375 Ga0373927_0011502 3300035695 Bacteria 5897
376 Ga0373947_0057206 3300035725 Bacteria 2359
377 Ga0373937_0034971 3300036401 Bacteria 4570
378 Ga0395901_0658275 3300038443 Bacteria 1050
379 Ga0451851_1263769 3300041507 Bacteria 918
380 Ga0451853_1864335 3300041512 Bacteria 1536
381 Ga0439449_0011903 3300042007 Bacteria 3271
382 Ga0439449_0016949 3300042007 Bacteria 2735
383 Ga0439457_001854 3300042014 Bacteria 6236
384 Ga0451577_0172217 3300042876 Bacteria 1951
385 Ga0451577_0510905 3300042876 Unclassified 1091
386 Ga0466969_0000033 3300044656 Bacteria 82227
387 Ga0466972_0000091 3300044658 Bacteria 81829
388 Ga0453683_0110722 3300044673 Bacteria 1727
389 Ga0466965_0085848 3300044683 Bacteria 1596
390 Ga0466966_0000170 3300044684 Bacteria 42809
391 Ga0466966_0098119 3300044684 Bacteria 1814
392 Ga0466964_0079122 3300044706 Bacteria 1407
393 Ga0453684_0000204 3300044712 Bacteria 258105
394 Ga0453684_0000298 3300044712 Bacteria 209777
395 Ga0453684_0001219 3300044712 Bacteria 78962
396 Ga0453684_0017707 3300044712 Bacteria 11007
397 Ga0453684_0099853 3300044712 Unclassified 3554
398 Ga0466971_0036463 3300044719 Unclassified 2205
399 Ga0466970_0319996 3300044765 Bacteria 877
400 Ga0466957_0016172 3300044842 Bacteria 4362
401 Ga0466957_0051029 3300044842 Bacteria 2518
402 Ga0466959_0000089 3300045049 Bacteria 57482
403 Ga0451576_0000033 3300045051 Bacteria 393131
404 Ga0451576_0132125 3300045051 Bacteria 2602
405 Ga0466958_0134660 3300045836 Bacteria 1553
406 Ga0466967_0076020 3300045976 Bacteria 3020
407 Ga0466967_0482228 3300045976 Bacteria 1215
408 Ga0466967_0538482 3300045976 Bacteria 1148
409 Ga0466967_0580169 3300045976 Bacteria 1105
410 Ga0495603_0038084 3300046455 Bacteria 2884
411 Ga0495629_0530974 3300046459 Bacteria 791
412 Ga0495638_0089154 3300046460 Bacteria 1861
413 Ga0495584_0056449 3300046491 Bacteria 1976
414 Ga0495585_0119339 3300046492 Bacteria 1396
415 Ga0495607_0154262 3300046501 Bacteria 1173
416 Ga0495618_0249081 3300046514 Unclassified 1115
417 Ga0495628_0170382 3300046516 Unclassified 1651
418 Ga0495628_0510353 3300046516 Bacteria 867
419 Ga0495648_0002082 3300046524 Bacteria 18925
420 Ga0495622_0073208 3300046557 Bacteria 1581
421 Ga0495634_0151574 3300046642 Unclassified 1466
422 Ga0495611_0028122 3300046648 Bacteria 2461
423 Ga0495687_000079 3300047443 Bacteria 147704
424 Ga0496100_0012350 3300048903 Bacteria 4893
425 Ga0496101_0005710 3300048904 Bacteria 7946
426 Ga0496101_0071604 3300048904 Unclassified 2542
427 Ga0496102_0078579 3300048905 Bacteria 3037
428 Ga0496103_0019396 3300048906 Bacteria 4083
429 Ga0496104_0002984 3300048907 Bacteria 14585
430 Ga0496105_0005097 3300048908 Bacteria 9958
431 Ga0496105_0246561 3300048908 Unclassified 1448
432 Ga0496106_0001147 3300048909 Bacteria 19624
433 Ga0496107_0002022 3300048910 Bacteria 12940
434 Ga0496108_0000646 3300048911 Bacteria 27125
435 Ga0496109_0000705 3300048912 Bacteria 27776
436 Ga0496110_0007717 3300048913 Bacteria 8609
437 Ga0496110_0199689 3300048913 Unclassified 1817
438 Ga0496110_0396481 3300048913 Unclassified 1258
439 Ga0496111_0000613 3300048914 Bacteria 18849
440 Ga0496112_0272147 3300048915 Bacteria 1642
441 Ga0496112_0372336 3300048915 Unclassified 1370
442 Ga0496113_0020298 3300048916 Bacteria 4669
443 Ga0496113_0562068 3300048916 Bacteria 915
444 Ga0496114_0058194 3300048917 Unclassified 3227
445 Ga0496116_0022002 3300048919 Bacteria 4794
446 Ga0496117_0052619 3300048920 Bacteria 2867
447 Ga0496119_0003051 3300048922 Bacteria 17722
448 Ga0496120_0017801 3300048923 Bacteria 4594
449 Ga0496122_0020261 3300048925 Bacteria 6021
450 Ga0496125_0003796 3300048928 Bacteria 17966
451 Ga0496125_0005442 3300048928 Bacteria 14152
452 Ga0496126_0096996 3300048929 Bacteria 2584
453 Ga0501034_0453529 3300049571 Bacteria 1200
454 Ga0501043_0310944 3300049579 Bacteria 1203
455 Ga0501047_0019608 3300049581 Bacteria 6490
456 Ga0501047_0234421 3300049581 Bacteria 1687
457 Ga0501048_0203724 3300049582 Bacteria 1403
458 Ga0501044_0285660 3300049823 Bacteria 1582
459 nmdc:mga05p37_9961_c1 3300050507 Bacteria 11286
460 nmdc:mga08y16_55707_c1 3300050511 Bacteria 4131
461 Ga0500578_0017678 3300053086 Bacteria 4582
462 Ga0500646_0022263 3300053090 Unclassified 1695
463 Ga0500583_0000002 3300053092 Bacteria 232826
464 Ga0500583_0000356 3300053092 Bacteria 15053
465 Ga0500583_0039745 3300053092 Bacteria 2126
466 Ga0500642_0002836 3300053130 Bacteria 5145
467 Ga0500652_091503 3300053131 Bacteria 1270
468 Ga0500658_0086805 3300053134 Bacteria 1347
469 Ga0500568_0005606 3300053139 Bacteria 6464
470 Ga0500589_007446 3300053147 Bacteria 4476
471 Ga0500589_174808 3300053147 Bacteria 850
472 Ga0500622_0002067 3300053156 Bacteria 14955
473 Ga0500622_0117710 3300053156 Bacteria 1292
474 Ga0500636_0287036 3300053177 Bacteria 818
475 Ga0500611_000038 3300053727 Bacteria 71407
476 Ga0501084_0198449 3300054114 Bacteria 1693

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0530974 Ga0495629_0530974_21_584 187
2 3300044719 Ga0466971_0036463 Ga0466971_0036463_56_688 206
3 3300053156 Ga0500622_0117710 Ga0500622_0117710_612_1235 207
4 3300009553 Ga0105249_10534229 Ga0105249_105342292 220
5 3300005563 Ga0068855_100189333 Ga0068855_1001893332 224
6 3300005564 Ga0070664_100499196 Ga0070664_1004991961 224
7 3300006358 Ga0068871_100737079 Ga0068871_1007370791 225
8 3300013306 Ga0163162_10366370 Ga0163162_103663702 225
9 3300014325 Ga0163163_10105540 Ga0163163_101055402 225
10 3300026095 Ga0207676_10704242 Ga0207676_107042422 225
11 3300005367 Ga0070667_100157892 Ga0070667_1001578923 227
12 3300005843 Ga0068860_101000242 Ga0068860_1010002421 227
13 3300009177 Ga0105248_11123747 Ga0105248_111237472 227
14 3300025986 Ga0207658_10264163 Ga0207658_102641632 227
15 3300035116 Ga0373945_0108609 Ga0373945_0108609_82_768 227
16 3300005330 Ga0070690_100134608 Ga0070690_1001346082 230
17 3300005331 Ga0070670_100054817 Ga0070670_1000548172 230
18 3300005539 Ga0068853_100015743 Ga0068853_1000157435 230
19 3300005618 Ga0068864_100540399 Ga0068864_1005403992 230
20 3300009553 Ga0105249_10414820 Ga0105249_104148202 230
21 3300014325 Ga0163163_10001587 Ga0163163_100015872 230
22 3300025925 Ga0207650_10038354 Ga0207650_100383542 230
23 3300025961 Ga0207712_10614603 Ga0207712_106146032 230
24 3300026041 Ga0207639_10016811 Ga0207639_100168114 230
25 3300005293 Ga0065715_10146333 Ga0065715_101463332 231
26 3300005333 Ga0070677_10239442 Ga0070677_102394421 231
27 3300005353 Ga0070669_100007779 Ga0070669_1000077797 231
28 3300005549 Ga0070704_100701606 Ga0070704_1007016061 231
29 3300025981 Ga0207640_10261369 Ga0207640_102613692 231
30 3300044712 Ga0453684_0000298 Ga0453684_0000298_107856_108596 232
31 3300045051 Ga0451576_0000033 Ga0451576_0000033_284536_285276 232
32 3300003790 Ga0055528_1003292 Ga0055528_100329210 233
33 3300005337 Ga0070682_100684937 Ga0070682_1006849371 233
34 3300005618 Ga0068864_100290672 Ga0068864_1002906721 233
35 3300009101 Ga0105247_10122455 Ga0105247_101224552 233
36 3300009176 Ga0105242_10007956 Ga0105242_100079563 233
37 3300011119 Ga0105246_10025518 Ga0105246_100255183 233
38 3300013296 Ga0157374_10113291 Ga0157374_101132913 233
39 3300014745 Ga0157377_10005666 Ga0157377_100056667 233
40 3300025273 Ga0209673_1005807 Ga0209673_10058076 233
41 3300025294 Ga0209025_1010964 Ga0209025_10109644 233
42 3300025711 Ga0207696_1039328 Ga0207696_10393282 233
43 3300025728 Ga0207655_1047176 Ga0207655_10471762 233
44 3300025735 Ga0207713_1015758 Ga0207713_10157584 233
45 3300046455 Ga0495603_0038084 Ga0495603_0038084_809_1564 233
46 3300046491 Ga0495584_0056449 Ga0495584_0056449_1033_1788 233
47 3300046492 Ga0495585_0119339 Ga0495585_0119339_609_1364 233
48 3300046557 Ga0495622_0073208 Ga0495622_0073208_658_1413 233
49 3300048903 Ga0496100_0012350 Ga0496100_0012350_692_1447 233
50 3300048904 Ga0496101_0005710 Ga0496101_0005710_3402_4157 233
51 3300048905 Ga0496102_0078579 Ga0496102_0078579_310_1065 233
52 3300048906 Ga0496103_0019396 Ga0496103_0019396_3296_4051 233
53 3300048907 Ga0496104_0002984 Ga0496104_0002984_626_1381 233
54 3300048908 Ga0496105_0005097 Ga0496105_0005097_6294_7049 233
55 3300048909 Ga0496106_0001147 Ga0496106_0001147_437_1192 233
56 3300048910 Ga0496107_0002022 Ga0496107_0002022_11749_12504 233
57 3300048911 Ga0496108_0000646 Ga0496108_0000646_25780_26535 233
58 3300048912 Ga0496109_0000705 Ga0496109_0000705_10875_11630 233
59 3300048913 Ga0496110_0007717 Ga0496110_0007717_7417_8172 233
60 3300048914 Ga0496111_0000613 Ga0496111_0000613_820_1575 233
61 3300048916 Ga0496113_0020298 Ga0496113_0020298_3882_4637 233
62 3300048919 Ga0496116_0022002 Ga0496116_0022002_499_1254 233
63 3300048920 Ga0496117_0052619 Ga0496117_0052619_354_1109 233
64 3300048922 Ga0496119_0003051 Ga0496119_0003051_16148_16903 233
65 3300048923 Ga0496120_0017801 Ga0496120_0017801_3483_4238 233
66 3300048925 Ga0496122_0020261 Ga0496122_0020261_1971_2726 233
67 3300048928 Ga0496125_0003796 Ga0496125_0003796_16392_17147 233
68 3300048929 Ga0496126_0096996 Ga0496126_0096996_437_1192 233
69 3300038443 Ga0395901_0658275 Ga0395901_0658275_222_941 234
70 3300005458 Ga0070681_10519514 Ga0070681_105195141 235
71 3300009553 Ga0105249_10232241 Ga0105249_102322413 235
72 3300025934 Ga0207686_10621135 Ga0207686_106211351 235
73 3300025942 Ga0207689_10057184 Ga0207689_100571843 235
74 3300044712 Ga0453684_0017707 Ga0453684_0017707_9257_10027 235
75 3300005335 Ga0070666_10174048 Ga0070666_101740482 236
76 3300005344 Ga0070661_100350549 Ga0070661_1003505492 236
77 3300005539 Ga0068853_100516188 Ga0068853_1005161881 236
78 3300005543 Ga0070672_100130702 Ga0070672_1001307022 236
79 3300005548 Ga0070665_100000031 Ga0070665_100000031260 236
80 3300005563 Ga0068855_100063838 Ga0068855_1000638384 236
81 3300005577 Ga0068857_100112015 Ga0068857_1001120153 236
82 3300005616 Ga0068852_100004088 Ga0068852_1000040885 236
83 3300009176 Ga0105242_10296735 Ga0105242_102967351 236
84 3300009551 Ga0105238_10119441 Ga0105238_101194412 236
85 3300010375 Ga0105239_10001192 Ga0105239_100011925 236
86 3300013104 Ga0157370_10070798 Ga0157370_100707982 236
87 3300013105 Ga0157369_10010532 Ga0157369_100105327 236
88 3300013307 Ga0157372_10188958 Ga0157372_101889581 236
89 3300025903 Ga0207680_10156521 Ga0207680_101565212 236
90 3300025904 Ga0207647_10034826 Ga0207647_100348262 236
91 3300025924 Ga0207694_10064947 Ga0207694_100649472 236
92 3300025940 Ga0207691_10538308 Ga0207691_105383081 236
93 3300025949 Ga0207667_10649862 Ga0207667_106498622 236
94 3300026116 Ga0207674_10192846 Ga0207674_101928462 236
95 3300028379 Ga0268266_10000088 Ga0268266_10000088153 236
96 3300003322 rootL2_10108260 rootL2_101082602 237
97 3300005334 Ga0068869_100041343 Ga0068869_1000413433 237
98 3300005340 Ga0070689_100172211 Ga0070689_1001722112 237
99 3300005367 Ga0070667_100075401 Ga0070667_1000754012 237
100 3300005455 Ga0070663_100461560 Ga0070663_1004615602 237
101 3300005617 Ga0068859_100013961 Ga0068859_1000139614 237
102 3300005618 Ga0068864_100154998 Ga0068864_1001549982 237
103 3300005842 Ga0068858_100400748 Ga0068858_1004007482 237
104 3300005843 Ga0068860_100053482 Ga0068860_1000534823 237
105 3300006237 Ga0097621_100063614 Ga0097621_1000636142 237
106 3300006358 Ga0068871_100062444 Ga0068871_1000624442 237
107 3300006931 Ga0097620_100013961 Ga0097620_1000139614 237
108 3300013102 Ga0157371_10067388 Ga0157371_100673882 237
109 3300013307 Ga0157372_10445279 Ga0157372_104452792 237
110 3300013308 Ga0157375_10146105 Ga0157375_101461051 237
111 3300025961 Ga0207712_10042337 Ga0207712_100423373 237
112 3300028381 Ga0268264_10304129 Ga0268264_103041292 237
113 3300045976 Ga0466967_0076020 Ga0466967_0076020_787_1500 237
114 3300046516 Ga0495628_0510353 Ga0495628_0510353_142_855 237
115 3300046642 Ga0495634_0151574 Ga0495634_0151574_743_1456 237
116 3300005563 Ga0068855_100451875 Ga0068855_1004518752 238
117 3300009545 Ga0105237_10132199 Ga0105237_101321993 238
118 3300013306 Ga0163162_10000167 Ga0163162_1000016717 238
119 3300025914 Ga0207671_10080519 Ga0207671_100805192 238
120 3300025949 Ga0207667_10391299 Ga0207667_103912992 238
121 3300047443 Ga0495687_000079 Ga0495687_000079_131336_132061 238
122 3300046460 Ga0495638_0089154 Ga0495638_0089154_980_1708 239
123 3300046524 Ga0495648_0002082 Ga0495648_0002082_5973_6701 239
124 3300046648 Ga0495611_0028122 Ga0495611_0028122_1229_1957 239
125 3300053092 Ga0500583_0039745 Ga0500583_0039745_54_782 239
126 3300053130 Ga0500642_0002836 Ga0500642_0002836_3207_3935 239
127 3300053139 Ga0500568_0005606 Ga0500568_0005606_4448_5176 239
128 3300053156 Ga0500622_0002067 Ga0500622_0002067_11100_11828 239
129 3300005328 Ga0070676_10076056 Ga0070676_100760562 240
130 3300005334 Ga0068869_100037162 Ga0068869_1000371622 240
131 3300005347 Ga0070668_100016255 Ga0070668_1000162555 240
132 3300005354 Ga0070675_100018008 Ga0070675_1000180084 240
133 3300005364 Ga0070673_100090429 Ga0070673_1000904292 240
134 3300005365 Ga0070688_100015683 Ga0070688_1000156832 240
135 3300005438 Ga0070701_10226070 Ga0070701_102260702 240
136 3300005457 Ga0070662_100039869 Ga0070662_1000398694 240
137 3300005543 Ga0070672_100042845 Ga0070672_1000428452 240
138 3300005577 Ga0068857_100047104 Ga0068857_1000471042 240
139 3300005578 Ga0068854_100245329 Ga0068854_1002453292 240
140 3300005617 Ga0068859_100872356 Ga0068859_1008723562 240
141 3300005719 Ga0068861_100002332 Ga0068861_10000233213 240
142 3300005844 Ga0068862_100083954 Ga0068862_1000839542 240
143 3300006881 Ga0068865_100348412 Ga0068865_1003484122 240
144 3300006931 Ga0097620_100872324 Ga0097620_1008723242 240
145 3300009094 Ga0111539_10122725 Ga0111539_101227252 240
146 3300009553 Ga0105249_10003194 Ga0105249_100031946 240
147 3300013306 Ga0163162_10128471 Ga0163162_101284713 240
148 3300013308 Ga0157375_10143036 Ga0157375_101430362 240
149 3300014326 Ga0157380_10070077 Ga0157380_100700773 240
150 3300014745 Ga0157377_10003672 Ga0157377_100036725 240
151 3300025315 Ga0207697_10035585 Ga0207697_100355852 240
152 3300025893 Ga0207682_10184605 Ga0207682_101846052 240
153 3300025907 Ga0207645_10114227 Ga0207645_101142272 240
154 3300025923 Ga0207681_10003075 Ga0207681_100030756 240
155 3300025926 Ga0207659_10098873 Ga0207659_100988732 240
156 3300025933 Ga0207706_10016620 Ga0207706_100166204 240
157 3300025940 Ga0207691_10301869 Ga0207691_103018692 240
158 3300025960 Ga0207651_10068231 Ga0207651_100682312 240
159 3300025961 Ga0207712_10048725 Ga0207712_100487252 240
160 3300025972 Ga0207668_10151619 Ga0207668_101516192 240
161 3300026116 Ga0207674_10323012 Ga0207674_103230122 240
162 3300026118 Ga0207675_100000051 Ga0207675_10000005134 240
163 3300027907 Ga0207428_10061235 Ga0207428_100612353 240
164 3300031901 Ga0307406_10812865 Ga0307406_108128651 240
165 3300050511 nmdc:mga08y16_55707_c1 nmdc:mga08y16_55707_c1_2800_3522 240
166 3300003323 rootH1_10017103 rootH1_1001710323 241
167 3300045976 Ga0466967_0482228 Ga0466967_0482228_91_816 241
168 3300053177 Ga0500636_0287036 Ga0500636_0287036_76_807 241
169 3300005539 Ga0068853_100340071 Ga0068853_1003400712 242
170 3300025936 Ga0207670_10275290 Ga0207670_102752901 242
171 3300044712 Ga0453684_0001219 Ga0453684_0001219_9472_10215 242
172 3300044712 Ga0453684_0099853 Ga0453684_0099853_1000_1734 242
173 3300005471 Ga0070698_100252560 Ga0070698_1002525602 243
174 3300005563 Ga0068855_100007582 Ga0068855_1000075825 243
175 3300005577 Ga0068857_100017630 Ga0068857_1000176303 243
176 3300005614 Ga0068856_100075154 Ga0068856_1000751543 243
177 3300006195 Ga0075366_10063296 Ga0075366_100632962 243
178 3300025949 Ga0207667_10008843 Ga0207667_100088437 243
179 3300026116 Ga0207674_10018901 Ga0207674_100189014 243
180 3300031548 Ga0307408_100057628 Ga0307408_1000576282 243
181 3300031852 Ga0307410_10156791 Ga0307410_101567912 243
182 3300031901 Ga0307406_10102331 Ga0307406_101023312 243
183 3300031903 Ga0307407_10015437 Ga0307407_100154373 243
184 3300032002 Ga0307416_100341806 Ga0307416_1003418062 243
185 3300005328 Ga0070676_10639609 Ga0070676_106396091 244
186 3300005338 Ga0068868_100228430 Ga0068868_1002284301 244
187 3300005457 Ga0070662_100006409 Ga0070662_1000064098 244
188 3300005459 Ga0068867_100040148 Ga0068867_1000401483 244
189 3300005459 Ga0068867_100154066 Ga0068867_1001540662 244
190 3300005564 Ga0070664_100074704 Ga0070664_1000747041 244
191 3300005618 Ga0068864_100290271 Ga0068864_1002902712 244
192 3300005843 Ga0068860_100072941 Ga0068860_1000729413 244
193 3300009176 Ga0105242_10018955 Ga0105242_100189555 244
194 3300009176 Ga0105242_10208181 Ga0105242_102081812 244
195 3300009177 Ga0105248_10057123 Ga0105248_100571233 244
196 3300009553 Ga0105249_10073440 Ga0105249_100734402 244
197 3300013102 Ga0157371_10326562 Ga0157371_103265621 244
198 3300013296 Ga0157374_10059289 Ga0157374_100592893 244
199 3300013306 Ga0163162_10069572 Ga0163162_100695723 244
200 3300017792 Ga0163161_10010716 Ga0163161_100107162 244
201 3300025931 Ga0207644_10023105 Ga0207644_100231052 244
202 3300025933 Ga0207706_10017036 Ga0207706_100170366 244
203 3300025945 Ga0207679_10038248 Ga0207679_100382483 244
204 3300026023 Ga0207677_10266812 Ga0207677_102668122 244
205 3300026023 Ga0207677_10426843 Ga0207677_104268432 244
206 3300026089 Ga0207648_10015759 Ga0207648_100157593 244
207 3300026089 Ga0207648_10211885 Ga0207648_102118852 244
208 3300026089 Ga0207648_10341409 Ga0207648_103414092 244
209 3300026095 Ga0207676_10245210 Ga0207676_102452102 244
210 3300026121 Ga0207683_10020692 Ga0207683_100206923 244
211 3300028380 Ga0268265_10467897 Ga0268265_104678972 244
212 3300044684 Ga0466966_0098119 Ga0466966_0098119_528_1274 244
213 3300044842 Ga0466957_0051029 Ga0466957_0051029_1624_2370 244
214 3300045836 Ga0466958_0134660 Ga0466958_0134660_357_1103 244
215 3300005335 Ga0070666_10171681 Ga0070666_101716812 245
216 3300005338 Ga0068868_100005469 Ga0068868_1000054698 245
217 3300005340 Ga0070689_100079398 Ga0070689_1000793982 245
218 3300005355 Ga0070671_100007945 Ga0070671_1000079452 245
219 3300005364 Ga0070673_100085947 Ga0070673_1000859473 245
220 3300005466 Ga0070685_10178542 Ga0070685_101785422 245
221 3300005617 Ga0068859_100190805 Ga0068859_1001908052 245
222 3300005618 Ga0068864_100048748 Ga0068864_1000487482 245
223 3300005843 Ga0068860_100030299 Ga0068860_1000302996 245
224 3300006237 Ga0097621_100619650 Ga0097621_1006196502 245
225 3300006358 Ga0068871_100012622 Ga0068871_1000126227 245
226 3300006881 Ga0068865_100045823 Ga0068865_1000458232 245
227 3300006931 Ga0097620_100190808 Ga0097620_1001908082 245
228 3300009101 Ga0105247_10209545 Ga0105247_102095452 245
229 3300009553 Ga0105249_10166444 Ga0105249_101664442 245
230 3300013308 Ga0157375_10540870 Ga0157375_105408702 245
231 3300014968 Ga0157379_10140951 Ga0157379_101409512 245
232 3300014969 Ga0157376_10074455 Ga0157376_100744552 245
233 3300017792 Ga0163161_10037101 Ga0163161_100371014 245
234 3300025941 Ga0207711_10054059 Ga0207711_100540592 245
235 3300025961 Ga0207712_10225509 Ga0207712_102255092 245
236 3300026023 Ga0207677_10009892 Ga0207677_100098922 245
237 3300026035 Ga0207703_10049939 Ga0207703_100499394 245
238 3300031730 Ga0307516_10003121 Ga0307516_100031217 245
239 3300044673 Ga0453683_0110722 Ga0453683_0110722_468_1223 245
240 3300003320 rootH2_10024155 rootH2_100241559 246
241 3300003323 rootH1_10340350 rootH1_103403502 246
242 3300005290 Ga0065712_10147099 Ga0065712_101470991 246
243 3300005327 Ga0070658_10073431 Ga0070658_100734313 246
244 3300005329 Ga0070683_100001393 Ga0070683_10000139313 246
245 3300005329 Ga0070683_100050104 Ga0070683_1000501044 246
246 3300005335 Ga0070666_10026432 Ga0070666_100264322 246
247 3300005337 Ga0070682_100000012 Ga0070682_100000012221 246
248 3300005337 Ga0070682_100026369 Ga0070682_1000263692 246
249 3300005338 Ga0068868_100056270 Ga0068868_1000562704 246
250 3300005338 Ga0068868_100099700 Ga0068868_1000997003 246
251 3300005339 Ga0070660_100005266 Ga0070660_1000052668 246
252 3300005339 Ga0070660_100191718 Ga0070660_1001917182 246
253 3300005340 Ga0070689_100038560 Ga0070689_1000385601 246
254 3300005344 Ga0070661_100000700 Ga0070661_10000070013 246
255 3300005344 Ga0070661_100003416 Ga0070661_1000034169 246
256 3300005354 Ga0070675_100248885 Ga0070675_1002488851 246
257 3300005364 Ga0070673_100019923 Ga0070673_1000199233 246
258 3300005366 Ga0070659_100009106 Ga0070659_1000091064 246
259 3300005366 Ga0070659_100032184 Ga0070659_1000321842 246
260 3300005367 Ga0070667_100098735 Ga0070667_1000987352 246
261 3300005457 Ga0070662_100022083 Ga0070662_1000220831 246
262 3300005458 Ga0070681_10064172 Ga0070681_100641724 246
263 3300005530 Ga0070679_100013971 Ga0070679_1000139715 246
264 3300005535 Ga0070684_100117524 Ga0070684_1001175242 246
265 3300005539 Ga0068853_100017442 Ga0068853_1000174425 246
266 3300005543 Ga0070672_100220793 Ga0070672_1002207932 246
267 3300005544 Ga0070686_100040163 Ga0070686_1000401632 246
268 3300005545 Ga0070695_100227279 Ga0070695_1002272792 246
269 3300005563 Ga0068855_100028580 Ga0068855_1000285802 246
270 3300005564 Ga0070664_100005564 Ga0070664_1000055644 246
271 3300005564 Ga0070664_100082492 Ga0070664_1000824922 246
272 3300005564 Ga0070664_100246631 Ga0070664_1002466312 246
273 3300005577 Ga0068857_100003941 Ga0068857_1000039418 246
274 3300005577 Ga0068857_100166170 Ga0068857_1001661702 246
275 3300005578 Ga0068854_100098102 Ga0068854_1000981022 246
276 3300005578 Ga0068854_100363306 Ga0068854_1003633062 246
277 3300005614 Ga0068856_100473026 Ga0068856_1004730261 246
278 3300005616 Ga0068852_100087619 Ga0068852_1000876194 246
279 3300005617 Ga0068859_100130180 Ga0068859_1001301802 246
280 3300005618 Ga0068864_100292944 Ga0068864_1002929442 246
281 3300005834 Ga0068851_10046563 Ga0068851_100465632 246
282 3300005834 Ga0068851_10203630 Ga0068851_102036302 246
283 3300005842 Ga0068858_100327988 Ga0068858_1003279882 246
284 3300005843 Ga0068860_100226041 Ga0068860_1002260412 246
285 3300005844 Ga0068862_100462952 Ga0068862_1004629521 246
286 3300006237 Ga0097621_100050834 Ga0097621_1000508343 246
287 3300006358 Ga0068871_100016455 Ga0068871_1000164556 246
288 3300006931 Ga0097620_100130180 Ga0097620_1001301802 246
289 3300009101 Ga0105247_10056073 Ga0105247_100560732 246
290 3300009174 Ga0105241_10587437 Ga0105241_105874371 246
291 3300011119 Ga0105246_10125187 Ga0105246_101251872 246
292 3300013100 Ga0157373_10027104 Ga0157373_100271042 246
293 3300013102 Ga0157371_10028168 Ga0157371_100281682 246
294 3300013102 Ga0157371_10226790 Ga0157371_102267902 246
295 3300013104 Ga0157370_10057896 Ga0157370_100578964 246
296 3300013105 Ga0157369_10103952 Ga0157369_101039524 246
297 3300013296 Ga0157374_10000002 Ga0157374_10000002761 246
298 3300013296 Ga0157374_10028260 Ga0157374_100282605 246
299 3300013296 Ga0157374_10075848 Ga0157374_100758482 246
300 3300013297 Ga0157378_10016010 Ga0157378_100160106 246
301 3300013297 Ga0157378_10242619 Ga0157378_102426192 246
302 3300013306 Ga0163162_10026814 Ga0163162_100268145 246
303 3300013306 Ga0163162_10042818 Ga0163162_100428182 246
304 3300013306 Ga0163162_10558987 Ga0163162_105589872 246
305 3300013307 Ga0157372_10091647 Ga0157372_100916474 246
306 3300013307 Ga0157372_10309332 Ga0157372_103093322 246
307 3300013308 Ga0157375_10210811 Ga0157375_102108112 246
308 3300013308 Ga0157375_10339856 Ga0157375_103398562 246
309 3300014325 Ga0163163_10114434 Ga0163163_101144342 246
310 3300014968 Ga0157379_10038921 Ga0157379_100389212 246
311 3300014968 Ga0157379_10145643 Ga0157379_101456432 246
312 3300014969 Ga0157376_10003940 Ga0157376_100039406 246
313 3300025912 Ga0207707_10048730 Ga0207707_100487304 246
314 3300025919 Ga0207657_10008310 Ga0207657_100083103 246
315 3300025919 Ga0207657_10167559 Ga0207657_101675592 246
316 3300025920 Ga0207649_10001123 Ga0207649_1000112310 246
317 3300025920 Ga0207649_10330703 Ga0207649_103307032 246
318 3300025921 Ga0207652_10077626 Ga0207652_100776262 246
319 3300025926 Ga0207659_10037849 Ga0207659_100378493 246
320 3300025932 Ga0207690_10003439 Ga0207690_100034395 246
321 3300025932 Ga0207690_10140376 Ga0207690_101403761 246
322 3300025933 Ga0207706_10001373 Ga0207706_1000137312 246
323 3300025933 Ga0207706_10041996 Ga0207706_100419962 246
324 3300025940 Ga0207691_10055044 Ga0207691_100550444 246
325 3300025944 Ga0207661_10001802 Ga0207661_1000180212 246
326 3300025944 Ga0207661_10059752 Ga0207661_100597524 246
327 3300025945 Ga0207679_10000768 Ga0207679_1000076810 246
328 3300025945 Ga0207679_10070675 Ga0207679_100706752 246
329 3300025945 Ga0207679_10190618 Ga0207679_101906182 246
330 3300025949 Ga0207667_10410123 Ga0207667_104101232 246
331 3300025981 Ga0207640_10159245 Ga0207640_101592452 246
332 3300025986 Ga0207658_10087994 Ga0207658_100879942 246
333 3300025986 Ga0207658_10142945 Ga0207658_101429452 246
334 3300026023 Ga0207677_10067814 Ga0207677_100678143 246
335 3300026035 Ga0207703_10050397 Ga0207703_100503974 246
336 3300026041 Ga0207639_10000365 Ga0207639_1000036529 246
337 3300026041 Ga0207639_10046303 Ga0207639_100463034 246
338 3300026078 Ga0207702_10115614 Ga0207702_101156142 246
339 3300026088 Ga0207641_10337564 Ga0207641_103375642 246
340 3300026116 Ga0207674_10005900 Ga0207674_100059009 246
341 3300026142 Ga0207698_10180666 Ga0207698_101806661 246
342 3300031251 Ga0265327_10000361 Ga0265327_1000036126 246
343 3300031507 Ga0307509_10031297 Ga0307509_100312974 246
344 3300035695 Ga0373927_0011502 Ga0373927_0011502_66_812 246
345 3300035725 Ga0373947_0057206 Ga0373947_0057206_338_1111 246
346 3300042876 Ga0451577_0510905 Ga0451577_0510905_138_878 246
347 3300044712 Ga0453684_0000204 Ga0453684_0000204_97538_98278 246
348 3300045051 Ga0451576_0132125 Ga0451576_0132125_632_1381 246
349 3300048913 Ga0496110_0396481 Ga0496110_0396481_310_1050 246
350 3300048915 Ga0496112_0372336 Ga0496112_0372336_297_1037 246
351 3300048916 Ga0496113_0562068 Ga0496113_0562068_78_860 246
352 3300053727 Ga0500611_000038 Ga0500611_000038_23155_23898 246
353 3300005295 Ga0065707_10184777 Ga0065707_101847772 247
354 3300005338 Ga0068868_100094229 Ga0068868_1000942292 247
355 3300005355 Ga0070671_100041427 Ga0070671_1000414272 247
356 3300005367 Ga0070667_100004183 Ga0070667_1000041834 247
357 3300005543 Ga0070672_100241208 Ga0070672_1002412082 247
358 3300005841 Ga0068863_100016141 Ga0068863_1000161413 247
359 3300006237 Ga0097621_100000036 Ga0097621_10000003648 247
360 3300006358 Ga0068871_100000032 Ga0068871_1000000322 247
361 3300009176 Ga0105242_10080593 Ga0105242_100805933 247
362 3300013297 Ga0157378_10012239 Ga0157378_100122395 247
363 3300013297 Ga0157378_10873904 Ga0157378_108739041 247
364 3300013306 Ga0163162_10001828 Ga0163162_1000182815 247
365 3300013308 Ga0157375_10000067 Ga0157375_1000006724 247
366 3300014968 Ga0157379_10011904 Ga0157379_100119044 247
367 3300014969 Ga0157376_10000874 Ga0157376_1000087412 247
368 3300017792 Ga0163161_10003173 Ga0163161_100031738 247
369 3300025931 Ga0207644_10027909 Ga0207644_100279094 247
370 3300025942 Ga0207689_10489238 Ga0207689_104892381 247
371 3300025986 Ga0207658_10096254 Ga0207658_100962542 247
372 3300026088 Ga0207641_10010477 Ga0207641_100104776 247
373 3300026089 Ga0207648_10820132 Ga0207648_108201321 247
374 3300028786 Ga0307517_10000658 Ga0307517_100006584 247
375 3300036401 Ga0373937_0034971 Ga0373937_0034971_2102_2941 247
376 3300048904 Ga0496101_0071604 Ga0496101_0071604_91_846 247
377 3300048908 Ga0496105_0246561 Ga0496105_0246561_483_1238 247
378 3300048913 Ga0496110_0199689 Ga0496110_0199689_88_843 247
379 3300048917 Ga0496114_0058194 Ga0496114_0058194_1086_1841 247
380 iso_pu_bacteria 2643221732 2644721746 247
381 iso_pu_bacteria 2818991465 2819708554 247
382 iso_pu_bacteria 2842882022 2842885786 247
383 iso_pu_bacteria 2904524088 2904528205 247
384 iso_pu_bacteria 2919143609 2919147724 247
385 iso_pu_bacteria 2919517244 2919521323 247
386 iso_pu_bacteria 2919720352 2919723980 247
387 iso_pu_bacteria 2928093941 2928098002 247
388 iso_pu_bacteria 2929004312 2929005182 247
389 iso_pu_bacteria 2960319331 2960322112 247
390 iso_pu_bacteria 2960375949 2960376798 247
391 iso_pu_bacteria 8022893055 8022895922 247
392 iso_pu_bacteria 8022914991 8022918869 247
393 iso_pu_bacteria 2643221543 2643741456 248
394 iso_pu_bacteria 8022792930 8022794202 248
395 iso_pu_bacteria 8057582654 8057585508 248
396 3300003320 rootH2_10319767 rootH2_103197671 249
397 3300005329 Ga0070683_100322716 Ga0070683_1003227161 249
398 3300005530 Ga0070679_100525426 Ga0070679_1005254262 249
399 3300005535 Ga0070684_100285018 Ga0070684_1002850182 249
400 3300025944 Ga0207661_10250826 Ga0207661_102508262 249
401 3300044765 Ga0466970_0319996 Ga0466970_0319996_101_865 249
402 3300045976 Ga0466967_0538482 Ga0466967_0538482_16_780 249
403 3300045976 Ga0466967_0580169 Ga0466967_0580169_89_853 249
404 3300048915 Ga0496112_0272147 Ga0496112_0272147_787_1551 249
405 iso_pu_bacteria 2738541299 2738837776 249
406 iso_pu_bacteria 2916971899 2916972260 249
407 3300042007 Ga0439449_0011903 Ga0439449_0011903_1626_2384 250
408 3300042007 Ga0439449_0016949 Ga0439449_0016949_841_1599 250
409 3300042014 Ga0439457_001854 Ga0439457_001854_2205_2963 250
410 3300044658 Ga0466972_0000091 Ga0466972_0000091_58701_59459 250
411 3300053090 Ga0500646_0022263 Ga0500646_0022263_454_1212 250
412 3300053147 Ga0500589_174808 Ga0500589_174808_44_802 250
413 iso_pu_bacteria 2864733723 2864738191 250
414 iso_pu_bacteria 2945991243 2945995019 250
415 3300003322 rootL2_10094034 rootL2_100940342 251
416 3300003323 rootH1_10035991 rootH1_1003599110 251
417 3300003323 rootH1_10230939 rootH1_102309392 251
418 3300005262 Ga0065165_1005778 Ga0065165_10057789 251
419 3300005331 Ga0070670_100621900 Ga0070670_1006219001 251
420 3300005338 Ga0068868_100004132 Ga0068868_1000041328 251
421 3300005355 Ga0070671_100013881 Ga0070671_1000138813 251
422 3300005457 Ga0070662_100187862 Ga0070662_1001878621 251
423 3300005834 Ga0068851_10065052 Ga0068851_100650522 251
424 3300005841 Ga0068863_100367197 Ga0068863_1003671972 251
425 3300005844 Ga0068862_100187025 Ga0068862_1001870251 251
426 3300006237 Ga0097621_100401761 Ga0097621_1004017612 251
427 3300009174 Ga0105241_10199962 Ga0105241_101999622 251
428 3300013100 Ga0157373_10110561 Ga0157373_101105612 251
429 3300013296 Ga0157374_10099088 Ga0157374_100990882 251
430 3300013297 Ga0157378_10007331 Ga0157378_100073314 251
431 3300013307 Ga0157372_10214053 Ga0157372_102140532 251
432 3300025321 Ga0207656_10070309 Ga0207656_100703092 251
433 3300025926 Ga0207659_10030111 Ga0207659_100301114 251
434 3300025931 Ga0207644_10068187 Ga0207644_100681873 251
435 3300025933 Ga0207706_10082824 Ga0207706_100828242 251
436 3300026023 Ga0207677_10004209 Ga0207677_100042097 251
437 3300026088 Ga0207641_10017352 Ga0207641_100173525 251
438 3300031456 Ga0307513_10072544 Ga0307513_100725445 251
439 3300031616 Ga0307508_10101932 Ga0307508_101019323 251
440 3300042876 Ga0451577_0172217 Ga0451577_0172217_572_1333 251
441 3300054114 Ga0501084_0198449 Ga0501084_0198449_862_1617 251
442 3300003187 JGI25151J46595_10001420 JGI25151J46595_1000142013 252
443 3300003187 JGI25151J46595_10002119 JGI25151J46595_100021198 252
444 3300005354 Ga0070675_100019755 Ga0070675_1000197552 252
445 3300005356 Ga0070674_100008870 Ga0070674_1000088703 252
446 3300005364 Ga0070673_100035730 Ga0070673_1000357302 252
447 3300005458 Ga0070681_10304831 Ga0070681_103048313 252
448 3300005459 Ga0068867_100222971 Ga0068867_1002229712 252
449 3300005539 Ga0068853_100036056 Ga0068853_1000360563 252
450 3300005543 Ga0070672_100070131 Ga0070672_1000701312 252
451 3300005563 Ga0068855_100245627 Ga0068855_1002456273 252
452 3300005564 Ga0070664_100016199 Ga0070664_1000161997 252
453 3300005577 Ga0068857_100065080 Ga0068857_1000650804 252
454 3300005840 Ga0068870_10193849 Ga0068870_101938491 252
455 3300009011 Ga0105251_10013407 Ga0105251_100134075 252
456 3300009092 Ga0105250_10004788 Ga0105250_100047883 252
457 3300009147 Ga0114129_10015792 Ga0114129_100157922 252
458 3300013308 Ga0157375_10709141 Ga0157375_107091412 252
459 3300025233 Ga0209437_101014 Ga0209437_1010146 252
460 3300025284 Ga0209130_1002569 Ga0209130_10025693 252
461 3300025294 Ga0209025_1001333 Ga0209025_100133310 252
462 3300025294 Ga0209025_1001933 Ga0209025_100193317 252
463 3300025893 Ga0207682_10053661 Ga0207682_100536612 252
464 3300025912 Ga0207707_10369596 Ga0207707_103695961 252
465 3300025940 Ga0207691_10017291 Ga0207691_100172913 252
466 3300025945 Ga0207679_10012834 Ga0207679_100128344 252
467 3300025960 Ga0207651_10187496 Ga0207651_101874962 252
468 3300026041 Ga0207639_10029347 Ga0207639_100293474 252
469 3300026078 Ga0207702_10453033 Ga0207702_104530332 252
470 3300026089 Ga0207648_10104363 Ga0207648_101043632 252
471 3300026121 Ga0207683_10071366 Ga0207683_100713663 252
472 3300041507 Ga0451851_1263769 Ga0451851_1263769_62_826 252
473 3300041512 Ga0451853_1864335 Ga0451853_1864335_482_1252 252
474 3300044656 Ga0466969_0000033 Ga0466969_0000033_75012_75779 252
475 3300044683 Ga0466965_0085848 Ga0466965_0085848_461_1225 252
476 3300044684 Ga0466966_0000170 Ga0466966_0000170_8772_9539 252
477 3300044706 Ga0466964_0079122 Ga0466964_0079122_82_849 252
478 3300044842 Ga0466957_0016172 Ga0466957_0016172_3201_3971 252
479 3300045049 Ga0466959_0000089 Ga0466959_0000089_8772_9539 252
480 3300046501 Ga0495607_0154262 Ga0495607_0154262_158_919 252
481 3300046514 Ga0495618_0249081 Ga0495618_0249081_226_1086 252
482 3300046516 Ga0495628_0170382 Ga0495628_0170382_97_957 252
483 3300048928 Ga0496125_0005442 Ga0496125_0005442_9575_10354 252
484 3300049571 Ga0501034_0453529 Ga0501034_0453529_17_787 252
485 3300049579 Ga0501043_0310944 Ga0501043_0310944_227_997 252
486 3300049581 Ga0501047_0019608 Ga0501047_0019608_1397_2167 252
487 3300049581 Ga0501047_0234421 Ga0501047_0234421_341_1105 252
488 3300049582 Ga0501048_0203724 Ga0501048_0203724_405_1175 252
489 3300049823 Ga0501044_0285660 Ga0501044_0285660_301_1071 252
490 3300050507 nmdc:mga05p37_9961_c1 nmdc:mga05p37_9961_c1_7633_8397 252
491 3300053086 Ga0500578_0017678 Ga0500578_0017678_950_1714 252
492 3300053092 Ga0500583_0000002 Ga0500583_0000002_167666_168430 252
493 3300053092 Ga0500583_0000356 Ga0500583_0000356_6217_6981 252
494 3300053131 Ga0500652_091503 Ga0500652_091503_313_1077 252
495 3300053134 Ga0500658_0086805 Ga0500658_0086805_183_947 252
496 3300053147 Ga0500589_007446 Ga0500589_007446_218_982 252
497 iso_pu_bacteria 2929297113 2929298080 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03746

LamB_YcsF

LamB/YcsF family

36

276

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v6t-assembly1.cif.gz_A crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 0.971 3 250
2dfa-assembly1.cif.gz_A crystal structure of lactam utilization protein from thermus thermophilus hb8 0.9692 3 251
2dfa-assembly1.cif.gz_A crystal structure of lactam utilization protein from thermus thermophilus hb8 0.9615 3 251
1xw8-assembly1.cif.gz_A-2 x-ray structure of putative lactam utilization protein ybgl. northeast structural genomics consortium target et90. 0.9558 3 252
2xu2-assembly1.cif.gz_A crystal structure of the hypothetical protein pa4511 from pseudomonas aeruginosa 0.955 4 239
ID Description Score Start End Superfamily
af_Q2FXX2_1_250_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9862 3 251 3.20.20.370
af_Q2FXX2_1_250_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9784 3 251 3.20.20.370
1v6tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.971 3 250 3.20.20.370
2dfaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9692 3 251 3.20.20.370
2dfaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9615 3 251 3.20.20.370
ID Description Score Start End GO Terms
AF-W1XZK8-F1-model_v4 LamB/YcsF family protein 0.9994 22 109 GO:0005975
AF-A0A0P9BCP6-F1-model_v4 LamB/YcsF family protein 0.9988 27 112 GO:0005975
AF-A0A382DYA8-F1-model_v4 LamB/YcsF family protein 0.9982 10 95 GO:0005975
AF-A0A847AW76-F1-model_v4 5-oxoprolinase subunit PxpA 0.998 1 149 GO:0005975
AF-A0A349HRB8-F1-model_v4 LamB/YcsF family protein 0.998 1 133 GO:0005975

Feature Viewer

pLDDT pTM Quality
93.53 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map