F455081
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 497 | 257 | 476 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300046514|Ga0495618_0249081|Ga0495618_0249081_226_1086 |
| Length | 286 |
| Sequence | VKKKIEKIKVTEQGNVPKVSPPKAEDLEGAGAEGAIDINCDMGEAIGNPALPAGRDEMIMSFISSANIACGYHAGNETIIRQTIQLAQKNNVAVGAHPSFFDKENFGRTEVNLPADEIYDIIILQLRLIKKIAKQQHAKLHHVKPHGALYNMSGKDPIIANAIANAVKDFDEDLILFGLSGSHSIKEAGLLNLKTASEVFADRTYQDDGSLTPRSQTNALIEDPAKSVIQALQMIKEGTVTSVNGNKISITADTVCIHGDGKNAIEFAKAIHEALQKEGFKIKAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 2 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 3 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 4 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 5 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 6 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 7 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 8 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 9 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 10 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 11 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 12 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 13 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 14 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 15 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 16 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 17 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 168 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 171 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 182 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 183 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 184 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 229 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 230 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 231 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 232 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 233 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 243 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 244 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 245 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 246 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 247 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 248 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 249 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 250 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 251 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 253 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 255 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 256 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 257 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.77 |
| Metatranscriptomes | 0 |
| Isolates | 4.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.23 |
| Nodule | 0 |
| Rhizoplane | 4.23 |
| Rhizosphere | 83.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10001420 | 3300003187 | Bacteria | 16379 |
| 2 | JGI25151J46595_10002119 | 3300003187 | Bacteria | 12377 |
| 3 | rootH2_10024155 | 3300003320 | Bacteria | 19843 |
| 4 | rootH2_10319767 | 3300003320 | Bacteria | 1494 |
| 5 | rootL2_10094034 | 3300003322 | Bacteria | 2936 |
| 6 | rootL2_10108260 | 3300003322 | Unclassified | 2349 |
| 7 | rootH1_10017103 | 3300003323 | Bacteria | 28716 |
| 8 | rootH1_10035991 | 3300003323 | Bacteria | 16103 |
| 9 | rootH1_10230939 | 3300003323 | Bacteria | 2084 |
| 10 | rootH1_10340350 | 3300003323 | Bacteria | 1286 |
| 11 | Ga0055528_1003292 | 3300003790 | Bacteria | 8212 |
| 12 | Ga0065165_1005778 | 3300005262 | Bacteria | 6767 |
| 13 | Ga0065712_10147099 | 3300005290 | Bacteria | 1364 |
| 14 | Ga0065715_10146333 | 3300005293 | Bacteria | 1784 |
| 15 | Ga0065707_10184777 | 3300005295 | Bacteria | 1395 |
| 16 | Ga0070658_10073431 | 3300005327 | Bacteria | 2805 |
| 17 | Ga0070676_10076056 | 3300005328 | Bacteria | 2026 |
| 18 | Ga0070676_10639609 | 3300005328 | Viruses | 771 |
| 19 | Ga0070683_100001393 | 3300005329 | Bacteria | 18553 |
| 20 | Ga0070683_100050104 | 3300005329 | Bacteria | 3864 |
| 21 | Ga0070683_100322716 | 3300005329 | Bacteria | 1470 |
| 22 | Ga0070690_100134608 | 3300005330 | Bacteria | 1672 |
| 23 | Ga0070670_100054817 | 3300005331 | Bacteria | 3423 |
| 24 | Ga0070670_100621900 | 3300005331 | Unclassified | 967 |
| 25 | Ga0070677_10239442 | 3300005333 | Bacteria | 895 |
| 26 | Ga0068869_100037162 | 3300005334 | Bacteria | 3462 |
| 27 | Ga0068869_100041343 | 3300005334 | Unclassified | 3301 |
| 28 | Ga0070666_10026432 | 3300005335 | Bacteria | 3792 |
| 29 | Ga0070666_10171681 | 3300005335 | Bacteria | 1519 |
| 30 | Ga0070666_10174048 | 3300005335 | Unclassified | 1508 |
| 31 | Ga0070682_100000012 | 3300005337 | Bacteria | 265658 |
| 32 | Ga0070682_100026369 | 3300005337 | Bacteria | 3477 |
| 33 | Ga0070682_100684937 | 3300005337 | Bacteria | 820 |
| 34 | Ga0068868_100004132 | 3300005338 | Bacteria | 10146 |
| 35 | Ga0068868_100005469 | 3300005338 | Bacteria | 8930 |
| 36 | Ga0068868_100056270 | 3300005338 | Bacteria | 3106 |
| 37 | Ga0068868_100094229 | 3300005338 | Unclassified | 2415 |
| 38 | Ga0068868_100099700 | 3300005338 | Bacteria | 2350 |
| 39 | Ga0068868_100228430 | 3300005338 | Bacteria | 1560 |
| 40 | Ga0070660_100005266 | 3300005339 | Bacteria | 8945 |
| 41 | Ga0070660_100191718 | 3300005339 | Unclassified | 1656 |
| 42 | Ga0070689_100038560 | 3300005340 | Unclassified | 3656 |
| 43 | Ga0070689_100079398 | 3300005340 | Bacteria | 2574 |
| 44 | Ga0070689_100172211 | 3300005340 | Bacteria | 1754 |
| 45 | Ga0070661_100000700 | 3300005344 | Bacteria | 24597 |
| 46 | Ga0070661_100003416 | 3300005344 | Bacteria | 10966 |
| 47 | Ga0070661_100350549 | 3300005344 | Bacteria | 1158 |
| 48 | Ga0070668_100016255 | 3300005347 | Bacteria | 5566 |
| 49 | Ga0070669_100007779 | 3300005353 | Bacteria | 7656 |
| 50 | Ga0070675_100018008 | 3300005354 | Bacteria | 5622 |
| 51 | Ga0070675_100019755 | 3300005354 | Bacteria | 5372 |
| 52 | Ga0070675_100248885 | 3300005354 | Unclassified | 1555 |
| 53 | Ga0070671_100007945 | 3300005355 | Bacteria | 8484 |
| 54 | Ga0070671_100013881 | 3300005355 | Bacteria | 6498 |
| 55 | Ga0070671_100041427 | 3300005355 | Unclassified | 3827 |
| 56 | Ga0070674_100008870 | 3300005356 | Bacteria | 6003 |
| 57 | Ga0070673_100019923 | 3300005364 | Bacteria | 4828 |
| 58 | Ga0070673_100035730 | 3300005364 | Unclassified | 3770 |
| 59 | Ga0070673_100085947 | 3300005364 | Bacteria | 2562 |
| 60 | Ga0070673_100090429 | 3300005364 | Bacteria | 2500 |
| 61 | Ga0070688_100015683 | 3300005365 | Bacteria | 4318 |
| 62 | Ga0070659_100009106 | 3300005366 | Bacteria | 7281 |
| 63 | Ga0070659_100032184 | 3300005366 | Bacteria | 4066 |
| 64 | Ga0070667_100004183 | 3300005367 | Bacteria | 12184 |
| 65 | Ga0070667_100075401 | 3300005367 | Bacteria | 2879 |
| 66 | Ga0070667_100098735 | 3300005367 | Unclassified | 2520 |
| 67 | Ga0070667_100157892 | 3300005367 | Bacteria | 1996 |
| 68 | Ga0070701_10226070 | 3300005438 | Bacteria | 1118 |
| 69 | Ga0070663_100461560 | 3300005455 | Bacteria | 1049 |
| 70 | Ga0070662_100006409 | 3300005457 | Bacteria | 7584 |
| 71 | Ga0070662_100022083 | 3300005457 | Bacteria | 4352 |
| 72 | Ga0070662_100039869 | 3300005457 | Bacteria | 3343 |
| 73 | Ga0070662_100187862 | 3300005457 | Bacteria | 1632 |
| 74 | Ga0070681_10064172 | 3300005458 | Bacteria | 3644 |
| 75 | Ga0070681_10304831 | 3300005458 | Bacteria | 1502 |
| 76 | Ga0070681_10519514 | 3300005458 | Bacteria | 1104 |
| 77 | Ga0068867_100040148 | 3300005459 | Bacteria | 3413 |
| 78 | Ga0068867_100154066 | 3300005459 | Bacteria | 1807 |
| 79 | Ga0068867_100222971 | 3300005459 | Unclassified | 1520 |
| 80 | Ga0070685_10178542 | 3300005466 | Bacteria | 1365 |
| 81 | Ga0070698_100252560 | 3300005471 | Bacteria | 1696 |
| 82 | Ga0070679_100013971 | 3300005530 | Bacteria | 7695 |
| 83 | Ga0070679_100525426 | 3300005530 | Bacteria | 1127 |
| 84 | Ga0070684_100117524 | 3300005535 | Bacteria | 2390 |
| 85 | Ga0070684_100285018 | 3300005535 | Bacteria | 1514 |
| 86 | Ga0068853_100015743 | 3300005539 | Bacteria | 6211 |
| 87 | Ga0068853_100017442 | 3300005539 | Bacteria | 5925 |
| 88 | Ga0068853_100036056 | 3300005539 | Bacteria | 4203 |
| 89 | Ga0068853_100340071 | 3300005539 | Bacteria | 1394 |
| 90 | Ga0068853_100516188 | 3300005539 | Bacteria | 1129 |
| 91 | Ga0070672_100042845 | 3300005543 | Bacteria | 3486 |
| 92 | Ga0070672_100070131 | 3300005543 | Unclassified | 2784 |
| 93 | Ga0070672_100130702 | 3300005543 | Bacteria | 2063 |
| 94 | Ga0070672_100220793 | 3300005543 | Unclassified | 1590 |
| 95 | Ga0070672_100241208 | 3300005543 | Unclassified | 1520 |
| 96 | Ga0070686_100040163 | 3300005544 | Bacteria | 2918 |
| 97 | Ga0070695_100227279 | 3300005545 | Unclassified | 1347 |
| 98 | Ga0070665_100000031 | 3300005548 | Bacteria | 333365 |
| 99 | Ga0070704_100701606 | 3300005549 | Bacteria | 897 |
| 100 | Ga0068855_100007582 | 3300005563 | Bacteria | 13129 |
| 101 | Ga0068855_100028580 | 3300005563 | Bacteria | 6671 |
| 102 | Ga0068855_100063838 | 3300005563 | Unclassified | 4296 |
| 103 | Ga0068855_100189333 | 3300005563 | Bacteria | 2322 |
| 104 | Ga0068855_100245627 | 3300005563 | Bacteria | 1998 |
| 105 | Ga0068855_100451875 | 3300005563 | Bacteria | 1402 |
| 106 | Ga0070664_100005564 | 3300005564 | Bacteria | 10120 |
| 107 | Ga0070664_100016199 | 3300005564 | Bacteria | 6109 |
| 108 | Ga0070664_100074704 | 3300005564 | Bacteria | 2909 |
| 109 | Ga0070664_100082492 | 3300005564 | Bacteria | 2773 |
| 110 | Ga0070664_100246631 | 3300005564 | Bacteria | 1604 |
| 111 | Ga0070664_100499196 | 3300005564 | Bacteria | 1121 |
| 112 | Ga0068857_100003941 | 3300005577 | Bacteria | 12494 |
| 113 | Ga0068857_100017630 | 3300005577 | Bacteria | 6261 |
| 114 | Ga0068857_100047104 | 3300005577 | Bacteria | 3827 |
| 115 | Ga0068857_100065080 | 3300005577 | Bacteria | 3241 |
| 116 | Ga0068857_100112015 | 3300005577 | Unclassified | 2453 |
| 117 | Ga0068857_100166170 | 3300005577 | Bacteria | 2004 |
| 118 | Ga0068854_100098102 | 3300005578 | Bacteria | 2192 |
| 119 | Ga0068854_100245329 | 3300005578 | Bacteria | 1428 |
| 120 | Ga0068854_100363306 | 3300005578 | Unclassified | 1188 |
| 121 | Ga0068856_100075154 | 3300005614 | Bacteria | 3347 |
| 122 | Ga0068856_100473026 | 3300005614 | Bacteria | 1274 |
| 123 | Ga0068852_100004088 | 3300005616 | Bacteria | 10268 |
| 124 | Ga0068852_100087619 | 3300005616 | Bacteria | 2778 |
| 125 | Ga0068859_100013961 | 3300005617 | Bacteria | 8056 |
| 126 | Ga0068859_100130180 | 3300005617 | Unclassified | 2587 |
| 127 | Ga0068859_100190805 | 3300005617 | Bacteria | 2133 |
| 128 | Ga0068859_100872356 | 3300005617 | Bacteria | 985 |
| 129 | Ga0068864_100048748 | 3300005618 | Bacteria | 3642 |
| 130 | Ga0068864_100154998 | 3300005618 | Bacteria | 2078 |
| 131 | Ga0068864_100290271 | 3300005618 | Bacteria | 1529 |
| 132 | Ga0068864_100290672 | 3300005618 | Bacteria | 1528 |
| 133 | Ga0068864_100292944 | 3300005618 | Bacteria | 1521 |
| 134 | Ga0068864_100540399 | 3300005618 | Bacteria | 1125 |
| 135 | Ga0068861_100002332 | 3300005719 | Bacteria | 12331 |
| 136 | Ga0068851_10046563 | 3300005834 | Bacteria | 2194 |
| 137 | Ga0068851_10065052 | 3300005834 | Bacteria | 1875 |
| 138 | Ga0068851_10203630 | 3300005834 | Bacteria | 1106 |
| 139 | Ga0068870_10193849 | 3300005840 | Bacteria | 1228 |
| 140 | Ga0068863_100016141 | 3300005841 | Bacteria | 7164 |
| 141 | Ga0068863_100367197 | 3300005841 | Bacteria | 1404 |
| 142 | Ga0068858_100327988 | 3300005842 | Bacteria | 1464 |
| 143 | Ga0068858_100400748 | 3300005842 | Bacteria | 1318 |
| 144 | Ga0068860_100030299 | 3300005843 | Bacteria | 5204 |
| 145 | Ga0068860_100053482 | 3300005843 | Unclassified | 3839 |
| 146 | Ga0068860_100072941 | 3300005843 | Bacteria | 3263 |
| 147 | Ga0068860_100226041 | 3300005843 | Bacteria | 1818 |
| 148 | Ga0068860_101000242 | 3300005843 | Unclassified | 854 |
| 149 | Ga0068862_100083954 | 3300005844 | Bacteria | 2766 |
| 150 | Ga0068862_100187025 | 3300005844 | Bacteria | 1862 |
| 151 | Ga0068862_100462952 | 3300005844 | Bacteria | 1197 |
| 152 | Ga0075366_10063296 | 3300006195 | Bacteria | 2199 |
| 153 | Ga0097621_100000036 | 3300006237 | Bacteria | 67999 |
| 154 | Ga0097621_100050834 | 3300006237 | Bacteria | 3371 |
| 155 | Ga0097621_100063614 | 3300006237 | Bacteria | 3033 |
| 156 | Ga0097621_100401761 | 3300006237 | Bacteria | 1227 |
| 157 | Ga0097621_100619650 | 3300006237 | Bacteria | 990 |
| 158 | Ga0068871_100000032 | 3300006358 | Bacteria | 73078 |
| 159 | Ga0068871_100012622 | 3300006358 | Bacteria | 6238 |
| 160 | Ga0068871_100016455 | 3300006358 | Bacteria | 5570 |
| 161 | Ga0068871_100062444 | 3300006358 | Unclassified | 3044 |
| 162 | Ga0068871_100737079 | 3300006358 | Unclassified | 905 |
| 163 | Ga0068865_100045823 | 3300006881 | Bacteria | 2999 |
| 164 | Ga0068865_100348412 | 3300006881 | Bacteria | 1199 |
| 165 | Ga0097620_100013961 | 3300006931 | Bacteria | 8056 |
| 166 | Ga0097620_100130180 | 3300006931 | Unclassified | 2587 |
| 167 | Ga0097620_100190808 | 3300006931 | Bacteria | 2133 |
| 168 | Ga0097620_100872324 | 3300006931 | Bacteria | 985 |
| 169 | Ga0105251_10013407 | 3300009011 | Bacteria | 4589 |
| 170 | Ga0105250_10004788 | 3300009092 | Bacteria | 6170 |
| 171 | Ga0111539_10122725 | 3300009094 | Bacteria | 3045 |
| 172 | Ga0105247_10056073 | 3300009101 | Unclassified | 2433 |
| 173 | Ga0105247_10122455 | 3300009101 | Bacteria | 1687 |
| 174 | Ga0105247_10209545 | 3300009101 | Bacteria | 1314 |
| 175 | Ga0114129_10015792 | 3300009147 | Bacteria | 10735 |
| 176 | Ga0105241_10199962 | 3300009174 | Bacteria | 1669 |
| 177 | Ga0105241_10587437 | 3300009174 | Unclassified | 1004 |
| 178 | Ga0105242_10007956 | 3300009176 | Bacteria | 8166 |
| 179 | Ga0105242_10018955 | 3300009176 | Bacteria | 5389 |
| 180 | Ga0105242_10080593 | 3300009176 | Unclassified | 2721 |
| 181 | Ga0105242_10208181 | 3300009176 | Unclassified | 1741 |
| 182 | Ga0105242_10296735 | 3300009176 | Bacteria | 1473 |
| 183 | Ga0105248_10057123 | 3300009177 | Unclassified | 4380 |
| 184 | Ga0105248_11123747 | 3300009177 | Bacteria | 888 |
| 185 | Ga0105237_10132199 | 3300009545 | Bacteria | 2490 |
| 186 | Ga0105238_10119441 | 3300009551 | Unclassified | 2616 |
| 187 | Ga0105249_10003194 | 3300009553 | Bacteria | 14183 |
| 188 | Ga0105249_10073440 | 3300009553 | Unclassified | 3164 |
| 189 | Ga0105249_10166444 | 3300009553 | Bacteria | 2134 |
| 190 | Ga0105249_10232241 | 3300009553 | Unclassified | 1820 |
| 191 | Ga0105249_10414820 | 3300009553 | Bacteria | 1379 |
| 192 | Ga0105249_10534229 | 3300009553 | Bacteria | 1222 |
| 193 | Ga0105239_10001192 | 3300010375 | Bacteria | 35572 |
| 194 | Ga0105246_10025518 | 3300011119 | Bacteria | 3853 |
| 195 | Ga0105246_10125187 | 3300011119 | Unclassified | 1911 |
| 196 | Ga0157373_10027104 | 3300013100 | Bacteria | 4134 |
| 197 | Ga0157373_10110561 | 3300013100 | Bacteria | 1932 |
| 198 | Ga0157371_10028168 | 3300013102 | Bacteria | 4070 |
| 199 | Ga0157371_10067388 | 3300013102 | Bacteria | 2534 |
| 200 | Ga0157371_10226790 | 3300013102 | Bacteria | 1342 |
| 201 | Ga0157371_10326562 | 3300013102 | Bacteria | 1114 |
| 202 | Ga0157370_10057896 | 3300013104 | Bacteria | 3683 |
| 203 | Ga0157370_10070798 | 3300013104 | Unclassified | 3292 |
| 204 | Ga0157369_10010532 | 3300013105 | Bacteria | 10524 |
| 205 | Ga0157369_10103952 | 3300013105 | Unclassified | 3026 |
| 206 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 207 | Ga0157374_10028260 | 3300013296 | Bacteria | 5066 |
| 208 | Ga0157374_10059289 | 3300013296 | Bacteria | 3578 |
| 209 | Ga0157374_10075848 | 3300013296 | Bacteria | 3178 |
| 210 | Ga0157374_10099088 | 3300013296 | Bacteria | 2791 |
| 211 | Ga0157374_10113291 | 3300013296 | Bacteria | 2610 |
| 212 | Ga0157378_10007331 | 3300013297 | Bacteria | 9634 |
| 213 | Ga0157378_10012239 | 3300013297 | Bacteria | 7513 |
| 214 | Ga0157378_10016010 | 3300013297 | Bacteria | 6567 |
| 215 | Ga0157378_10242619 | 3300013297 | Unclassified | 1722 |
| 216 | Ga0157378_10873904 | 3300013297 | Bacteria | 928 |
| 217 | Ga0163162_10000167 | 3300013306 | Bacteria | 60620 |
| 218 | Ga0163162_10001828 | 3300013306 | Bacteria | 20026 |
| 219 | Ga0163162_10026814 | 3300013306 | Bacteria | 5697 |
| 220 | Ga0163162_10042818 | 3300013306 | Unclassified | 4533 |
| 221 | Ga0163162_10069572 | 3300013306 | Unclassified | 3571 |
| 222 | Ga0163162_10128471 | 3300013306 | Bacteria | 2642 |
| 223 | Ga0163162_10366370 | 3300013306 | Bacteria | 1574 |
| 224 | Ga0163162_10558987 | 3300013306 | Unclassified | 1272 |
| 225 | Ga0157372_10091647 | 3300013307 | Bacteria | 3457 |
| 226 | Ga0157372_10188958 | 3300013307 | Unclassified | 2385 |
| 227 | Ga0157372_10214053 | 3300013307 | Bacteria | 2233 |
| 228 | Ga0157372_10309332 | 3300013307 | Bacteria | 1839 |
| 229 | Ga0157372_10445279 | 3300013307 | Unclassified | 1510 |
| 230 | Ga0157375_10000067 | 3300013308 | Bacteria | 110313 |
| 231 | Ga0157375_10143036 | 3300013308 | Bacteria | 2520 |
| 232 | Ga0157375_10146105 | 3300013308 | Bacteria | 2495 |
| 233 | Ga0157375_10210811 | 3300013308 | Bacteria | 2100 |
| 234 | Ga0157375_10339856 | 3300013308 | Bacteria | 1667 |
| 235 | Ga0157375_10540870 | 3300013308 | Bacteria | 1327 |
| 236 | Ga0157375_10709141 | 3300013308 | Unclassified | 1159 |
| 237 | Ga0163163_10001587 | 3300014325 | Bacteria | 19117 |
| 238 | Ga0163163_10105540 | 3300014325 | Bacteria | 2843 |
| 239 | Ga0163163_10114434 | 3300014325 | Bacteria | 2728 |
| 240 | Ga0157380_10070077 | 3300014326 | Bacteria | 2832 |
| 241 | Ga0157377_10003672 | 3300014745 | Bacteria | 6963 |
| 242 | Ga0157377_10005666 | 3300014745 | Bacteria | 5886 |
| 243 | Ga0157379_10011904 | 3300014968 | Bacteria | 7602 |
| 244 | Ga0157379_10038921 | 3300014968 | Unclassified | 4242 |
| 245 | Ga0157379_10140951 | 3300014968 | Bacteria | 2173 |
| 246 | Ga0157379_10145643 | 3300014968 | Unclassified | 2136 |
| 247 | Ga0157376_10000874 | 3300014969 | Bacteria | 19764 |
| 248 | Ga0157376_10003940 | 3300014969 | Bacteria | 10269 |
| 249 | Ga0157376_10074455 | 3300014969 | Bacteria | 2894 |
| 250 | Ga0163161_10003173 | 3300017792 | Bacteria | 11597 |
| 251 | Ga0163161_10010716 | 3300017792 | Bacteria | 6349 |
| 252 | Ga0163161_10037101 | 3300017792 | Bacteria | 3493 |
| 253 | Ga0209437_101014 | 3300025233 | Bacteria | 9707 |
| 254 | Ga0209673_1005807 | 3300025273 | Bacteria | 6124 |
| 255 | Ga0209130_1002569 | 3300025284 | Bacteria | 8844 |
| 256 | Ga0209025_1001333 | 3300025294 | Bacteria | 33361 |
| 257 | Ga0209025_1001933 | 3300025294 | Bacteria | 23996 |
| 258 | Ga0209025_1010964 | 3300025294 | Bacteria | 6056 |
| 259 | Ga0207697_10035585 | 3300025315 | Bacteria | 2038 |
| 260 | Ga0207656_10070309 | 3300025321 | Bacteria | 1554 |
| 261 | Ga0207696_1039328 | 3300025711 | Bacteria | 1392 |
| 262 | Ga0207655_1047176 | 3300025728 | Bacteria | 1780 |
| 263 | Ga0207713_1015758 | 3300025735 | Bacteria | 3864 |
| 264 | Ga0207682_10053661 | 3300025893 | Unclassified | 1672 |
| 265 | Ga0207682_10184605 | 3300025893 | Bacteria | 954 |
| 266 | Ga0207680_10156521 | 3300025903 | Unclassified | 1524 |
| 267 | Ga0207647_10034826 | 3300025904 | Unclassified | 3211 |
| 268 | Ga0207645_10114227 | 3300025907 | Bacteria | 1750 |
| 269 | Ga0207707_10048730 | 3300025912 | Bacteria | 3690 |
| 270 | Ga0207707_10369596 | 3300025912 | Bacteria | 1234 |
| 271 | Ga0207671_10080519 | 3300025914 | Bacteria | 2441 |
| 272 | Ga0207657_10008310 | 3300025919 | Bacteria | 10562 |
| 273 | Ga0207657_10167559 | 3300025919 | Unclassified | 1781 |
| 274 | Ga0207649_10001123 | 3300025920 | Bacteria | 16235 |
| 275 | Ga0207649_10330703 | 3300025920 | Bacteria | 1122 |
| 276 | Ga0207652_10077626 | 3300025921 | Bacteria | 2898 |
| 277 | Ga0207681_10003075 | 3300025923 | Bacteria | 10485 |
| 278 | Ga0207694_10064947 | 3300025924 | Unclassified | 2845 |
| 279 | Ga0207650_10038354 | 3300025925 | Bacteria | 3498 |
| 280 | Ga0207659_10030111 | 3300025926 | Unclassified | 3705 |
| 281 | Ga0207659_10037849 | 3300025926 | Bacteria | 3352 |
| 282 | Ga0207659_10098873 | 3300025926 | Bacteria | 2195 |
| 283 | Ga0207644_10023105 | 3300025931 | Bacteria | 4255 |
| 284 | Ga0207644_10027909 | 3300025931 | Unclassified | 3902 |
| 285 | Ga0207644_10068187 | 3300025931 | Unclassified | 2595 |
| 286 | Ga0207690_10003439 | 3300025932 | Bacteria | 9449 |
| 287 | Ga0207690_10140376 | 3300025932 | Bacteria | 1779 |
| 288 | Ga0207706_10001373 | 3300025933 | Bacteria | 24327 |
| 289 | Ga0207706_10016620 | 3300025933 | Bacteria | 6641 |
| 290 | Ga0207706_10017036 | 3300025933 | Bacteria | 6555 |
| 291 | Ga0207706_10041996 | 3300025933 | Unclassified | 4052 |
| 292 | Ga0207706_10082824 | 3300025933 | Bacteria | 2820 |
| 293 | Ga0207686_10621135 | 3300025934 | Unclassified | 852 |
| 294 | Ga0207670_10275290 | 3300025936 | Unclassified | 1310 |
| 295 | Ga0207691_10017291 | 3300025940 | Bacteria | 6839 |
| 296 | Ga0207691_10055044 | 3300025940 | Unclassified | 3627 |
| 297 | Ga0207691_10301869 | 3300025940 | Bacteria | 1376 |
| 298 | Ga0207691_10538308 | 3300025940 | Bacteria | 991 |
| 299 | Ga0207711_10054059 | 3300025941 | Bacteria | 3444 |
| 300 | Ga0207689_10057184 | 3300025942 | Unclassified | 3208 |
| 301 | Ga0207689_10489238 | 3300025942 | Unclassified | 1030 |
| 302 | Ga0207661_10001802 | 3300025944 | Bacteria | 14637 |
| 303 | Ga0207661_10059752 | 3300025944 | Bacteria | 3073 |
| 304 | Ga0207661_10250826 | 3300025944 | Bacteria | 1573 |
| 305 | Ga0207679_10000768 | 3300025945 | Bacteria | 21047 |
| 306 | Ga0207679_10012834 | 3300025945 | Bacteria | 5478 |
| 307 | Ga0207679_10038248 | 3300025945 | Bacteria | 3417 |
| 308 | Ga0207679_10070675 | 3300025945 | Bacteria | 2631 |
| 309 | Ga0207679_10190618 | 3300025945 | Bacteria | 1704 |
| 310 | Ga0207667_10008843 | 3300025949 | Bacteria | 11920 |
| 311 | Ga0207667_10391299 | 3300025949 | Bacteria | 1416 |
| 312 | Ga0207667_10410123 | 3300025949 | Bacteria | 1379 |
| 313 | Ga0207667_10649862 | 3300025949 | Bacteria | 1060 |
| 314 | Ga0207651_10068231 | 3300025960 | Bacteria | 2506 |
| 315 | Ga0207651_10187496 | 3300025960 | Unclassified | 1647 |
| 316 | Ga0207712_10042337 | 3300025961 | Unclassified | 3135 |
| 317 | Ga0207712_10048725 | 3300025961 | Bacteria | 2948 |
| 318 | Ga0207712_10225509 | 3300025961 | Bacteria | 1501 |
| 319 | Ga0207712_10614603 | 3300025961 | Bacteria | 941 |
| 320 | Ga0207668_10151619 | 3300025972 | Bacteria | 1795 |
| 321 | Ga0207640_10159245 | 3300025981 | Bacteria | 1668 |
| 322 | Ga0207640_10261369 | 3300025981 | Bacteria | 1349 |
| 323 | Ga0207658_10087994 | 3300025986 | Bacteria | 2400 |
| 324 | Ga0207658_10096254 | 3300025986 | Unclassified | 2308 |
| 325 | Ga0207658_10142945 | 3300025986 | Unclassified | 1939 |
| 326 | Ga0207658_10264163 | 3300025986 | Bacteria | 1468 |
| 327 | Ga0207677_10004209 | 3300026023 | Bacteria | 7705 |
| 328 | Ga0207677_10009892 | 3300026023 | Bacteria | 5376 |
| 329 | Ga0207677_10067814 | 3300026023 | Bacteria | 2501 |
| 330 | Ga0207677_10266812 | 3300026023 | Unclassified | 1398 |
| 331 | Ga0207677_10426843 | 3300026023 | Bacteria | 1130 |
| 332 | Ga0207703_10049939 | 3300026035 | Bacteria | 3383 |
| 333 | Ga0207703_10050397 | 3300026035 | Unclassified | 3370 |
| 334 | Ga0207639_10000365 | 3300026041 | Bacteria | 31332 |
| 335 | Ga0207639_10016811 | 3300026041 | Bacteria | 5182 |
| 336 | Ga0207639_10029347 | 3300026041 | Bacteria | 4025 |
| 337 | Ga0207639_10046303 | 3300026041 | Bacteria | 3281 |
| 338 | Ga0207702_10115614 | 3300026078 | Bacteria | 2393 |
| 339 | Ga0207702_10453033 | 3300026078 | Bacteria | 1245 |
| 340 | Ga0207641_10010477 | 3300026088 | Bacteria | 7613 |
| 341 | Ga0207641_10017352 | 3300026088 | Bacteria | 5893 |
| 342 | Ga0207641_10337564 | 3300026088 | Bacteria | 1433 |
| 343 | Ga0207648_10015759 | 3300026089 | Bacteria | 6934 |
| 344 | Ga0207648_10104363 | 3300026089 | Unclassified | 2486 |
| 345 | Ga0207648_10211885 | 3300026089 | Bacteria | 1720 |
| 346 | Ga0207648_10341409 | 3300026089 | Bacteria | 1348 |
| 347 | Ga0207648_10820132 | 3300026089 | Bacteria | 867 |
| 348 | Ga0207676_10245210 | 3300026095 | Bacteria | 1610 |
| 349 | Ga0207676_10704242 | 3300026095 | Bacteria | 979 |
| 350 | Ga0207674_10005900 | 3300026116 | Bacteria | 14502 |
| 351 | Ga0207674_10018901 | 3300026116 | Bacteria | 7472 |
| 352 | Ga0207674_10192846 | 3300026116 | Unclassified | 1987 |
| 353 | Ga0207674_10323012 | 3300026116 | Bacteria | 1493 |
| 354 | Ga0207675_100000051 | 3300026118 | Bacteria | 83288 |
| 355 | Ga0207683_10020692 | 3300026121 | Bacteria | 5629 |
| 356 | Ga0207683_10071366 | 3300026121 | Unclassified | 3070 |
| 357 | Ga0207698_10180666 | 3300026142 | Bacteria | 1869 |
| 358 | Ga0207428_10061235 | 3300027907 | Bacteria | 2980 |
| 359 | Ga0268266_10000088 | 3300028379 | Bacteria | 199029 |
| 360 | Ga0268265_10467897 | 3300028380 | Unclassified | 1181 |
| 361 | Ga0268264_10304129 | 3300028381 | Bacteria | 1502 |
| 362 | Ga0307517_10000658 | 3300028786 | Bacteria | 59357 |
| 363 | Ga0265327_10000361 | 3300031251 | Bacteria | 86574 |
| 364 | Ga0307513_10072544 | 3300031456 | Bacteria | 3588 |
| 365 | Ga0307509_10031297 | 3300031507 | Bacteria | 5876 |
| 366 | Ga0307408_100057628 | 3300031548 | Unclassified | 2821 |
| 367 | Ga0307508_10101932 | 3300031616 | Unclassified | 2467 |
| 368 | Ga0307516_10003121 | 3300031730 | Bacteria | 21554 |
| 369 | Ga0307410_10156791 | 3300031852 | Bacteria | 1701 |
| 370 | Ga0307406_10102331 | 3300031901 | Unclassified | 1954 |
| 371 | Ga0307406_10812865 | 3300031901 | Bacteria | 790 |
| 372 | Ga0307407_10015437 | 3300031903 | Unclassified | 3775 |
| 373 | Ga0307416_100341806 | 3300032002 | Bacteria | 1510 |
| 374 | Ga0373945_0108609 | 3300035116 | Bacteria | 1093 |
| 375 | Ga0373927_0011502 | 3300035695 | Bacteria | 5897 |
| 376 | Ga0373947_0057206 | 3300035725 | Bacteria | 2359 |
| 377 | Ga0373937_0034971 | 3300036401 | Bacteria | 4570 |
| 378 | Ga0395901_0658275 | 3300038443 | Bacteria | 1050 |
| 379 | Ga0451851_1263769 | 3300041507 | Bacteria | 918 |
| 380 | Ga0451853_1864335 | 3300041512 | Bacteria | 1536 |
| 381 | Ga0439449_0011903 | 3300042007 | Bacteria | 3271 |
| 382 | Ga0439449_0016949 | 3300042007 | Bacteria | 2735 |
| 383 | Ga0439457_001854 | 3300042014 | Bacteria | 6236 |
| 384 | Ga0451577_0172217 | 3300042876 | Bacteria | 1951 |
| 385 | Ga0451577_0510905 | 3300042876 | Unclassified | 1091 |
| 386 | Ga0466969_0000033 | 3300044656 | Bacteria | 82227 |
| 387 | Ga0466972_0000091 | 3300044658 | Bacteria | 81829 |
| 388 | Ga0453683_0110722 | 3300044673 | Bacteria | 1727 |
| 389 | Ga0466965_0085848 | 3300044683 | Bacteria | 1596 |
| 390 | Ga0466966_0000170 | 3300044684 | Bacteria | 42809 |
| 391 | Ga0466966_0098119 | 3300044684 | Bacteria | 1814 |
| 392 | Ga0466964_0079122 | 3300044706 | Bacteria | 1407 |
| 393 | Ga0453684_0000204 | 3300044712 | Bacteria | 258105 |
| 394 | Ga0453684_0000298 | 3300044712 | Bacteria | 209777 |
| 395 | Ga0453684_0001219 | 3300044712 | Bacteria | 78962 |
| 396 | Ga0453684_0017707 | 3300044712 | Bacteria | 11007 |
| 397 | Ga0453684_0099853 | 3300044712 | Unclassified | 3554 |
| 398 | Ga0466971_0036463 | 3300044719 | Unclassified | 2205 |
| 399 | Ga0466970_0319996 | 3300044765 | Bacteria | 877 |
| 400 | Ga0466957_0016172 | 3300044842 | Bacteria | 4362 |
| 401 | Ga0466957_0051029 | 3300044842 | Bacteria | 2518 |
| 402 | Ga0466959_0000089 | 3300045049 | Bacteria | 57482 |
| 403 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 404 | Ga0451576_0132125 | 3300045051 | Bacteria | 2602 |
| 405 | Ga0466958_0134660 | 3300045836 | Bacteria | 1553 |
| 406 | Ga0466967_0076020 | 3300045976 | Bacteria | 3020 |
| 407 | Ga0466967_0482228 | 3300045976 | Bacteria | 1215 |
| 408 | Ga0466967_0538482 | 3300045976 | Bacteria | 1148 |
| 409 | Ga0466967_0580169 | 3300045976 | Bacteria | 1105 |
| 410 | Ga0495603_0038084 | 3300046455 | Bacteria | 2884 |
| 411 | Ga0495629_0530974 | 3300046459 | Bacteria | 791 |
| 412 | Ga0495638_0089154 | 3300046460 | Bacteria | 1861 |
| 413 | Ga0495584_0056449 | 3300046491 | Bacteria | 1976 |
| 414 | Ga0495585_0119339 | 3300046492 | Bacteria | 1396 |
| 415 | Ga0495607_0154262 | 3300046501 | Bacteria | 1173 |
| 416 | Ga0495618_0249081 | 3300046514 | Unclassified | 1115 |
| 417 | Ga0495628_0170382 | 3300046516 | Unclassified | 1651 |
| 418 | Ga0495628_0510353 | 3300046516 | Bacteria | 867 |
| 419 | Ga0495648_0002082 | 3300046524 | Bacteria | 18925 |
| 420 | Ga0495622_0073208 | 3300046557 | Bacteria | 1581 |
| 421 | Ga0495634_0151574 | 3300046642 | Unclassified | 1466 |
| 422 | Ga0495611_0028122 | 3300046648 | Bacteria | 2461 |
| 423 | Ga0495687_000079 | 3300047443 | Bacteria | 147704 |
| 424 | Ga0496100_0012350 | 3300048903 | Bacteria | 4893 |
| 425 | Ga0496101_0005710 | 3300048904 | Bacteria | 7946 |
| 426 | Ga0496101_0071604 | 3300048904 | Unclassified | 2542 |
| 427 | Ga0496102_0078579 | 3300048905 | Bacteria | 3037 |
| 428 | Ga0496103_0019396 | 3300048906 | Bacteria | 4083 |
| 429 | Ga0496104_0002984 | 3300048907 | Bacteria | 14585 |
| 430 | Ga0496105_0005097 | 3300048908 | Bacteria | 9958 |
| 431 | Ga0496105_0246561 | 3300048908 | Unclassified | 1448 |
| 432 | Ga0496106_0001147 | 3300048909 | Bacteria | 19624 |
| 433 | Ga0496107_0002022 | 3300048910 | Bacteria | 12940 |
| 434 | Ga0496108_0000646 | 3300048911 | Bacteria | 27125 |
| 435 | Ga0496109_0000705 | 3300048912 | Bacteria | 27776 |
| 436 | Ga0496110_0007717 | 3300048913 | Bacteria | 8609 |
| 437 | Ga0496110_0199689 | 3300048913 | Unclassified | 1817 |
| 438 | Ga0496110_0396481 | 3300048913 | Unclassified | 1258 |
| 439 | Ga0496111_0000613 | 3300048914 | Bacteria | 18849 |
| 440 | Ga0496112_0272147 | 3300048915 | Bacteria | 1642 |
| 441 | Ga0496112_0372336 | 3300048915 | Unclassified | 1370 |
| 442 | Ga0496113_0020298 | 3300048916 | Bacteria | 4669 |
| 443 | Ga0496113_0562068 | 3300048916 | Bacteria | 915 |
| 444 | Ga0496114_0058194 | 3300048917 | Unclassified | 3227 |
| 445 | Ga0496116_0022002 | 3300048919 | Bacteria | 4794 |
| 446 | Ga0496117_0052619 | 3300048920 | Bacteria | 2867 |
| 447 | Ga0496119_0003051 | 3300048922 | Bacteria | 17722 |
| 448 | Ga0496120_0017801 | 3300048923 | Bacteria | 4594 |
| 449 | Ga0496122_0020261 | 3300048925 | Bacteria | 6021 |
| 450 | Ga0496125_0003796 | 3300048928 | Bacteria | 17966 |
| 451 | Ga0496125_0005442 | 3300048928 | Bacteria | 14152 |
| 452 | Ga0496126_0096996 | 3300048929 | Bacteria | 2584 |
| 453 | Ga0501034_0453529 | 3300049571 | Bacteria | 1200 |
| 454 | Ga0501043_0310944 | 3300049579 | Bacteria | 1203 |
| 455 | Ga0501047_0019608 | 3300049581 | Bacteria | 6490 |
| 456 | Ga0501047_0234421 | 3300049581 | Bacteria | 1687 |
| 457 | Ga0501048_0203724 | 3300049582 | Bacteria | 1403 |
| 458 | Ga0501044_0285660 | 3300049823 | Bacteria | 1582 |
| 459 | nmdc:mga05p37_9961_c1 | 3300050507 | Bacteria | 11286 |
| 460 | nmdc:mga08y16_55707_c1 | 3300050511 | Bacteria | 4131 |
| 461 | Ga0500578_0017678 | 3300053086 | Bacteria | 4582 |
| 462 | Ga0500646_0022263 | 3300053090 | Unclassified | 1695 |
| 463 | Ga0500583_0000002 | 3300053092 | Bacteria | 232826 |
| 464 | Ga0500583_0000356 | 3300053092 | Bacteria | 15053 |
| 465 | Ga0500583_0039745 | 3300053092 | Bacteria | 2126 |
| 466 | Ga0500642_0002836 | 3300053130 | Bacteria | 5145 |
| 467 | Ga0500652_091503 | 3300053131 | Bacteria | 1270 |
| 468 | Ga0500658_0086805 | 3300053134 | Bacteria | 1347 |
| 469 | Ga0500568_0005606 | 3300053139 | Bacteria | 6464 |
| 470 | Ga0500589_007446 | 3300053147 | Bacteria | 4476 |
| 471 | Ga0500589_174808 | 3300053147 | Bacteria | 850 |
| 472 | Ga0500622_0002067 | 3300053156 | Bacteria | 14955 |
| 473 | Ga0500622_0117710 | 3300053156 | Bacteria | 1292 |
| 474 | Ga0500636_0287036 | 3300053177 | Bacteria | 818 |
| 475 | Ga0500611_000038 | 3300053727 | Bacteria | 71407 |
| 476 | Ga0501084_0198449 | 3300054114 | Bacteria | 1693 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0530974 | Ga0495629_0530974_21_584 | 187 |
| 2 | 3300044719 | Ga0466971_0036463 | Ga0466971_0036463_56_688 | 206 |
| 3 | 3300053156 | Ga0500622_0117710 | Ga0500622_0117710_612_1235 | 207 |
| 4 | 3300009553 | Ga0105249_10534229 | Ga0105249_105342292 | 220 |
| 5 | 3300005563 | Ga0068855_100189333 | Ga0068855_1001893332 | 224 |
| 6 | 3300005564 | Ga0070664_100499196 | Ga0070664_1004991961 | 224 |
| 7 | 3300006358 | Ga0068871_100737079 | Ga0068871_1007370791 | 225 |
| 8 | 3300013306 | Ga0163162_10366370 | Ga0163162_103663702 | 225 |
| 9 | 3300014325 | Ga0163163_10105540 | Ga0163163_101055402 | 225 |
| 10 | 3300026095 | Ga0207676_10704242 | Ga0207676_107042422 | 225 |
| 11 | 3300005367 | Ga0070667_100157892 | Ga0070667_1001578923 | 227 |
| 12 | 3300005843 | Ga0068860_101000242 | Ga0068860_1010002421 | 227 |
| 13 | 3300009177 | Ga0105248_11123747 | Ga0105248_111237472 | 227 |
| 14 | 3300025986 | Ga0207658_10264163 | Ga0207658_102641632 | 227 |
| 15 | 3300035116 | Ga0373945_0108609 | Ga0373945_0108609_82_768 | 227 |
| 16 | 3300005330 | Ga0070690_100134608 | Ga0070690_1001346082 | 230 |
| 17 | 3300005331 | Ga0070670_100054817 | Ga0070670_1000548172 | 230 |
| 18 | 3300005539 | Ga0068853_100015743 | Ga0068853_1000157435 | 230 |
| 19 | 3300005618 | Ga0068864_100540399 | Ga0068864_1005403992 | 230 |
| 20 | 3300009553 | Ga0105249_10414820 | Ga0105249_104148202 | 230 |
| 21 | 3300014325 | Ga0163163_10001587 | Ga0163163_100015872 | 230 |
| 22 | 3300025925 | Ga0207650_10038354 | Ga0207650_100383542 | 230 |
| 23 | 3300025961 | Ga0207712_10614603 | Ga0207712_106146032 | 230 |
| 24 | 3300026041 | Ga0207639_10016811 | Ga0207639_100168114 | 230 |
| 25 | 3300005293 | Ga0065715_10146333 | Ga0065715_101463332 | 231 |
| 26 | 3300005333 | Ga0070677_10239442 | Ga0070677_102394421 | 231 |
| 27 | 3300005353 | Ga0070669_100007779 | Ga0070669_1000077797 | 231 |
| 28 | 3300005549 | Ga0070704_100701606 | Ga0070704_1007016061 | 231 |
| 29 | 3300025981 | Ga0207640_10261369 | Ga0207640_102613692 | 231 |
| 30 | 3300044712 | Ga0453684_0000298 | Ga0453684_0000298_107856_108596 | 232 |
| 31 | 3300045051 | Ga0451576_0000033 | Ga0451576_0000033_284536_285276 | 232 |
| 32 | 3300003790 | Ga0055528_1003292 | Ga0055528_100329210 | 233 |
| 33 | 3300005337 | Ga0070682_100684937 | Ga0070682_1006849371 | 233 |
| 34 | 3300005618 | Ga0068864_100290672 | Ga0068864_1002906721 | 233 |
| 35 | 3300009101 | Ga0105247_10122455 | Ga0105247_101224552 | 233 |
| 36 | 3300009176 | Ga0105242_10007956 | Ga0105242_100079563 | 233 |
| 37 | 3300011119 | Ga0105246_10025518 | Ga0105246_100255183 | 233 |
| 38 | 3300013296 | Ga0157374_10113291 | Ga0157374_101132913 | 233 |
| 39 | 3300014745 | Ga0157377_10005666 | Ga0157377_100056667 | 233 |
| 40 | 3300025273 | Ga0209673_1005807 | Ga0209673_10058076 | 233 |
| 41 | 3300025294 | Ga0209025_1010964 | Ga0209025_10109644 | 233 |
| 42 | 3300025711 | Ga0207696_1039328 | Ga0207696_10393282 | 233 |
| 43 | 3300025728 | Ga0207655_1047176 | Ga0207655_10471762 | 233 |
| 44 | 3300025735 | Ga0207713_1015758 | Ga0207713_10157584 | 233 |
| 45 | 3300046455 | Ga0495603_0038084 | Ga0495603_0038084_809_1564 | 233 |
| 46 | 3300046491 | Ga0495584_0056449 | Ga0495584_0056449_1033_1788 | 233 |
| 47 | 3300046492 | Ga0495585_0119339 | Ga0495585_0119339_609_1364 | 233 |
| 48 | 3300046557 | Ga0495622_0073208 | Ga0495622_0073208_658_1413 | 233 |
| 49 | 3300048903 | Ga0496100_0012350 | Ga0496100_0012350_692_1447 | 233 |
| 50 | 3300048904 | Ga0496101_0005710 | Ga0496101_0005710_3402_4157 | 233 |
| 51 | 3300048905 | Ga0496102_0078579 | Ga0496102_0078579_310_1065 | 233 |
| 52 | 3300048906 | Ga0496103_0019396 | Ga0496103_0019396_3296_4051 | 233 |
| 53 | 3300048907 | Ga0496104_0002984 | Ga0496104_0002984_626_1381 | 233 |
| 54 | 3300048908 | Ga0496105_0005097 | Ga0496105_0005097_6294_7049 | 233 |
| 55 | 3300048909 | Ga0496106_0001147 | Ga0496106_0001147_437_1192 | 233 |
| 56 | 3300048910 | Ga0496107_0002022 | Ga0496107_0002022_11749_12504 | 233 |
| 57 | 3300048911 | Ga0496108_0000646 | Ga0496108_0000646_25780_26535 | 233 |
| 58 | 3300048912 | Ga0496109_0000705 | Ga0496109_0000705_10875_11630 | 233 |
| 59 | 3300048913 | Ga0496110_0007717 | Ga0496110_0007717_7417_8172 | 233 |
| 60 | 3300048914 | Ga0496111_0000613 | Ga0496111_0000613_820_1575 | 233 |
| 61 | 3300048916 | Ga0496113_0020298 | Ga0496113_0020298_3882_4637 | 233 |
| 62 | 3300048919 | Ga0496116_0022002 | Ga0496116_0022002_499_1254 | 233 |
| 63 | 3300048920 | Ga0496117_0052619 | Ga0496117_0052619_354_1109 | 233 |
| 64 | 3300048922 | Ga0496119_0003051 | Ga0496119_0003051_16148_16903 | 233 |
| 65 | 3300048923 | Ga0496120_0017801 | Ga0496120_0017801_3483_4238 | 233 |
| 66 | 3300048925 | Ga0496122_0020261 | Ga0496122_0020261_1971_2726 | 233 |
| 67 | 3300048928 | Ga0496125_0003796 | Ga0496125_0003796_16392_17147 | 233 |
| 68 | 3300048929 | Ga0496126_0096996 | Ga0496126_0096996_437_1192 | 233 |
| 69 | 3300038443 | Ga0395901_0658275 | Ga0395901_0658275_222_941 | 234 |
| 70 | 3300005458 | Ga0070681_10519514 | Ga0070681_105195141 | 235 |
| 71 | 3300009553 | Ga0105249_10232241 | Ga0105249_102322413 | 235 |
| 72 | 3300025934 | Ga0207686_10621135 | Ga0207686_106211351 | 235 |
| 73 | 3300025942 | Ga0207689_10057184 | Ga0207689_100571843 | 235 |
| 74 | 3300044712 | Ga0453684_0017707 | Ga0453684_0017707_9257_10027 | 235 |
| 75 | 3300005335 | Ga0070666_10174048 | Ga0070666_101740482 | 236 |
| 76 | 3300005344 | Ga0070661_100350549 | Ga0070661_1003505492 | 236 |
| 77 | 3300005539 | Ga0068853_100516188 | Ga0068853_1005161881 | 236 |
| 78 | 3300005543 | Ga0070672_100130702 | Ga0070672_1001307022 | 236 |
| 79 | 3300005548 | Ga0070665_100000031 | Ga0070665_100000031260 | 236 |
| 80 | 3300005563 | Ga0068855_100063838 | Ga0068855_1000638384 | 236 |
| 81 | 3300005577 | Ga0068857_100112015 | Ga0068857_1001120153 | 236 |
| 82 | 3300005616 | Ga0068852_100004088 | Ga0068852_1000040885 | 236 |
| 83 | 3300009176 | Ga0105242_10296735 | Ga0105242_102967351 | 236 |
| 84 | 3300009551 | Ga0105238_10119441 | Ga0105238_101194412 | 236 |
| 85 | 3300010375 | Ga0105239_10001192 | Ga0105239_100011925 | 236 |
| 86 | 3300013104 | Ga0157370_10070798 | Ga0157370_100707982 | 236 |
| 87 | 3300013105 | Ga0157369_10010532 | Ga0157369_100105327 | 236 |
| 88 | 3300013307 | Ga0157372_10188958 | Ga0157372_101889581 | 236 |
| 89 | 3300025903 | Ga0207680_10156521 | Ga0207680_101565212 | 236 |
| 90 | 3300025904 | Ga0207647_10034826 | Ga0207647_100348262 | 236 |
| 91 | 3300025924 | Ga0207694_10064947 | Ga0207694_100649472 | 236 |
| 92 | 3300025940 | Ga0207691_10538308 | Ga0207691_105383081 | 236 |
| 93 | 3300025949 | Ga0207667_10649862 | Ga0207667_106498622 | 236 |
| 94 | 3300026116 | Ga0207674_10192846 | Ga0207674_101928462 | 236 |
| 95 | 3300028379 | Ga0268266_10000088 | Ga0268266_10000088153 | 236 |
| 96 | 3300003322 | rootL2_10108260 | rootL2_101082602 | 237 |
| 97 | 3300005334 | Ga0068869_100041343 | Ga0068869_1000413433 | 237 |
| 98 | 3300005340 | Ga0070689_100172211 | Ga0070689_1001722112 | 237 |
| 99 | 3300005367 | Ga0070667_100075401 | Ga0070667_1000754012 | 237 |
| 100 | 3300005455 | Ga0070663_100461560 | Ga0070663_1004615602 | 237 |
| 101 | 3300005617 | Ga0068859_100013961 | Ga0068859_1000139614 | 237 |
| 102 | 3300005618 | Ga0068864_100154998 | Ga0068864_1001549982 | 237 |
| 103 | 3300005842 | Ga0068858_100400748 | Ga0068858_1004007482 | 237 |
| 104 | 3300005843 | Ga0068860_100053482 | Ga0068860_1000534823 | 237 |
| 105 | 3300006237 | Ga0097621_100063614 | Ga0097621_1000636142 | 237 |
| 106 | 3300006358 | Ga0068871_100062444 | Ga0068871_1000624442 | 237 |
| 107 | 3300006931 | Ga0097620_100013961 | Ga0097620_1000139614 | 237 |
| 108 | 3300013102 | Ga0157371_10067388 | Ga0157371_100673882 | 237 |
| 109 | 3300013307 | Ga0157372_10445279 | Ga0157372_104452792 | 237 |
| 110 | 3300013308 | Ga0157375_10146105 | Ga0157375_101461051 | 237 |
| 111 | 3300025961 | Ga0207712_10042337 | Ga0207712_100423373 | 237 |
| 112 | 3300028381 | Ga0268264_10304129 | Ga0268264_103041292 | 237 |
| 113 | 3300045976 | Ga0466967_0076020 | Ga0466967_0076020_787_1500 | 237 |
| 114 | 3300046516 | Ga0495628_0510353 | Ga0495628_0510353_142_855 | 237 |
| 115 | 3300046642 | Ga0495634_0151574 | Ga0495634_0151574_743_1456 | 237 |
| 116 | 3300005563 | Ga0068855_100451875 | Ga0068855_1004518752 | 238 |
| 117 | 3300009545 | Ga0105237_10132199 | Ga0105237_101321993 | 238 |
| 118 | 3300013306 | Ga0163162_10000167 | Ga0163162_1000016717 | 238 |
| 119 | 3300025914 | Ga0207671_10080519 | Ga0207671_100805192 | 238 |
| 120 | 3300025949 | Ga0207667_10391299 | Ga0207667_103912992 | 238 |
| 121 | 3300047443 | Ga0495687_000079 | Ga0495687_000079_131336_132061 | 238 |
| 122 | 3300046460 | Ga0495638_0089154 | Ga0495638_0089154_980_1708 | 239 |
| 123 | 3300046524 | Ga0495648_0002082 | Ga0495648_0002082_5973_6701 | 239 |
| 124 | 3300046648 | Ga0495611_0028122 | Ga0495611_0028122_1229_1957 | 239 |
| 125 | 3300053092 | Ga0500583_0039745 | Ga0500583_0039745_54_782 | 239 |
| 126 | 3300053130 | Ga0500642_0002836 | Ga0500642_0002836_3207_3935 | 239 |
| 127 | 3300053139 | Ga0500568_0005606 | Ga0500568_0005606_4448_5176 | 239 |
| 128 | 3300053156 | Ga0500622_0002067 | Ga0500622_0002067_11100_11828 | 239 |
| 129 | 3300005328 | Ga0070676_10076056 | Ga0070676_100760562 | 240 |
| 130 | 3300005334 | Ga0068869_100037162 | Ga0068869_1000371622 | 240 |
| 131 | 3300005347 | Ga0070668_100016255 | Ga0070668_1000162555 | 240 |
| 132 | 3300005354 | Ga0070675_100018008 | Ga0070675_1000180084 | 240 |
| 133 | 3300005364 | Ga0070673_100090429 | Ga0070673_1000904292 | 240 |
| 134 | 3300005365 | Ga0070688_100015683 | Ga0070688_1000156832 | 240 |
| 135 | 3300005438 | Ga0070701_10226070 | Ga0070701_102260702 | 240 |
| 136 | 3300005457 | Ga0070662_100039869 | Ga0070662_1000398694 | 240 |
| 137 | 3300005543 | Ga0070672_100042845 | Ga0070672_1000428452 | 240 |
| 138 | 3300005577 | Ga0068857_100047104 | Ga0068857_1000471042 | 240 |
| 139 | 3300005578 | Ga0068854_100245329 | Ga0068854_1002453292 | 240 |
| 140 | 3300005617 | Ga0068859_100872356 | Ga0068859_1008723562 | 240 |
| 141 | 3300005719 | Ga0068861_100002332 | Ga0068861_10000233213 | 240 |
| 142 | 3300005844 | Ga0068862_100083954 | Ga0068862_1000839542 | 240 |
| 143 | 3300006881 | Ga0068865_100348412 | Ga0068865_1003484122 | 240 |
| 144 | 3300006931 | Ga0097620_100872324 | Ga0097620_1008723242 | 240 |
| 145 | 3300009094 | Ga0111539_10122725 | Ga0111539_101227252 | 240 |
| 146 | 3300009553 | Ga0105249_10003194 | Ga0105249_100031946 | 240 |
| 147 | 3300013306 | Ga0163162_10128471 | Ga0163162_101284713 | 240 |
| 148 | 3300013308 | Ga0157375_10143036 | Ga0157375_101430362 | 240 |
| 149 | 3300014326 | Ga0157380_10070077 | Ga0157380_100700773 | 240 |
| 150 | 3300014745 | Ga0157377_10003672 | Ga0157377_100036725 | 240 |
| 151 | 3300025315 | Ga0207697_10035585 | Ga0207697_100355852 | 240 |
| 152 | 3300025893 | Ga0207682_10184605 | Ga0207682_101846052 | 240 |
| 153 | 3300025907 | Ga0207645_10114227 | Ga0207645_101142272 | 240 |
| 154 | 3300025923 | Ga0207681_10003075 | Ga0207681_100030756 | 240 |
| 155 | 3300025926 | Ga0207659_10098873 | Ga0207659_100988732 | 240 |
| 156 | 3300025933 | Ga0207706_10016620 | Ga0207706_100166204 | 240 |
| 157 | 3300025940 | Ga0207691_10301869 | Ga0207691_103018692 | 240 |
| 158 | 3300025960 | Ga0207651_10068231 | Ga0207651_100682312 | 240 |
| 159 | 3300025961 | Ga0207712_10048725 | Ga0207712_100487252 | 240 |
| 160 | 3300025972 | Ga0207668_10151619 | Ga0207668_101516192 | 240 |
| 161 | 3300026116 | Ga0207674_10323012 | Ga0207674_103230122 | 240 |
| 162 | 3300026118 | Ga0207675_100000051 | Ga0207675_10000005134 | 240 |
| 163 | 3300027907 | Ga0207428_10061235 | Ga0207428_100612353 | 240 |
| 164 | 3300031901 | Ga0307406_10812865 | Ga0307406_108128651 | 240 |
| 165 | 3300050511 | nmdc:mga08y16_55707_c1 | nmdc:mga08y16_55707_c1_2800_3522 | 240 |
| 166 | 3300003323 | rootH1_10017103 | rootH1_1001710323 | 241 |
| 167 | 3300045976 | Ga0466967_0482228 | Ga0466967_0482228_91_816 | 241 |
| 168 | 3300053177 | Ga0500636_0287036 | Ga0500636_0287036_76_807 | 241 |
| 169 | 3300005539 | Ga0068853_100340071 | Ga0068853_1003400712 | 242 |
| 170 | 3300025936 | Ga0207670_10275290 | Ga0207670_102752901 | 242 |
| 171 | 3300044712 | Ga0453684_0001219 | Ga0453684_0001219_9472_10215 | 242 |
| 172 | 3300044712 | Ga0453684_0099853 | Ga0453684_0099853_1000_1734 | 242 |
| 173 | 3300005471 | Ga0070698_100252560 | Ga0070698_1002525602 | 243 |
| 174 | 3300005563 | Ga0068855_100007582 | Ga0068855_1000075825 | 243 |
| 175 | 3300005577 | Ga0068857_100017630 | Ga0068857_1000176303 | 243 |
| 176 | 3300005614 | Ga0068856_100075154 | Ga0068856_1000751543 | 243 |
| 177 | 3300006195 | Ga0075366_10063296 | Ga0075366_100632962 | 243 |
| 178 | 3300025949 | Ga0207667_10008843 | Ga0207667_100088437 | 243 |
| 179 | 3300026116 | Ga0207674_10018901 | Ga0207674_100189014 | 243 |
| 180 | 3300031548 | Ga0307408_100057628 | Ga0307408_1000576282 | 243 |
| 181 | 3300031852 | Ga0307410_10156791 | Ga0307410_101567912 | 243 |
| 182 | 3300031901 | Ga0307406_10102331 | Ga0307406_101023312 | 243 |
| 183 | 3300031903 | Ga0307407_10015437 | Ga0307407_100154373 | 243 |
| 184 | 3300032002 | Ga0307416_100341806 | Ga0307416_1003418062 | 243 |
| 185 | 3300005328 | Ga0070676_10639609 | Ga0070676_106396091 | 244 |
| 186 | 3300005338 | Ga0068868_100228430 | Ga0068868_1002284301 | 244 |
| 187 | 3300005457 | Ga0070662_100006409 | Ga0070662_1000064098 | 244 |
| 188 | 3300005459 | Ga0068867_100040148 | Ga0068867_1000401483 | 244 |
| 189 | 3300005459 | Ga0068867_100154066 | Ga0068867_1001540662 | 244 |
| 190 | 3300005564 | Ga0070664_100074704 | Ga0070664_1000747041 | 244 |
| 191 | 3300005618 | Ga0068864_100290271 | Ga0068864_1002902712 | 244 |
| 192 | 3300005843 | Ga0068860_100072941 | Ga0068860_1000729413 | 244 |
| 193 | 3300009176 | Ga0105242_10018955 | Ga0105242_100189555 | 244 |
| 194 | 3300009176 | Ga0105242_10208181 | Ga0105242_102081812 | 244 |
| 195 | 3300009177 | Ga0105248_10057123 | Ga0105248_100571233 | 244 |
| 196 | 3300009553 | Ga0105249_10073440 | Ga0105249_100734402 | 244 |
| 197 | 3300013102 | Ga0157371_10326562 | Ga0157371_103265621 | 244 |
| 198 | 3300013296 | Ga0157374_10059289 | Ga0157374_100592893 | 244 |
| 199 | 3300013306 | Ga0163162_10069572 | Ga0163162_100695723 | 244 |
| 200 | 3300017792 | Ga0163161_10010716 | Ga0163161_100107162 | 244 |
| 201 | 3300025931 | Ga0207644_10023105 | Ga0207644_100231052 | 244 |
| 202 | 3300025933 | Ga0207706_10017036 | Ga0207706_100170366 | 244 |
| 203 | 3300025945 | Ga0207679_10038248 | Ga0207679_100382483 | 244 |
| 204 | 3300026023 | Ga0207677_10266812 | Ga0207677_102668122 | 244 |
| 205 | 3300026023 | Ga0207677_10426843 | Ga0207677_104268432 | 244 |
| 206 | 3300026089 | Ga0207648_10015759 | Ga0207648_100157593 | 244 |
| 207 | 3300026089 | Ga0207648_10211885 | Ga0207648_102118852 | 244 |
| 208 | 3300026089 | Ga0207648_10341409 | Ga0207648_103414092 | 244 |
| 209 | 3300026095 | Ga0207676_10245210 | Ga0207676_102452102 | 244 |
| 210 | 3300026121 | Ga0207683_10020692 | Ga0207683_100206923 | 244 |
| 211 | 3300028380 | Ga0268265_10467897 | Ga0268265_104678972 | 244 |
| 212 | 3300044684 | Ga0466966_0098119 | Ga0466966_0098119_528_1274 | 244 |
| 213 | 3300044842 | Ga0466957_0051029 | Ga0466957_0051029_1624_2370 | 244 |
| 214 | 3300045836 | Ga0466958_0134660 | Ga0466958_0134660_357_1103 | 244 |
| 215 | 3300005335 | Ga0070666_10171681 | Ga0070666_101716812 | 245 |
| 216 | 3300005338 | Ga0068868_100005469 | Ga0068868_1000054698 | 245 |
| 217 | 3300005340 | Ga0070689_100079398 | Ga0070689_1000793982 | 245 |
| 218 | 3300005355 | Ga0070671_100007945 | Ga0070671_1000079452 | 245 |
| 219 | 3300005364 | Ga0070673_100085947 | Ga0070673_1000859473 | 245 |
| 220 | 3300005466 | Ga0070685_10178542 | Ga0070685_101785422 | 245 |
| 221 | 3300005617 | Ga0068859_100190805 | Ga0068859_1001908052 | 245 |
| 222 | 3300005618 | Ga0068864_100048748 | Ga0068864_1000487482 | 245 |
| 223 | 3300005843 | Ga0068860_100030299 | Ga0068860_1000302996 | 245 |
| 224 | 3300006237 | Ga0097621_100619650 | Ga0097621_1006196502 | 245 |
| 225 | 3300006358 | Ga0068871_100012622 | Ga0068871_1000126227 | 245 |
| 226 | 3300006881 | Ga0068865_100045823 | Ga0068865_1000458232 | 245 |
| 227 | 3300006931 | Ga0097620_100190808 | Ga0097620_1001908082 | 245 |
| 228 | 3300009101 | Ga0105247_10209545 | Ga0105247_102095452 | 245 |
| 229 | 3300009553 | Ga0105249_10166444 | Ga0105249_101664442 | 245 |
| 230 | 3300013308 | Ga0157375_10540870 | Ga0157375_105408702 | 245 |
| 231 | 3300014968 | Ga0157379_10140951 | Ga0157379_101409512 | 245 |
| 232 | 3300014969 | Ga0157376_10074455 | Ga0157376_100744552 | 245 |
| 233 | 3300017792 | Ga0163161_10037101 | Ga0163161_100371014 | 245 |
| 234 | 3300025941 | Ga0207711_10054059 | Ga0207711_100540592 | 245 |
| 235 | 3300025961 | Ga0207712_10225509 | Ga0207712_102255092 | 245 |
| 236 | 3300026023 | Ga0207677_10009892 | Ga0207677_100098922 | 245 |
| 237 | 3300026035 | Ga0207703_10049939 | Ga0207703_100499394 | 245 |
| 238 | 3300031730 | Ga0307516_10003121 | Ga0307516_100031217 | 245 |
| 239 | 3300044673 | Ga0453683_0110722 | Ga0453683_0110722_468_1223 | 245 |
| 240 | 3300003320 | rootH2_10024155 | rootH2_100241559 | 246 |
| 241 | 3300003323 | rootH1_10340350 | rootH1_103403502 | 246 |
| 242 | 3300005290 | Ga0065712_10147099 | Ga0065712_101470991 | 246 |
| 243 | 3300005327 | Ga0070658_10073431 | Ga0070658_100734313 | 246 |
| 244 | 3300005329 | Ga0070683_100001393 | Ga0070683_10000139313 | 246 |
| 245 | 3300005329 | Ga0070683_100050104 | Ga0070683_1000501044 | 246 |
| 246 | 3300005335 | Ga0070666_10026432 | Ga0070666_100264322 | 246 |
| 247 | 3300005337 | Ga0070682_100000012 | Ga0070682_100000012221 | 246 |
| 248 | 3300005337 | Ga0070682_100026369 | Ga0070682_1000263692 | 246 |
| 249 | 3300005338 | Ga0068868_100056270 | Ga0068868_1000562704 | 246 |
| 250 | 3300005338 | Ga0068868_100099700 | Ga0068868_1000997003 | 246 |
| 251 | 3300005339 | Ga0070660_100005266 | Ga0070660_1000052668 | 246 |
| 252 | 3300005339 | Ga0070660_100191718 | Ga0070660_1001917182 | 246 |
| 253 | 3300005340 | Ga0070689_100038560 | Ga0070689_1000385601 | 246 |
| 254 | 3300005344 | Ga0070661_100000700 | Ga0070661_10000070013 | 246 |
| 255 | 3300005344 | Ga0070661_100003416 | Ga0070661_1000034169 | 246 |
| 256 | 3300005354 | Ga0070675_100248885 | Ga0070675_1002488851 | 246 |
| 257 | 3300005364 | Ga0070673_100019923 | Ga0070673_1000199233 | 246 |
| 258 | 3300005366 | Ga0070659_100009106 | Ga0070659_1000091064 | 246 |
| 259 | 3300005366 | Ga0070659_100032184 | Ga0070659_1000321842 | 246 |
| 260 | 3300005367 | Ga0070667_100098735 | Ga0070667_1000987352 | 246 |
| 261 | 3300005457 | Ga0070662_100022083 | Ga0070662_1000220831 | 246 |
| 262 | 3300005458 | Ga0070681_10064172 | Ga0070681_100641724 | 246 |
| 263 | 3300005530 | Ga0070679_100013971 | Ga0070679_1000139715 | 246 |
| 264 | 3300005535 | Ga0070684_100117524 | Ga0070684_1001175242 | 246 |
| 265 | 3300005539 | Ga0068853_100017442 | Ga0068853_1000174425 | 246 |
| 266 | 3300005543 | Ga0070672_100220793 | Ga0070672_1002207932 | 246 |
| 267 | 3300005544 | Ga0070686_100040163 | Ga0070686_1000401632 | 246 |
| 268 | 3300005545 | Ga0070695_100227279 | Ga0070695_1002272792 | 246 |
| 269 | 3300005563 | Ga0068855_100028580 | Ga0068855_1000285802 | 246 |
| 270 | 3300005564 | Ga0070664_100005564 | Ga0070664_1000055644 | 246 |
| 271 | 3300005564 | Ga0070664_100082492 | Ga0070664_1000824922 | 246 |
| 272 | 3300005564 | Ga0070664_100246631 | Ga0070664_1002466312 | 246 |
| 273 | 3300005577 | Ga0068857_100003941 | Ga0068857_1000039418 | 246 |
| 274 | 3300005577 | Ga0068857_100166170 | Ga0068857_1001661702 | 246 |
| 275 | 3300005578 | Ga0068854_100098102 | Ga0068854_1000981022 | 246 |
| 276 | 3300005578 | Ga0068854_100363306 | Ga0068854_1003633062 | 246 |
| 277 | 3300005614 | Ga0068856_100473026 | Ga0068856_1004730261 | 246 |
| 278 | 3300005616 | Ga0068852_100087619 | Ga0068852_1000876194 | 246 |
| 279 | 3300005617 | Ga0068859_100130180 | Ga0068859_1001301802 | 246 |
| 280 | 3300005618 | Ga0068864_100292944 | Ga0068864_1002929442 | 246 |
| 281 | 3300005834 | Ga0068851_10046563 | Ga0068851_100465632 | 246 |
| 282 | 3300005834 | Ga0068851_10203630 | Ga0068851_102036302 | 246 |
| 283 | 3300005842 | Ga0068858_100327988 | Ga0068858_1003279882 | 246 |
| 284 | 3300005843 | Ga0068860_100226041 | Ga0068860_1002260412 | 246 |
| 285 | 3300005844 | Ga0068862_100462952 | Ga0068862_1004629521 | 246 |
| 286 | 3300006237 | Ga0097621_100050834 | Ga0097621_1000508343 | 246 |
| 287 | 3300006358 | Ga0068871_100016455 | Ga0068871_1000164556 | 246 |
| 288 | 3300006931 | Ga0097620_100130180 | Ga0097620_1001301802 | 246 |
| 289 | 3300009101 | Ga0105247_10056073 | Ga0105247_100560732 | 246 |
| 290 | 3300009174 | Ga0105241_10587437 | Ga0105241_105874371 | 246 |
| 291 | 3300011119 | Ga0105246_10125187 | Ga0105246_101251872 | 246 |
| 292 | 3300013100 | Ga0157373_10027104 | Ga0157373_100271042 | 246 |
| 293 | 3300013102 | Ga0157371_10028168 | Ga0157371_100281682 | 246 |
| 294 | 3300013102 | Ga0157371_10226790 | Ga0157371_102267902 | 246 |
| 295 | 3300013104 | Ga0157370_10057896 | Ga0157370_100578964 | 246 |
| 296 | 3300013105 | Ga0157369_10103952 | Ga0157369_101039524 | 246 |
| 297 | 3300013296 | Ga0157374_10000002 | Ga0157374_10000002761 | 246 |
| 298 | 3300013296 | Ga0157374_10028260 | Ga0157374_100282605 | 246 |
| 299 | 3300013296 | Ga0157374_10075848 | Ga0157374_100758482 | 246 |
| 300 | 3300013297 | Ga0157378_10016010 | Ga0157378_100160106 | 246 |
| 301 | 3300013297 | Ga0157378_10242619 | Ga0157378_102426192 | 246 |
| 302 | 3300013306 | Ga0163162_10026814 | Ga0163162_100268145 | 246 |
| 303 | 3300013306 | Ga0163162_10042818 | Ga0163162_100428182 | 246 |
| 304 | 3300013306 | Ga0163162_10558987 | Ga0163162_105589872 | 246 |
| 305 | 3300013307 | Ga0157372_10091647 | Ga0157372_100916474 | 246 |
| 306 | 3300013307 | Ga0157372_10309332 | Ga0157372_103093322 | 246 |
| 307 | 3300013308 | Ga0157375_10210811 | Ga0157375_102108112 | 246 |
| 308 | 3300013308 | Ga0157375_10339856 | Ga0157375_103398562 | 246 |
| 309 | 3300014325 | Ga0163163_10114434 | Ga0163163_101144342 | 246 |
| 310 | 3300014968 | Ga0157379_10038921 | Ga0157379_100389212 | 246 |
| 311 | 3300014968 | Ga0157379_10145643 | Ga0157379_101456432 | 246 |
| 312 | 3300014969 | Ga0157376_10003940 | Ga0157376_100039406 | 246 |
| 313 | 3300025912 | Ga0207707_10048730 | Ga0207707_100487304 | 246 |
| 314 | 3300025919 | Ga0207657_10008310 | Ga0207657_100083103 | 246 |
| 315 | 3300025919 | Ga0207657_10167559 | Ga0207657_101675592 | 246 |
| 316 | 3300025920 | Ga0207649_10001123 | Ga0207649_1000112310 | 246 |
| 317 | 3300025920 | Ga0207649_10330703 | Ga0207649_103307032 | 246 |
| 318 | 3300025921 | Ga0207652_10077626 | Ga0207652_100776262 | 246 |
| 319 | 3300025926 | Ga0207659_10037849 | Ga0207659_100378493 | 246 |
| 320 | 3300025932 | Ga0207690_10003439 | Ga0207690_100034395 | 246 |
| 321 | 3300025932 | Ga0207690_10140376 | Ga0207690_101403761 | 246 |
| 322 | 3300025933 | Ga0207706_10001373 | Ga0207706_1000137312 | 246 |
| 323 | 3300025933 | Ga0207706_10041996 | Ga0207706_100419962 | 246 |
| 324 | 3300025940 | Ga0207691_10055044 | Ga0207691_100550444 | 246 |
| 325 | 3300025944 | Ga0207661_10001802 | Ga0207661_1000180212 | 246 |
| 326 | 3300025944 | Ga0207661_10059752 | Ga0207661_100597524 | 246 |
| 327 | 3300025945 | Ga0207679_10000768 | Ga0207679_1000076810 | 246 |
| 328 | 3300025945 | Ga0207679_10070675 | Ga0207679_100706752 | 246 |
| 329 | 3300025945 | Ga0207679_10190618 | Ga0207679_101906182 | 246 |
| 330 | 3300025949 | Ga0207667_10410123 | Ga0207667_104101232 | 246 |
| 331 | 3300025981 | Ga0207640_10159245 | Ga0207640_101592452 | 246 |
| 332 | 3300025986 | Ga0207658_10087994 | Ga0207658_100879942 | 246 |
| 333 | 3300025986 | Ga0207658_10142945 | Ga0207658_101429452 | 246 |
| 334 | 3300026023 | Ga0207677_10067814 | Ga0207677_100678143 | 246 |
| 335 | 3300026035 | Ga0207703_10050397 | Ga0207703_100503974 | 246 |
| 336 | 3300026041 | Ga0207639_10000365 | Ga0207639_1000036529 | 246 |
| 337 | 3300026041 | Ga0207639_10046303 | Ga0207639_100463034 | 246 |
| 338 | 3300026078 | Ga0207702_10115614 | Ga0207702_101156142 | 246 |
| 339 | 3300026088 | Ga0207641_10337564 | Ga0207641_103375642 | 246 |
| 340 | 3300026116 | Ga0207674_10005900 | Ga0207674_100059009 | 246 |
| 341 | 3300026142 | Ga0207698_10180666 | Ga0207698_101806661 | 246 |
| 342 | 3300031251 | Ga0265327_10000361 | Ga0265327_1000036126 | 246 |
| 343 | 3300031507 | Ga0307509_10031297 | Ga0307509_100312974 | 246 |
| 344 | 3300035695 | Ga0373927_0011502 | Ga0373927_0011502_66_812 | 246 |
| 345 | 3300035725 | Ga0373947_0057206 | Ga0373947_0057206_338_1111 | 246 |
| 346 | 3300042876 | Ga0451577_0510905 | Ga0451577_0510905_138_878 | 246 |
| 347 | 3300044712 | Ga0453684_0000204 | Ga0453684_0000204_97538_98278 | 246 |
| 348 | 3300045051 | Ga0451576_0132125 | Ga0451576_0132125_632_1381 | 246 |
| 349 | 3300048913 | Ga0496110_0396481 | Ga0496110_0396481_310_1050 | 246 |
| 350 | 3300048915 | Ga0496112_0372336 | Ga0496112_0372336_297_1037 | 246 |
| 351 | 3300048916 | Ga0496113_0562068 | Ga0496113_0562068_78_860 | 246 |
| 352 | 3300053727 | Ga0500611_000038 | Ga0500611_000038_23155_23898 | 246 |
| 353 | 3300005295 | Ga0065707_10184777 | Ga0065707_101847772 | 247 |
| 354 | 3300005338 | Ga0068868_100094229 | Ga0068868_1000942292 | 247 |
| 355 | 3300005355 | Ga0070671_100041427 | Ga0070671_1000414272 | 247 |
| 356 | 3300005367 | Ga0070667_100004183 | Ga0070667_1000041834 | 247 |
| 357 | 3300005543 | Ga0070672_100241208 | Ga0070672_1002412082 | 247 |
| 358 | 3300005841 | Ga0068863_100016141 | Ga0068863_1000161413 | 247 |
| 359 | 3300006237 | Ga0097621_100000036 | Ga0097621_10000003648 | 247 |
| 360 | 3300006358 | Ga0068871_100000032 | Ga0068871_1000000322 | 247 |
| 361 | 3300009176 | Ga0105242_10080593 | Ga0105242_100805933 | 247 |
| 362 | 3300013297 | Ga0157378_10012239 | Ga0157378_100122395 | 247 |
| 363 | 3300013297 | Ga0157378_10873904 | Ga0157378_108739041 | 247 |
| 364 | 3300013306 | Ga0163162_10001828 | Ga0163162_1000182815 | 247 |
| 365 | 3300013308 | Ga0157375_10000067 | Ga0157375_1000006724 | 247 |
| 366 | 3300014968 | Ga0157379_10011904 | Ga0157379_100119044 | 247 |
| 367 | 3300014969 | Ga0157376_10000874 | Ga0157376_1000087412 | 247 |
| 368 | 3300017792 | Ga0163161_10003173 | Ga0163161_100031738 | 247 |
| 369 | 3300025931 | Ga0207644_10027909 | Ga0207644_100279094 | 247 |
| 370 | 3300025942 | Ga0207689_10489238 | Ga0207689_104892381 | 247 |
| 371 | 3300025986 | Ga0207658_10096254 | Ga0207658_100962542 | 247 |
| 372 | 3300026088 | Ga0207641_10010477 | Ga0207641_100104776 | 247 |
| 373 | 3300026089 | Ga0207648_10820132 | Ga0207648_108201321 | 247 |
| 374 | 3300028786 | Ga0307517_10000658 | Ga0307517_100006584 | 247 |
| 375 | 3300036401 | Ga0373937_0034971 | Ga0373937_0034971_2102_2941 | 247 |
| 376 | 3300048904 | Ga0496101_0071604 | Ga0496101_0071604_91_846 | 247 |
| 377 | 3300048908 | Ga0496105_0246561 | Ga0496105_0246561_483_1238 | 247 |
| 378 | 3300048913 | Ga0496110_0199689 | Ga0496110_0199689_88_843 | 247 |
| 379 | 3300048917 | Ga0496114_0058194 | Ga0496114_0058194_1086_1841 | 247 |
| 380 | iso_pu_bacteria | 2643221732 | 2644721746 | 247 |
| 381 | iso_pu_bacteria | 2818991465 | 2819708554 | 247 |
| 382 | iso_pu_bacteria | 2842882022 | 2842885786 | 247 |
| 383 | iso_pu_bacteria | 2904524088 | 2904528205 | 247 |
| 384 | iso_pu_bacteria | 2919143609 | 2919147724 | 247 |
| 385 | iso_pu_bacteria | 2919517244 | 2919521323 | 247 |
| 386 | iso_pu_bacteria | 2919720352 | 2919723980 | 247 |
| 387 | iso_pu_bacteria | 2928093941 | 2928098002 | 247 |
| 388 | iso_pu_bacteria | 2929004312 | 2929005182 | 247 |
| 389 | iso_pu_bacteria | 2960319331 | 2960322112 | 247 |
| 390 | iso_pu_bacteria | 2960375949 | 2960376798 | 247 |
| 391 | iso_pu_bacteria | 8022893055 | 8022895922 | 247 |
| 392 | iso_pu_bacteria | 8022914991 | 8022918869 | 247 |
| 393 | iso_pu_bacteria | 2643221543 | 2643741456 | 248 |
| 394 | iso_pu_bacteria | 8022792930 | 8022794202 | 248 |
| 395 | iso_pu_bacteria | 8057582654 | 8057585508 | 248 |
| 396 | 3300003320 | rootH2_10319767 | rootH2_103197671 | 249 |
| 397 | 3300005329 | Ga0070683_100322716 | Ga0070683_1003227161 | 249 |
| 398 | 3300005530 | Ga0070679_100525426 | Ga0070679_1005254262 | 249 |
| 399 | 3300005535 | Ga0070684_100285018 | Ga0070684_1002850182 | 249 |
| 400 | 3300025944 | Ga0207661_10250826 | Ga0207661_102508262 | 249 |
| 401 | 3300044765 | Ga0466970_0319996 | Ga0466970_0319996_101_865 | 249 |
| 402 | 3300045976 | Ga0466967_0538482 | Ga0466967_0538482_16_780 | 249 |
| 403 | 3300045976 | Ga0466967_0580169 | Ga0466967_0580169_89_853 | 249 |
| 404 | 3300048915 | Ga0496112_0272147 | Ga0496112_0272147_787_1551 | 249 |
| 405 | iso_pu_bacteria | 2738541299 | 2738837776 | 249 |
| 406 | iso_pu_bacteria | 2916971899 | 2916972260 | 249 |
| 407 | 3300042007 | Ga0439449_0011903 | Ga0439449_0011903_1626_2384 | 250 |
| 408 | 3300042007 | Ga0439449_0016949 | Ga0439449_0016949_841_1599 | 250 |
| 409 | 3300042014 | Ga0439457_001854 | Ga0439457_001854_2205_2963 | 250 |
| 410 | 3300044658 | Ga0466972_0000091 | Ga0466972_0000091_58701_59459 | 250 |
| 411 | 3300053090 | Ga0500646_0022263 | Ga0500646_0022263_454_1212 | 250 |
| 412 | 3300053147 | Ga0500589_174808 | Ga0500589_174808_44_802 | 250 |
| 413 | iso_pu_bacteria | 2864733723 | 2864738191 | 250 |
| 414 | iso_pu_bacteria | 2945991243 | 2945995019 | 250 |
| 415 | 3300003322 | rootL2_10094034 | rootL2_100940342 | 251 |
| 416 | 3300003323 | rootH1_10035991 | rootH1_1003599110 | 251 |
| 417 | 3300003323 | rootH1_10230939 | rootH1_102309392 | 251 |
| 418 | 3300005262 | Ga0065165_1005778 | Ga0065165_10057789 | 251 |
| 419 | 3300005331 | Ga0070670_100621900 | Ga0070670_1006219001 | 251 |
| 420 | 3300005338 | Ga0068868_100004132 | Ga0068868_1000041328 | 251 |
| 421 | 3300005355 | Ga0070671_100013881 | Ga0070671_1000138813 | 251 |
| 422 | 3300005457 | Ga0070662_100187862 | Ga0070662_1001878621 | 251 |
| 423 | 3300005834 | Ga0068851_10065052 | Ga0068851_100650522 | 251 |
| 424 | 3300005841 | Ga0068863_100367197 | Ga0068863_1003671972 | 251 |
| 425 | 3300005844 | Ga0068862_100187025 | Ga0068862_1001870251 | 251 |
| 426 | 3300006237 | Ga0097621_100401761 | Ga0097621_1004017612 | 251 |
| 427 | 3300009174 | Ga0105241_10199962 | Ga0105241_101999622 | 251 |
| 428 | 3300013100 | Ga0157373_10110561 | Ga0157373_101105612 | 251 |
| 429 | 3300013296 | Ga0157374_10099088 | Ga0157374_100990882 | 251 |
| 430 | 3300013297 | Ga0157378_10007331 | Ga0157378_100073314 | 251 |
| 431 | 3300013307 | Ga0157372_10214053 | Ga0157372_102140532 | 251 |
| 432 | 3300025321 | Ga0207656_10070309 | Ga0207656_100703092 | 251 |
| 433 | 3300025926 | Ga0207659_10030111 | Ga0207659_100301114 | 251 |
| 434 | 3300025931 | Ga0207644_10068187 | Ga0207644_100681873 | 251 |
| 435 | 3300025933 | Ga0207706_10082824 | Ga0207706_100828242 | 251 |
| 436 | 3300026023 | Ga0207677_10004209 | Ga0207677_100042097 | 251 |
| 437 | 3300026088 | Ga0207641_10017352 | Ga0207641_100173525 | 251 |
| 438 | 3300031456 | Ga0307513_10072544 | Ga0307513_100725445 | 251 |
| 439 | 3300031616 | Ga0307508_10101932 | Ga0307508_101019323 | 251 |
| 440 | 3300042876 | Ga0451577_0172217 | Ga0451577_0172217_572_1333 | 251 |
| 441 | 3300054114 | Ga0501084_0198449 | Ga0501084_0198449_862_1617 | 251 |
| 442 | 3300003187 | JGI25151J46595_10001420 | JGI25151J46595_1000142013 | 252 |
| 443 | 3300003187 | JGI25151J46595_10002119 | JGI25151J46595_100021198 | 252 |
| 444 | 3300005354 | Ga0070675_100019755 | Ga0070675_1000197552 | 252 |
| 445 | 3300005356 | Ga0070674_100008870 | Ga0070674_1000088703 | 252 |
| 446 | 3300005364 | Ga0070673_100035730 | Ga0070673_1000357302 | 252 |
| 447 | 3300005458 | Ga0070681_10304831 | Ga0070681_103048313 | 252 |
| 448 | 3300005459 | Ga0068867_100222971 | Ga0068867_1002229712 | 252 |
| 449 | 3300005539 | Ga0068853_100036056 | Ga0068853_1000360563 | 252 |
| 450 | 3300005543 | Ga0070672_100070131 | Ga0070672_1000701312 | 252 |
| 451 | 3300005563 | Ga0068855_100245627 | Ga0068855_1002456273 | 252 |
| 452 | 3300005564 | Ga0070664_100016199 | Ga0070664_1000161997 | 252 |
| 453 | 3300005577 | Ga0068857_100065080 | Ga0068857_1000650804 | 252 |
| 454 | 3300005840 | Ga0068870_10193849 | Ga0068870_101938491 | 252 |
| 455 | 3300009011 | Ga0105251_10013407 | Ga0105251_100134075 | 252 |
| 456 | 3300009092 | Ga0105250_10004788 | Ga0105250_100047883 | 252 |
| 457 | 3300009147 | Ga0114129_10015792 | Ga0114129_100157922 | 252 |
| 458 | 3300013308 | Ga0157375_10709141 | Ga0157375_107091412 | 252 |
| 459 | 3300025233 | Ga0209437_101014 | Ga0209437_1010146 | 252 |
| 460 | 3300025284 | Ga0209130_1002569 | Ga0209130_10025693 | 252 |
| 461 | 3300025294 | Ga0209025_1001333 | Ga0209025_100133310 | 252 |
| 462 | 3300025294 | Ga0209025_1001933 | Ga0209025_100193317 | 252 |
| 463 | 3300025893 | Ga0207682_10053661 | Ga0207682_100536612 | 252 |
| 464 | 3300025912 | Ga0207707_10369596 | Ga0207707_103695961 | 252 |
| 465 | 3300025940 | Ga0207691_10017291 | Ga0207691_100172913 | 252 |
| 466 | 3300025945 | Ga0207679_10012834 | Ga0207679_100128344 | 252 |
| 467 | 3300025960 | Ga0207651_10187496 | Ga0207651_101874962 | 252 |
| 468 | 3300026041 | Ga0207639_10029347 | Ga0207639_100293474 | 252 |
| 469 | 3300026078 | Ga0207702_10453033 | Ga0207702_104530332 | 252 |
| 470 | 3300026089 | Ga0207648_10104363 | Ga0207648_101043632 | 252 |
| 471 | 3300026121 | Ga0207683_10071366 | Ga0207683_100713663 | 252 |
| 472 | 3300041507 | Ga0451851_1263769 | Ga0451851_1263769_62_826 | 252 |
| 473 | 3300041512 | Ga0451853_1864335 | Ga0451853_1864335_482_1252 | 252 |
| 474 | 3300044656 | Ga0466969_0000033 | Ga0466969_0000033_75012_75779 | 252 |
| 475 | 3300044683 | Ga0466965_0085848 | Ga0466965_0085848_461_1225 | 252 |
| 476 | 3300044684 | Ga0466966_0000170 | Ga0466966_0000170_8772_9539 | 252 |
| 477 | 3300044706 | Ga0466964_0079122 | Ga0466964_0079122_82_849 | 252 |
| 478 | 3300044842 | Ga0466957_0016172 | Ga0466957_0016172_3201_3971 | 252 |
| 479 | 3300045049 | Ga0466959_0000089 | Ga0466959_0000089_8772_9539 | 252 |
| 480 | 3300046501 | Ga0495607_0154262 | Ga0495607_0154262_158_919 | 252 |
| 481 | 3300046514 | Ga0495618_0249081 | Ga0495618_0249081_226_1086 | 252 |
| 482 | 3300046516 | Ga0495628_0170382 | Ga0495628_0170382_97_957 | 252 |
| 483 | 3300048928 | Ga0496125_0005442 | Ga0496125_0005442_9575_10354 | 252 |
| 484 | 3300049571 | Ga0501034_0453529 | Ga0501034_0453529_17_787 | 252 |
| 485 | 3300049579 | Ga0501043_0310944 | Ga0501043_0310944_227_997 | 252 |
| 486 | 3300049581 | Ga0501047_0019608 | Ga0501047_0019608_1397_2167 | 252 |
| 487 | 3300049581 | Ga0501047_0234421 | Ga0501047_0234421_341_1105 | 252 |
| 488 | 3300049582 | Ga0501048_0203724 | Ga0501048_0203724_405_1175 | 252 |
| 489 | 3300049823 | Ga0501044_0285660 | Ga0501044_0285660_301_1071 | 252 |
| 490 | 3300050507 | nmdc:mga05p37_9961_c1 | nmdc:mga05p37_9961_c1_7633_8397 | 252 |
| 491 | 3300053086 | Ga0500578_0017678 | Ga0500578_0017678_950_1714 | 252 |
| 492 | 3300053092 | Ga0500583_0000002 | Ga0500583_0000002_167666_168430 | 252 |
| 493 | 3300053092 | Ga0500583_0000356 | Ga0500583_0000356_6217_6981 | 252 |
| 494 | 3300053131 | Ga0500652_091503 | Ga0500652_091503_313_1077 | 252 |
| 495 | 3300053134 | Ga0500658_0086805 | Ga0500658_0086805_183_947 | 252 |
| 496 | 3300053147 | Ga0500589_007446 | Ga0500589_007446_218_982 | 252 |
| 497 | iso_pu_bacteria | 2929297113 | 2929298080 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v6t-assembly1.cif.gz_A | crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 | 0.971 | 3 | 250 |
| 2dfa-assembly1.cif.gz_A | crystal structure of lactam utilization protein from thermus thermophilus hb8 | 0.9692 | 3 | 251 |
| 2dfa-assembly1.cif.gz_A | crystal structure of lactam utilization protein from thermus thermophilus hb8 | 0.9615 | 3 | 251 |
| 1xw8-assembly1.cif.gz_A-2 | x-ray structure of putative lactam utilization protein ybgl. northeast structural genomics consortium target et90. | 0.9558 | 3 | 252 |
| 2xu2-assembly1.cif.gz_A | crystal structure of the hypothetical protein pa4511 from pseudomonas aeruginosa | 0.955 | 4 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXX2_1_250_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9862 | 3 | 251 | 3.20.20.370 |
| af_Q2FXX2_1_250_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9784 | 3 | 251 | 3.20.20.370 |
| 1v6tA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.971 | 3 | 250 | 3.20.20.370 |
| 2dfaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9692 | 3 | 251 | 3.20.20.370 |
| 2dfaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9615 | 3 | 251 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W1XZK8-F1-model_v4 | LamB/YcsF family protein | 0.9994 | 22 | 109 |
GO:0005975
|
| AF-A0A0P9BCP6-F1-model_v4 | LamB/YcsF family protein | 0.9988 | 27 | 112 |
GO:0005975
|
| AF-A0A382DYA8-F1-model_v4 | LamB/YcsF family protein | 0.9982 | 10 | 95 |
GO:0005975
|
| AF-A0A847AW76-F1-model_v4 | 5-oxoprolinase subunit PxpA | 0.998 | 1 | 149 |
GO:0005975
|
| AF-A0A349HRB8-F1-model_v4 | LamB/YcsF family protein | 0.998 | 1 | 133 |
GO:0005975
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar