F455059

General Info

Members Datasets Scaffolds Average Seq Length
497 251 471 327

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10230336|Ga0307513_102303362
Length 360
Sequence MENVKCTLRAKSQIQKFQIPVGWLFGSRLMSYFSSMNKINWGIIGCGDVTEVKSGPAFNKVPDSSLVAVMRRDAAKARDYAQRHAVPKWYSNAQDLINDPGVNAIYIATPPSSHEEYALAAVAAGKPVYVEKPMSVDAGSAWRMHAAASDKGVPLVVAHYRRAQPLFKKLKQLLLDRVIGDTRFVRLELYKPLLTDNELAVPKTAWRVDPGVAGGGLFHDLAPHQLDLMYHFFGPVAKASGIGTNQAGKYGASDIVTGNILFKNNIIFDGLWNFSAGTATEKDQCEIIGTKGSIGFSMFDHMPVVVRLDTNEQSFAFDRLEHVQQPMIEQVVRYFLGKGDNPCGGEEGAEVMQLLDRFTS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
17 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
18 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
19 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
20 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
21 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
22 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
23 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
24 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
25 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
26 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
180 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
181 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
182 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
183 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
204 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
232 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
233 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
234 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
235 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
236 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
237 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
238 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
239 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
240 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
241 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
251 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 0.4
Rhizosphere 88.73
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2517045 2162886007 Bacteria 1439
2 SwRhRL2b_contig_3952261 2162886007 Bacteria 34047
3 JGI25152J39213_1000168 3300002773 Bacteria 44576
4 JGI25150J39212_1000019 3300002774 Bacteria 135244
5 JGI25151J46595_10000074 3300003187 Bacteria 135244
6 JGI25153J46596_10000056 3300003215 Bacteria 135244
7 rootH2_10008284 3300003320 Bacteria 49220
8 rootH2_10159931 3300003320 Bacteria 1328
9 rootH2_10263957 3300003320 Bacteria 2100
10 rootL2_10098413 3300003322 Bacteria 2000
11 rootL2_10248355 3300003322 Bacteria 1811
12 rootL2_10363840 3300003322 Bacteria 2944
13 rootL2_10373572 3300003322 Bacteria 1089
14 rootH1_10005337 3300003323 Bacteria 42291
15 rootH1_10053218 3300003323 Bacteria 10526
16 rootH1_10350930 3300003323 Unclassified 2559
17 Ga0055536_1000016 3300003781 Bacteria 222134
18 Ga0055530_10001822 3300003791 Bacteria 14718
19 Ga0055531_10000232 3300003794 Bacteria 61570
20 Ga0065714_10002765 3300005288 Bacteria 65513
21 Ga0065714_10014869 3300005288 Unclassified 1940
22 Ga0065714_10064461 3300005288 Bacteria 66149
23 Ga0065714_10070852 3300005288 Bacteria 3745
24 Ga0065704_10070264 3300005289 Bacteria 44804
25 Ga0065704_10140669 3300005289 Bacteria 1521
26 Ga0065712_10068216 3300005290 Bacteria 12837
27 Ga0065712_10080646 3300005290 Bacteria 3076
28 Ga0065715_10171485 3300005293 Bacteria 1543
29 Ga0070658_10274667 3300005327 Bacteria 1434
30 Ga0070676_10004115 3300005328 Bacteria 7638
31 Ga0070683_100004953 3300005329 Bacteria 11048
32 Ga0070683_100068855 3300005329 Unclassified 3298
33 Ga0070690_100038452 3300005330 Bacteria 3020
34 Ga0070690_100117531 3300005330 Unclassified 1781
35 Ga0070690_100274202 3300005330 Bacteria 1201
36 Ga0070670_100151181 3300005331 Bacteria 2009
37 Ga0070670_100341524 3300005331 Bacteria 1314
38 Ga0068869_100038806 3300005334 Bacteria 3398
39 Ga0068869_100044660 3300005334 Bacteria 3187
40 Ga0070666_10007962 3300005335 Bacteria 6552
41 Ga0068868_100001438 3300005338 Bacteria 16409
42 Ga0068868_100018256 3300005338 Bacteria 5240
43 Ga0068868_100029755 3300005338 Bacteria 4184
44 Ga0070689_100009434 3300005340 Bacteria 6918
45 Ga0070687_100175349 3300005343 Bacteria 1280
46 Ga0070687_100338062 3300005343 Bacteria 967
47 Ga0070661_100065785 3300005344 Bacteria 2664
48 Ga0070668_100071763 3300005347 Bacteria 2698
49 Ga0070668_100172871 3300005347 Bacteria 1760
50 Ga0070669_100001549 3300005353 Bacteria 16626
51 Ga0070669_100192309 3300005353 Bacteria 1601
52 Ga0070669_100300250 3300005353 Bacteria 1291
53 Ga0070675_100017889 3300005354 Bacteria 5638
54 Ga0070675_100043377 3300005354 Bacteria 3675
55 Ga0070675_100049679 3300005354 Bacteria 3443
56 Ga0070675_100136541 3300005354 Unclassified 2093
57 Ga0070671_100115784 3300005355 Unclassified 2254
58 Ga0070674_100048436 3300005356 Unclassified 2917
59 Ga0070673_100019354 3300005364 Bacteria 4885
60 Ga0070673_100020406 3300005364 Bacteria 4780
61 Ga0070673_100253691 3300005364 Bacteria 1534
62 Ga0070659_100042318 3300005366 Bacteria 3561
63 Ga0070659_100149784 3300005366 Bacteria 1903
64 Ga0070667_100007783 3300005367 Bacteria 8884
65 Ga0070667_100009777 3300005367 Bacteria 7951
66 Ga0070667_100023337 3300005367 Bacteria 5131
67 Ga0070667_100091624 3300005367 Unclassified 2614
68 Ga0070667_100192822 3300005367 Bacteria 1806
69 Ga0070700_100078744 3300005441 Bacteria 2123
70 Ga0070662_100009312 3300005457 Bacteria 6418
71 Ga0070662_100038202 3300005457 Bacteria 3409
72 Ga0070662_100061043 3300005457 Bacteria 2751
73 Ga0070662_100211161 3300005457 Unclassified 1545
74 Ga0070662_100412679 3300005457 Bacteria 1116
75 Ga0068867_100009360 3300005459 Bacteria 6916
76 Ga0068867_100038192 3300005459 Unclassified 3495
77 Ga0070685_10018684 3300005466 Unclassified 3732
78 Ga0070685_10025462 3300005466 Bacteria 3258
79 Ga0070685_10068077 3300005466 Bacteria 2102
80 Ga0070685_10112079 3300005466 Bacteria 1682
81 Ga0070707_100181737 3300005468 Bacteria 2050
82 Ga0070698_100000434 3300005471 Bacteria 44513
83 Ga0070698_100002200 3300005471 Bacteria 21650
84 Ga0070698_100089032 3300005471 Bacteria 3071
85 Ga0070679_100446227 3300005530 Bacteria 1238
86 Ga0070684_100192843 3300005535 Bacteria 1854
87 Ga0068853_100022631 3300005539 Bacteria 5251
88 Ga0068853_100038601 3300005539 Bacteria 4068
89 Ga0068853_100071145 3300005539 Bacteria 3029
90 Ga0068853_100163025 3300005539 Bacteria 2013
91 Ga0068853_100198486 3300005539 Bacteria 1825
92 Ga0070672_100054163 3300005543 Bacteria 3139
93 Ga0070686_100046180 3300005544 Bacteria 2747
94 Ga0070665_100106920 3300005548 Unclassified 2800
95 Ga0070704_100263906 3300005549 Bacteria 1420
96 Ga0068855_100007808 3300005563 Bacteria 12921
97 Ga0068855_100274504 3300005563 Bacteria 1874
98 Ga0068855_100484670 3300005563 Bacteria 1346
99 Ga0070664_100041551 3300005564 Bacteria 3881
100 Ga0070664_100046057 3300005564 Bacteria 3683
101 Ga0070664_100193312 3300005564 Bacteria 1813
102 Ga0070664_100253493 3300005564 Bacteria 1582
103 Ga0070664_100365436 3300005564 Bacteria 1315
104 Ga0068857_100043387 3300005577 Bacteria 3990
105 Ga0068857_100045231 3300005577 Bacteria 3905
106 Ga0068857_100064844 3300005577 Bacteria 3248
107 Ga0068854_100154543 3300005578 Bacteria 1772
108 Ga0068854_100165981 3300005578 Bacteria 1714
109 Ga0068854_100223785 3300005578 Unclassified 1490
110 Ga0068854_100274702 3300005578 Unclassified 1354
111 Ga0068852_100232036 3300005616 Bacteria 1759
112 Ga0068852_100305900 3300005616 Unclassified 1540
113 Ga0068852_100312144 3300005616 Unclassified 1525
114 Ga0068859_100000186 3300005617 Bacteria 60206
115 Ga0068859_100007864 3300005617 Bacteria 10821
116 Ga0068859_100012573 3300005617 Bacteria 8516
117 Ga0068859_100034457 3300005617 Bacteria 5082
118 Ga0068859_100065835 3300005617 Bacteria 3657
119 Ga0068859_100078908 3300005617 Bacteria 3332
120 Ga0068859_100287430 3300005617 Bacteria 1737
121 Ga0068859_100531864 3300005617 Bacteria 1270
122 Ga0068864_100070103 3300005618 Unclassified 3050
123 Ga0068864_100121847 3300005618 Unclassified 2333
124 Ga0068864_100122890 3300005618 Bacteria 2323
125 Ga0068864_100140768 3300005618 Unclassified 2176
126 Ga0068864_100144845 3300005618 Bacteria 2147
127 Ga0068864_100367425 3300005618 Bacteria 1361
128 Ga0068864_100416256 3300005618 Bacteria 1280
129 Ga0068866_10011854 3300005718 Unclassified 3786
130 Ga0068866_10064384 3300005718 Bacteria 1914
131 Ga0068861_100021056 3300005719 Bacteria 4684
132 Ga0068851_10025552 3300005834 Unclassified 2898
133 Ga0068870_10029966 3300005840 Bacteria 2747
134 Ga0068863_100046895 3300005841 Bacteria 4101
135 Ga0068863_100169222 3300005841 Bacteria 2095
136 Ga0068863_100239708 3300005841 Unclassified 1750
137 Ga0068858_100028292 3300005842 Bacteria 5208
138 Ga0068858_100121166 3300005842 Unclassified 2446
139 Ga0068860_100004566 3300005843 Bacteria 14129
140 Ga0068860_100038641 3300005843 Unclassified 4566
141 Ga0068862_100004879 3300005844 Bacteria 11295
142 Ga0070715_10153841 3300006163 Unclassified 1130
143 Ga0097621_100001612 3300006237 Bacteria 15459
144 Ga0097621_100116368 3300006237 Bacteria 2264
145 Ga0097621_100177590 3300006237 Bacteria 1839
146 Ga0068871_100092578 3300006358 Bacteria 2521
147 Ga0068871_100132237 3300006358 Bacteria 2116
148 Ga0068871_100154447 3300006358 Unclassified 1959
149 Ga0075428_100003121 3300006844 Bacteria 18092
150 Ga0075428_100057980 3300006844 Bacteria 4240
151 Ga0075430_100071113 3300006846 Bacteria 2919
152 Ga0075431_100012508 3300006847 Bacteria 8568
153 Ga0075429_100015250 3300006880 Bacteria 6660
154 Ga0075429_100034029 3300006880 Bacteria 4427
155 Ga0075429_100213814 3300006880 Unclassified 1689
156 Ga0068865_100043995 3300006881 Unclassified 3054
157 Ga0068865_100119253 3300006881 Bacteria 1959
158 Ga0097620_100000186 3300006931 Bacteria 60206
159 Ga0097620_100007864 3300006931 Bacteria 10821
160 Ga0097620_100012573 3300006931 Bacteria 8516
161 Ga0097620_100034457 3300006931 Bacteria 5082
162 Ga0097620_100065840 3300006931 Bacteria 3657
163 Ga0097620_100078908 3300006931 Bacteria 3332
164 Ga0097620_100287452 3300006931 Bacteria 1737
165 Ga0097620_100531882 3300006931 Bacteria 1270
166 Ga0105240_10042535 3300009093 Bacteria 5789
167 Ga0105240_10253733 3300009093 Bacteria 2033
168 Ga0111539_10004826 3300009094 Bacteria 17579
169 Ga0111539_10011457 3300009094 Bacteria 11131
170 Ga0111539_10309628 3300009094 Bacteria 1838
171 Ga0105247_10002164 3300009101 Bacteria 13555
172 Ga0105247_10015899 3300009101 Unclassified 4506
173 Ga0105247_10129083 3300009101 Unclassified 1646
174 Ga0114129_10409768 3300009147 Bacteria 1785
175 Ga0114129_11013143 3300009147 Bacteria 1045
176 Ga0105241_10011692 3300009174 Bacteria 6444
177 Ga0105241_10135616 3300009174 Unclassified 1998
178 Ga0105242_10018162 3300009176 Bacteria 5493
179 Ga0105242_10187885 3300009176 Bacteria 1827
180 Ga0105242_10299162 3300009176 Unclassified 1468
181 Ga0105237_10000056 3300009545 Bacteria 151313
182 Ga0105237_10014734 3300009545 Bacteria 8160
183 Ga0105237_10019727 3300009545 Bacteria 6961
184 Ga0105237_10109176 3300009545 Unclassified 2758
185 Ga0105249_10001799 3300009553 Bacteria 18649
186 Ga0105249_10025044 3300009553 Bacteria 5369
187 Ga0105249_10027070 3300009553 Bacteria 5172
188 Ga0105249_10096546 3300009553 Unclassified 2773
189 Ga0105249_10149714 3300009553 Unclassified 2246
190 Ga0105249_10365988 3300009553 Bacteria 1464
191 Ga0105249_10372666 3300009553 Unclassified 1452
192 Ga0105239_10000140 3300010375 Bacteria 101896
193 Ga0105239_10122906 3300010375 Bacteria 2884
194 Ga0105246_10022520 3300011119 Unclassified 4065
195 Ga0105246_10074523 3300011119 Unclassified 2399
196 Ga0105246_10096161 3300011119 Bacteria 2146
197 Ga0157373_10000043 3300013100 Bacteria 113422
198 Ga0157373_10008535 3300013100 Bacteria 7609
199 Ga0157371_10000119 3300013102 Bacteria 120350
200 Ga0157371_10000416 3300013102 Bacteria 52659
201 Ga0157371_10001802 3300013102 Bacteria 21657
202 Ga0157371_10015353 3300013102 Bacteria 5748
203 Ga0157370_10016180 3300013104 Bacteria 7561
204 Ga0157370_10016437 3300013104 Bacteria 7491
205 Ga0157370_10068596 3300013104 Bacteria 3351
206 Ga0157370_10084206 3300013104 Bacteria 2989
207 Ga0157370_10158677 3300013104 Bacteria 2105
208 Ga0157370_10230295 3300013104 Bacteria 1715
209 Ga0157370_10328564 3300013104 Bacteria 1410
210 Ga0157370_10449212 3300013104 Bacteria 1185
211 Ga0157369_10000015 3300013105 Bacteria 262917
212 Ga0157374_10110262 3300013296 Bacteria 2646
213 Ga0157374_10214314 3300013296 Bacteria 1889
214 Ga0157374_10236568 3300013296 Bacteria 1795
215 Ga0157378_10015966 3300013297 Bacteria 6576
216 Ga0157378_10046526 3300013297 Bacteria 3856
217 Ga0157378_10069477 3300013297 Unclassified 3160
218 Ga0157378_10082166 3300013297 Bacteria 2913
219 Ga0157378_10203761 3300013297 Bacteria 1872
220 Ga0157378_10271235 3300013297 Bacteria 1632
221 Ga0157378_10343476 3300013297 Unclassified 1456
222 Ga0157378_10358001 3300013297 Unclassified 1427
223 Ga0163162_10000503 3300013306 Bacteria 36430
224 Ga0163162_10000520 3300013306 Bacteria 35697
225 Ga0163162_10004595 3300013306 Bacteria 13299
226 Ga0163162_10016877 3300013306 Bacteria 7137
227 Ga0163162_10018243 3300013306 Bacteria 6873
228 Ga0163162_10247504 3300013306 Unclassified 1914
229 Ga0163162_10436391 3300013306 Bacteria 1442
230 Ga0157372_10021922 3300013307 Bacteria 6905
231 Ga0157372_10095982 3300013307 Unclassified 3378
232 Ga0157372_10678739 3300013307 Bacteria 1199
233 Ga0157375_10004190 3300013308 Bacteria 12518
234 Ga0157375_10011168 3300013308 Bacteria 7922
235 Ga0157375_10033185 3300013308 Unclassified 4903
236 Ga0157375_10121018 3300013308 Bacteria 2727
237 Ga0157375_10129449 3300013308 Bacteria 2642
238 Ga0157375_10158783 3300013308 Bacteria 2402
239 Ga0157375_10314862 3300013308 Bacteria 1729
240 Ga0157375_10504499 3300013308 Unclassified 1374
241 Ga0163163_10060041 3300014325 Bacteria 3763
242 Ga0163163_10095282 3300014325 Unclassified 2996
243 Ga0163163_10252448 3300014325 Bacteria 1814
244 Ga0157380_10004237 3300014326 Bacteria 9921
245 Ga0157380_10013873 3300014326 Bacteria 5885
246 Ga0157380_10022449 3300014326 Bacteria 4751
247 Ga0157380_10151261 3300014326 Bacteria 2007
248 Ga0157380_10182452 3300014326 Bacteria 1845
249 Ga0182008_10000018 3300014497 Bacteria 230609
250 Ga0157377_10001470 3300014745 Bacteria 10199
251 Ga0157377_10017466 3300014745 Bacteria 3711
252 Ga0157377_10096962 3300014745 Bacteria 1750
253 Ga0157379_10084320 3300014968 Bacteria 2848
254 Ga0157379_10122738 3300014968 Bacteria 2337
255 Ga0157379_10230265 3300014968 Unclassified 1679
256 Ga0157376_10003846 3300014969 Bacteria 10377
257 Ga0157376_10135842 3300014969 Bacteria 2200
258 Ga0157376_10147224 3300014969 Bacteria 2119
259 Ga0182006_1000091 3300015261 Bacteria 109227
260 Ga0182007_10000010 3300015262 Bacteria 286070
261 Ga0183373_1003 3300015682 Bacteria 558813
262 Ga0163161_10000046 3300017792 Bacteria 127211
263 Ga0163161_10000353 3300017792 Bacteria 38695
264 Ga0163161_10000589 3300017792 Bacteria 29075
265 Ga0163161_10014202 3300017792 Bacteria 5546
266 Ga0207425_1000007 3300025245 Bacteria 777411
267 Ga0209129_1000006 3300025258 Bacteria 777761
268 Ga0209676_1000106 3300025292 Bacteria 222576
269 Ga0209025_1000025 3300025294 Bacteria 524454
270 Ga0209758_1000016 3300025297 Bacteria 778557
271 Ga0209050_1000174 3300025298 Bacteria 148871
272 Ga0209050_1002421 3300025298 Bacteria 16078
273 Ga0209257_1000006 3300025304 Bacteria 1570111
274 Ga0207697_10025986 3300025315 Bacteria 2394
275 Ga0207656_10077700 3300025321 Bacteria 1486
276 Ga0207682_10027450 3300025893 Bacteria 2267
277 Ga0207642_10082110 3300025899 Bacteria 1568
278 Ga0207710_10003395 3300025900 Bacteria 7119
279 Ga0207680_10003295 3300025903 Bacteria 7610
280 Ga0207680_10081168 3300025903 Unclassified 2038
281 Ga0207680_10263429 3300025903 Bacteria 1194
282 Ga0207645_10040898 3300025907 Bacteria 2969
283 Ga0207643_10008368 3300025908 Bacteria 5550
284 Ga0207643_10163065 3300025908 Unclassified 1342
285 Ga0207695_10048875 3300025913 Bacteria 4463
286 Ga0207671_10001166 3300025914 Bacteria 31300
287 Ga0207671_10009433 3300025914 Bacteria 8160
288 Ga0207671_10014727 3300025914 Bacteria 6166
289 Ga0207660_10052361 3300025917 Bacteria 2906
290 Ga0207662_10021743 3300025918 Unclassified 3670
291 Ga0207662_10048653 3300025918 Bacteria 2512
292 Ga0207657_10010871 3300025919 Bacteria 9055
293 Ga0207657_10038399 3300025919 Bacteria 4262
294 Ga0207657_10399191 3300025919 Bacteria 1081
295 Ga0207649_10019656 3300025920 Bacteria 3864
296 Ga0207649_10099074 3300025920 Bacteria 1925
297 Ga0207681_10032416 3300025923 Bacteria 3420
298 Ga0207681_10036208 3300025923 Bacteria 3255
299 Ga0207681_10177672 3300025923 Bacteria 1619
300 Ga0207694_10235107 3300025924 Bacteria 1497
301 Ga0207650_10056156 3300025925 Bacteria 2925
302 Ga0207659_10020890 3300025926 Bacteria 4336
303 Ga0207659_10116222 3300025926 Bacteria 2042
304 Ga0207659_10222749 3300025926 Bacteria 1517
305 Ga0207687_10332335 3300025927 Unclassified 1233
306 Ga0207706_10008726 3300025933 Bacteria 9337
307 Ga0207706_10013744 3300025933 Bacteria 7347
308 Ga0207706_10251978 3300025933 Bacteria 1542
309 Ga0207706_10295269 3300025933 Bacteria 1412
310 Ga0207686_10014530 3300025934 Bacteria 4385
311 Ga0207686_10184344 3300025934 Unclassified 1482
312 Ga0207670_10000687 3300025936 Bacteria 17875
313 Ga0207670_10002843 3300025936 Bacteria 9138
314 Ga0207704_10240832 3300025938 Bacteria 1352
315 Ga0207691_10021148 3300025940 Bacteria 6148
316 Ga0207691_10023326 3300025940 Bacteria 5825
317 Ga0207689_10000687 3300025942 Bacteria 32323
318 Ga0207689_10007198 3300025942 Bacteria 9772
319 Ga0207689_10024931 3300025942 Bacteria 5014
320 Ga0207689_10025599 3300025942 Bacteria 4944
321 Ga0207689_10044184 3300025942 Bacteria 3683
322 Ga0207689_10045098 3300025942 Unclassified 3647
323 Ga0207689_10136814 3300025942 Bacteria 2017
324 Ga0207661_10299507 3300025944 Unclassified 1441
325 Ga0207679_10019874 3300025945 Bacteria 4523
326 Ga0207651_10052856 3300025960 Unclassified 2773
327 Ga0207651_10058606 3300025960 Bacteria 2662
328 Ga0207651_10073442 3300025960 Unclassified 2432
329 Ga0207651_10129209 3300025960 Bacteria 1931
330 Ga0207651_10155248 3300025960 Bacteria 1787
331 Ga0207712_10003717 3300025961 Bacteria 9629
332 Ga0207712_10009896 3300025961 Bacteria 6042
333 Ga0207712_10088556 3300025961 Unclassified 2273
334 Ga0207712_10092051 3300025961 Unclassified 2234
335 Ga0207668_10023595 3300025972 Bacteria 3957
336 Ga0207668_10173599 3300025972 Unclassified 1693
337 Ga0207668_10282881 3300025972 Bacteria 1361
338 Ga0207658_10006184 3300025986 Bacteria 8175
339 Ga0207658_10019203 3300025986 Bacteria 4726
340 Ga0207658_10029037 3300025986 Bacteria 3901
341 Ga0207658_10057763 3300025986 Unclassified 2885
342 Ga0207677_10030084 3300026023 Unclassified 3461
343 Ga0207677_10156454 3300026023 Unclassified 1765
344 Ga0207703_10011809 3300026035 Bacteria 6800
345 Ga0207703_10038406 3300026035 Unclassified 3820
346 Ga0207703_10115096 3300026035 Unclassified 2301
347 Ga0207703_10420550 3300026035 Bacteria 1243
348 Ga0207639_10030508 3300026041 Bacteria 3953
349 Ga0207708_10065310 3300026075 Bacteria 2781
350 Ga0207708_10228745 3300026075 Bacteria 1492
351 Ga0207641_10000111 3300026088 Bacteria 120527
352 Ga0207641_10000194 3300026088 Bacteria 82153
353 Ga0207641_10026918 3300026088 Bacteria 4748
354 Ga0207641_10113982 3300026088 Bacteria 2401
355 Ga0207641_10142360 3300026088 Bacteria 2165
356 Ga0207648_10032967 3300026089 Bacteria 4570
357 Ga0207648_10207063 3300026089 Bacteria 1740
358 Ga0207676_10051795 3300026095 Unclassified 3206
359 Ga0207676_10064162 3300026095 Unclassified 2920
360 Ga0207676_10360961 3300026095 Bacteria 1346
361 Ga0207674_10007033 3300026116 Bacteria 13155
362 Ga0207674_10007660 3300026116 Bacteria 12570
363 Ga0207674_10117769 3300026116 Bacteria 2627
364 Ga0207675_100000594 3300026118 Bacteria 35413
365 Ga0207683_10025740 3300026121 Bacteria 5075
366 Ga0207683_10184822 3300026121 Bacteria 1891
367 Ga0207698_10007582 3300026142 Bacteria 6804
368 Ga0207698_10036485 3300026142 Unclassified 3609
369 Ga0207698_10252944 3300026142 Unclassified 1613
370 Ga0207698_10270350 3300026142 Unclassified 1567
371 Ga0207428_10048260 3300027907 Bacteria 3417
372 Ga0268265_10009189 3300028380 Bacteria 6680
373 Ga0268265_10026968 3300028380 Unclassified 4094
374 Ga0268265_10029771 3300028380 Bacteria 3925
375 Ga0268264_10004807 3300028381 Bacteria 11457
376 Ga0268264_10007504 3300028381 Bacteria 9098
377 Ga0307515_10000001 3300028794 Bacteria 4259510
378 Ga0307515_10000074 3300028794 Bacteria 229874
379 Ga0307515_10055300 3300028794 Bacteria 5803
380 Ga0307511_10000580 3300030521 Bacteria 39130
381 Ga0316177_1014320 3300030731 Bacteria 9953
382 Ga0316176_1135267 3300030732 Bacteria 3922
383 Ga0316183_1129153 3300030742 Bacteria 18506
384 Ga0316181_1008661 3300030744 Bacteria 3957
385 Ga0265327_10000087 3300031251 Bacteria 198174
386 Ga0265327_10000117 3300031251 Bacteria 173075
387 Ga0265327_10058270 3300031251 Bacteria 1983
388 Ga0307513_10230336 3300031456 Bacteria 1666
389 Ga0307408_100000192 3300031548 Bacteria 65993
390 Ga0307408_100000386 3300031548 Bacteria 40362
391 Ga0307408_100000742 3300031548 Bacteria 26362
392 Ga0307408_100000797 3300031548 Bacteria 25229
393 Ga0316576_10014153 3300031727 Bacteria 5324
394 Ga0307405_10000049 3300031731 Bacteria 66592
395 Ga0307405_10195453 3300031731 Bacteria 1464
396 Ga0316577_10008235 3300031733 Bacteria 5582
397 Ga0307406_10003624 3300031901 Bacteria 8412
398 Ga0307406_10056092 3300031901 Bacteria 2521
399 Ga0307407_10000024 3300031903 Bacteria 113716
400 Ga0307412_10000075 3300031911 Bacteria 97612
401 Ga0307412_10010592 3300031911 Bacteria 5313
402 Ga0307412_10195757 3300031911 Bacteria 1531
403 Ga0307416_100000037 3300032002 Bacteria 137513
404 Ga0307414_10003504 3300032004 Bacteria 8386
405 Ga0316585_10030773 3300032137 Bacteria 1685
406 Ga0307510_10007160 3300033180 Bacteria 13284
407 Ga0373935_0244060 3300035692 Bacteria 1255
408 Ga0373937_0034836 3300036401 Bacteria 4579
409 Ga0316584_0001102 3300036712 Bacteria 15812
410 Ga0395900_0507140 3300037418 Unclassified 1156
411 Ga0395898_0133908 3300037466 Bacteria 2373
412 Ga0395901_0074536 3300038443 Bacteria 3541
413 Ga0439431_0020148 3300041997 Bacteria 1591
414 Ga0439457_020374 3300042014 Unclassified 1472
415 Ga0453684_0003659 3300044712 Bacteria 34139
416 Ga0495592_0299194 3300046454 Bacteria 1046
417 Ga0495638_0000113 3300046460 Bacteria 129331
418 Ga0495610_0000045 3300046512 Bacteria 155304
419 Ga0495610_0002755 3300046512 Bacteria 14412
420 Ga0495630_0010504 3300046517 Bacteria 6689
421 Ga0495634_0084695 3300046642 Bacteria 2067
422 Ga0495611_0000145 3300046648 Bacteria 50311
423 Ga0495635_0094258 3300046663 Bacteria 2047
424 Ga0495649_0075065 3300046694 Bacteria 1811
425 Ga0495672_0009095 3300047320 Bacteria 7243
426 Ga0495672_0108655 3300047320 Bacteria 1492
427 Ga0495676_0209650 3300047321 Bacteria 1349
428 Ga0495684_0058258 3300047471 Bacteria 2943
429 Ga0496114_0201595 3300048917 Bacteria 1743
430 Ga0496115_0420877 3300048918 Bacteria 1082
431 Ga0496122_0005517 3300048925 Bacteria 15025
432 Ga0496123_0014761 3300048926 Bacteria 6450
433 Ga0501031_0188861 3300049568 Bacteria 1345
434 Ga0501032_0010676 3300049569 Bacteria 6611
435 Ga0501033_0046070 3300049570 Unclassified 3243
436 Ga0501034_0034920 3300049571 Bacteria 5099
437 Ga0501036_0037380 3300049572 Bacteria 4108
438 Ga0501036_0101626 3300049572 Bacteria 2432
439 Ga0501037_0009716 3300049573 Bacteria 7060
440 Ga0501038_0079991 3300049574 Bacteria 2756
441 Ga0501039_0012871 3300049575 Bacteria 6397
442 Ga0501039_0118407 3300049575 Bacteria 2074
443 Ga0501043_0010274 3300049579 Bacteria 7336
444 Ga0501047_0053728 3300049581 Unclassified 3896
445 Ga0501047_0152208 3300049581 Bacteria 2189
446 Ga0501202_003236 3300049652 Unclassified 2779
447 Ga0501223_000294 3300049663 Bacteria 12597
448 Ga0501223_005336 3300049663 Unclassified 2705
449 Ga0501224_004818 3300049664 Unclassified 1925
450 Ga0501243_000292 3300049675 Bacteria 6458
451 Ga0501249_010398 3300049679 Bacteria 1948
452 Ga0501259_000215 3300049688 Bacteria 8882
453 Ga0501221_002494 3300049704 Bacteria 3038
454 Ga0501225_0024874 3300049705 Bacteria 1648
455 Ga0501225_0050373 3300049705 Bacteria 1159
456 Ga0501241_005449 3300049758 Bacteria 2371
457 Ga0501280_006618 3300049776 Unclassified 1630
458 Ga0501283_012107 3300049779 Unclassified 1293
459 Ga0501035_0082133 3300049822 Bacteria 2844
460 Ga0501035_0091174 3300049822 Bacteria 2682
461 Ga0501044_0031349 3300049823 Bacteria 5596
462 nmdc:mga06r32_39147_c1 3300050510 Bacteria 4497
463 nmdc:mga08y16_5445_c1 3300050511 Bacteria 13308
464 nmdc:mga08y16_662171_c1 3300050511 Bacteria 1047
465 nmdc:mga08y16_8130_c1 3300050511 Bacteria 3973
466 Ga0500651_0000204 3300053093 Bacteria 37623
467 Ga0500568_0052130 3300053139 Bacteria 1607
468 Ga0500616_0000004 3300053153 Bacteria 1002714
469 Ga0500616_0028286 3300053153 Bacteria 3090
470 Ga0500622_0076452 3300053156 Unclassified 1683
471 Ga0500611_000059 3300053727 Bacteria 48867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_662171_c1 nmdc:mga08y16_662171_c1_108_977 288
2 3300053156 Ga0500622_0076452 Ga0500622_0076452_38_910 288
3 3300005343 Ga0070687_100338062 Ga0070687_1003380621 291
4 3300013296 Ga0157374_10236568 Ga0157374_102365682 302
5 3300046648 Ga0495611_0000145 Ga0495611_0000145_4733_5704 304
6 3300041997 Ga0439431_0020148 Ga0439431_0020148_258_1238 305
7 3300009553 Ga0105249_10025044 Ga0105249_100250444 306
8 3300013306 Ga0163162_10016877 Ga0163162_100168773 306
9 3300003322 rootL2_10248355 rootL2_102483552 313
10 3300003794 Ga0055531_10000232 Ga0055531_1000023217 313
11 3300025304 Ga0209257_1000006 Ga0209257_1000006854 313
12 iso_pu_bacteria 2890737413 2890739643 314
13 3300003322 rootL2_10363840 rootL2_103638402 315
14 3300030731 Ga0316177_1014320 Ga0316177_10143207 315
15 3300030732 Ga0316176_1135267 Ga0316176_11352674 315
16 3300030742 Ga0316183_1129153 Ga0316183_11291536 315
17 3300030744 Ga0316181_1008661 Ga0316181_10086612 315
18 iso_pu_bacteria 2898713307 2898715936 315
19 3300003320 rootH2_10008284 rootH2_100082843 316
20 iso_pu_bacteria 2818991460 2819678563 316
21 3300013297 Ga0157378_10015966 Ga0157378_100159669 317
22 3300014968 Ga0157379_10230265 Ga0157379_102302651 317
23 3300025986 Ga0207658_10019203 Ga0207658_100192037 317
24 3300005330 Ga0070690_100117531 Ga0070690_1001175312 319
25 3300005617 Ga0068859_100531864 Ga0068859_1005318642 319
26 3300006931 Ga0097620_100531882 Ga0097620_1005318822 319
27 3300013297 Ga0157378_10343476 Ga0157378_103434761 319
28 3300013307 Ga0157372_10095982 Ga0157372_100959821 319
29 3300025924 Ga0207694_10235107 Ga0207694_102351071 319
30 iso_pu_bacteria 2585427687 2586209290 319
31 iso_pu_bacteria 2739367651 2739590236 319
32 iso_pu_bacteria 2842722452 2842723042 319
33 iso_pu_bacteria 2842909656 2842913998 319
34 iso_pu_bacteria 2857627736 2857632297 319
35 iso_pu_bacteria 2945997725 2946000023 319
36 3300005564 Ga0070664_100365436 Ga0070664_1003654361 320
37 3300049776 Ga0501280_006618 Ga0501280_006618_113_1090 320
38 iso_pu_bacteria 2738541302 2738855737 320
39 iso_pu_bacteria 2739367656 2739615745 320
40 iso_pu_bacteria 2818991437 2819548388 320
41 iso_pu_bacteria 2842903701 2842907404 320
42 iso_pu_bacteria 2902048731 2902051085 320
43 iso_pu_bacteria 2954016120 2954016623 320
44 iso_pu_bacteria 8055588893 8055591954 320
45 3300005288 Ga0065714_10014869 Ga0065714_100148692 321
46 3300005539 Ga0068853_100038601 Ga0068853_1000386012 321
47 3300013308 Ga0157375_10504499 Ga0157375_105044992 321
48 3300025298 Ga0209050_1002421 Ga0209050_100242110 321
49 iso_pu_bacteria 2738541283 2738754102 321
50 iso_pu_bacteria 2739367663 2739645423 321
51 iso_pu_bacteria 2775506987 2776613325 321
52 iso_pu_bacteria 2929177148 2929180227 321
53 iso_pu_bacteria 2946013367 2946017980 321
54 3300003320 rootH2_10159931 rootH2_101599311 322
55 3300003322 rootL2_10098413 rootL2_100984131 322
56 3300003322 rootL2_10373572 rootL2_103735721 322
57 3300005288 Ga0065714_10070852 Ga0065714_100708525 322
58 3300005290 Ga0065712_10068216 Ga0065712_100682164 322
59 3300005290 Ga0065712_10080646 Ga0065712_100806463 322
60 3300005293 Ga0065715_10171485 Ga0065715_101714852 322
61 3300005340 Ga0070689_100009434 Ga0070689_1000094347 322
62 3300005343 Ga0070687_100175349 Ga0070687_1001753491 322
63 3300005354 Ga0070675_100049679 Ga0070675_1000496793 322
64 3300005364 Ga0070673_100019354 Ga0070673_1000193542 322
65 3300005364 Ga0070673_100020406 Ga0070673_1000204064 322
66 3300005441 Ga0070700_100078744 Ga0070700_1000787442 322
67 3300005466 Ga0070685_10025462 Ga0070685_100254622 322
68 3300005543 Ga0070672_100054163 Ga0070672_1000541632 322
69 3300005549 Ga0070704_100263906 Ga0070704_1002639062 322
70 3300005617 Ga0068859_100012573 Ga0068859_1000125734 322
71 3300005617 Ga0068859_100065835 Ga0068859_1000658352 322
72 3300005618 Ga0068864_100122890 Ga0068864_1001228903 322
73 3300005618 Ga0068864_100416256 Ga0068864_1004162562 322
74 3300005718 Ga0068866_10011854 Ga0068866_100118545 322
75 3300005840 Ga0068870_10029966 Ga0068870_100299662 322
76 3300005841 Ga0068863_100046895 Ga0068863_1000468956 322
77 3300005841 Ga0068863_100169222 Ga0068863_1001692222 322
78 3300005841 Ga0068863_100239708 Ga0068863_1002397082 322
79 3300006844 Ga0075428_100003121 Ga0075428_10000312113 322
80 3300006847 Ga0075431_100012508 Ga0075431_1000125082 322
81 3300006880 Ga0075429_100034029 Ga0075429_1000340293 322
82 3300006881 Ga0068865_100119253 Ga0068865_1001192532 322
83 3300006931 Ga0097620_100012573 Ga0097620_1000125734 322
84 3300006931 Ga0097620_100065840 Ga0097620_1000658402 322
85 3300009094 Ga0111539_10309628 Ga0111539_103096282 322
86 3300009147 Ga0114129_11013143 Ga0114129_110131431 322
87 3300009176 Ga0105242_10018162 Ga0105242_100181622 322
88 3300009176 Ga0105242_10299162 Ga0105242_102991622 322
89 3300009553 Ga0105249_10001799 Ga0105249_1000179914 322
90 3300009553 Ga0105249_10365988 Ga0105249_103659882 322
91 3300013308 Ga0157375_10004190 Ga0157375_100041902 322
92 3300014326 Ga0157380_10013873 Ga0157380_100138733 322
93 3300014326 Ga0157380_10151261 Ga0157380_101512612 322
94 3300014326 Ga0157380_10182452 Ga0157380_101824522 322
95 3300014745 Ga0157377_10096962 Ga0157377_100969622 322
96 3300014969 Ga0157376_10135842 Ga0157376_101358422 322
97 3300025315 Ga0207697_10025986 Ga0207697_100259862 322
98 3300025321 Ga0207656_10077700 Ga0207656_100777001 322
99 3300025893 Ga0207682_10027450 Ga0207682_100274502 322
100 3300025908 Ga0207643_10008368 Ga0207643_100083686 322
101 3300025918 Ga0207662_10048653 Ga0207662_100486533 322
102 3300025923 Ga0207681_10036208 Ga0207681_100362082 322
103 3300025934 Ga0207686_10014530 Ga0207686_100145302 322
104 3300025936 Ga0207670_10000687 Ga0207670_100006879 322
105 3300025936 Ga0207670_10002843 Ga0207670_100028435 322
106 3300025938 Ga0207704_10240832 Ga0207704_102408322 322
107 3300025940 Ga0207691_10021148 Ga0207691_100211481 322
108 3300025942 Ga0207689_10044184 Ga0207689_100441842 322
109 3300025960 Ga0207651_10073442 Ga0207651_100734423 322
110 3300025961 Ga0207712_10003717 Ga0207712_100037178 322
111 3300025961 Ga0207712_10009896 Ga0207712_100098965 322
112 3300026075 Ga0207708_10065310 Ga0207708_100653103 322
113 3300026088 Ga0207641_10000111 Ga0207641_1000011119 322
114 3300026088 Ga0207641_10026918 Ga0207641_100269185 322
115 3300026088 Ga0207641_10142360 Ga0207641_101423602 322
116 3300026089 Ga0207648_10032967 Ga0207648_100329672 322
117 3300026089 Ga0207648_10207063 Ga0207648_102070632 322
118 3300026116 Ga0207674_10117769 Ga0207674_101177692 322
119 3300031251 Ga0265327_10000117 Ga0265327_10000117143 322
120 3300031548 Ga0307408_100000192 Ga0307408_10000019245 322
121 3300031731 Ga0307405_10195453 Ga0307405_101954532 322
122 3300031901 Ga0307406_10003624 Ga0307406_100036246 322
123 3300031911 Ga0307412_10195757 Ga0307412_101957572 322
124 3300048918 Ga0496115_0420877 Ga0496115_0420877_94_1068 322
125 3300049663 Ga0501223_000294 Ga0501223_000294_5279_6250 322
126 3300050510 nmdc:mga06r32_39147_c1 nmdc:mga06r32_39147_c1_1693_2676 322
127 3300053153 Ga0500616_0028286 Ga0500616_0028286_1582_2568 322
128 3300003323 rootH1_10350930 rootH1_103509303 323
129 3300005330 Ga0070690_100274202 Ga0070690_1002742022 323
130 3300005468 Ga0070707_100181737 Ga0070707_1001817373 323
131 3300005471 Ga0070698_100000434 Ga0070698_10000043443 323
132 3300005471 Ga0070698_100002200 Ga0070698_10000220019 323
133 3300005471 Ga0070698_100089032 Ga0070698_1000890322 323
134 3300005544 Ga0070686_100046180 Ga0070686_1000461802 323
135 3300005563 Ga0068855_100007808 Ga0068855_10000780811 323
136 3300005564 Ga0070664_100046057 Ga0070664_1000460572 323
137 3300005618 Ga0068864_100144845 Ga0068864_1001448452 323
138 3300006237 Ga0097621_100116368 Ga0097621_1001163683 323
139 3300006237 Ga0097621_100177590 Ga0097621_1001775903 323
140 3300006846 Ga0075430_100071113 Ga0075430_1000711132 323
141 3300006880 Ga0075429_100015250 Ga0075429_1000152508 323
142 3300009093 Ga0105240_10042535 Ga0105240_100425352 323
143 3300009147 Ga0114129_10409768 Ga0114129_104097682 323
144 3300009545 Ga0105237_10000056 Ga0105237_1000005634 323
145 3300009545 Ga0105237_10014734 Ga0105237_100147342 323
146 3300009553 Ga0105249_10372666 Ga0105249_103726662 323
147 3300010375 Ga0105239_10000140 Ga0105239_1000014090 323
148 3300011119 Ga0105246_10096161 Ga0105246_100961613 323
149 3300013100 Ga0157373_10008535 Ga0157373_100085355 323
150 3300013104 Ga0157370_10016437 Ga0157370_100164377 323
151 3300013105 Ga0157369_10000015 Ga0157369_10000015115 323
152 3300013297 Ga0157378_10358001 Ga0157378_103580011 323
153 3300013306 Ga0163162_10000520 Ga0163162_100005209 323
154 3300013306 Ga0163162_10247504 Ga0163162_102475041 323
155 3300013306 Ga0163162_10436391 Ga0163162_104363912 323
156 3300013308 Ga0157375_10121018 Ga0157375_101210181 323
157 3300014326 Ga0157380_10022449 Ga0157380_100224495 323
158 3300014968 Ga0157379_10084320 Ga0157379_100843202 323
159 3300015262 Ga0182007_10000010 Ga0182007_1000001099 323
160 3300025907 Ga0207645_10040898 Ga0207645_100408983 323
161 3300025913 Ga0207695_10048875 Ga0207695_100488752 323
162 3300025914 Ga0207671_10001166 Ga0207671_100011665 323
163 3300025914 Ga0207671_10009433 Ga0207671_100094337 323
164 3300025918 Ga0207662_10021743 Ga0207662_100217433 323
165 3300025926 Ga0207659_10116222 Ga0207659_101162222 323
166 3300025926 Ga0207659_10222749 Ga0207659_102227491 323
167 3300025940 Ga0207691_10023326 Ga0207691_100233263 323
168 3300025942 Ga0207689_10007198 Ga0207689_100071987 323
169 3300025942 Ga0207689_10024931 Ga0207689_100249313 323
170 3300025960 Ga0207651_10052856 Ga0207651_100528563 323
171 3300026023 Ga0207677_10156454 Ga0207677_101564541 323
172 3300026035 Ga0207703_10420550 Ga0207703_104205501 323
173 3300026121 Ga0207683_10184822 Ga0207683_101848222 323
174 3300028794 Ga0307515_10000001 Ga0307515_10000001472 323
175 3300030521 Ga0307511_10000580 Ga0307511_1000058014 323
176 3300031251 Ga0265327_10000087 Ga0265327_1000008734 323
177 3300031251 Ga0265327_10058270 Ga0265327_100582702 323
178 3300031456 Ga0307513_10230336 Ga0307513_102303362 323
179 3300031731 Ga0307405_10000049 Ga0307405_1000004935 323
180 3300031903 Ga0307407_10000024 Ga0307407_1000002438 323
181 3300032002 Ga0307416_100000037 Ga0307416_10000003759 323
182 3300032004 Ga0307414_10003504 Ga0307414_1000350410 323
183 3300035692 Ga0373935_0244060 Ga0373935_0244060_218_1207 323
184 3300044712 Ga0453684_0003659 Ga0453684_0003659_23192_24178 323
185 3300046512 Ga0495610_0002755 Ga0495610_0002755_10786_11757 323
186 3300047320 Ga0495672_0009095 Ga0495672_0009095_3393_4370 323
187 3300049679 Ga0501249_010398 Ga0501249_010398_352_1323 323
188 iso_pu_bacteria 2852627209 2852631636 323
189 iso_pu_bacteria 2919186247 2919186964 323
190 iso_pu_bacteria 2939664404 2939665767 323
191 3300005327 Ga0070658_10274667 Ga0070658_102746671 324
192 3300005329 Ga0070683_100004953 Ga0070683_1000049537 324
193 3300005331 Ga0070670_100151181 Ga0070670_1001511813 324
194 3300005344 Ga0070661_100065785 Ga0070661_1000657852 324
195 3300005347 Ga0070668_100071763 Ga0070668_1000717632 324
196 3300005353 Ga0070669_100300250 Ga0070669_1003002501 324
197 3300005356 Ga0070674_100048436 Ga0070674_1000484363 324
198 3300005366 Ga0070659_100042318 Ga0070659_1000423181 324
199 3300005366 Ga0070659_100149784 Ga0070659_1001497842 324
200 3300005367 Ga0070667_100091624 Ga0070667_1000916243 324
201 3300005367 Ga0070667_100192822 Ga0070667_1001928223 324
202 3300005457 Ga0070662_100038202 Ga0070662_1000382024 324
203 3300005457 Ga0070662_100412679 Ga0070662_1004126791 324
204 3300005459 Ga0068867_100009360 Ga0068867_1000093605 324
205 3300005530 Ga0070679_100446227 Ga0070679_1004462272 324
206 3300005535 Ga0070684_100192843 Ga0070684_1001928431 324
207 3300005539 Ga0068853_100022631 Ga0068853_1000226314 324
208 3300005539 Ga0068853_100071145 Ga0068853_1000711451 324
209 3300005539 Ga0068853_100163025 Ga0068853_1001630252 324
210 3300005539 Ga0068853_100198486 Ga0068853_1001984861 324
211 3300005563 Ga0068855_100274504 Ga0068855_1002745042 324
212 3300005563 Ga0068855_100484670 Ga0068855_1004846702 324
213 3300005564 Ga0070664_100193312 Ga0070664_1001933122 324
214 3300005564 Ga0070664_100253493 Ga0070664_1002534932 324
215 3300005577 Ga0068857_100045231 Ga0068857_1000452312 324
216 3300005577 Ga0068857_100064844 Ga0068857_1000648443 324
217 3300005578 Ga0068854_100165981 Ga0068854_1001659812 324
218 3300005616 Ga0068852_100232036 Ga0068852_1002320362 324
219 3300005617 Ga0068859_100078908 Ga0068859_1000789083 324
220 3300005618 Ga0068864_100070103 Ga0068864_1000701033 324
221 3300005618 Ga0068864_100367425 Ga0068864_1003674251 324
222 3300005718 Ga0068866_10064384 Ga0068866_100643842 324
223 3300005842 Ga0068858_100121166 Ga0068858_1001211662 324
224 3300005843 Ga0068860_100004566 Ga0068860_1000045662 324
225 3300005844 Ga0068862_100004879 Ga0068862_10000487913 324
226 3300006931 Ga0097620_100078908 Ga0097620_1000789083 324
227 3300009101 Ga0105247_10002164 Ga0105247_100021644 324
228 3300009553 Ga0105249_10027070 Ga0105249_100270703 324
229 3300013102 Ga0157371_10000119 Ga0157371_1000011988 324
230 3300013102 Ga0157371_10015353 Ga0157371_100153534 324
231 3300013104 Ga0157370_10068596 Ga0157370_100685964 324
232 3300013104 Ga0157370_10230295 Ga0157370_102302952 324
233 3300013104 Ga0157370_10449212 Ga0157370_104492122 324
234 3300013297 Ga0157378_10203761 Ga0157378_102037611 324
235 3300013297 Ga0157378_10271235 Ga0157378_102712352 324
236 3300013307 Ga0157372_10678739 Ga0157372_106787392 324
237 3300013308 Ga0157375_10158783 Ga0157375_101587834 324
238 3300013308 Ga0157375_10314862 Ga0157375_103148622 324
239 3300014325 Ga0163163_10252448 Ga0163163_102524482 324
240 3300014969 Ga0157376_10147224 Ga0157376_101472242 324
241 3300015261 Ga0182006_1000091 Ga0182006_100009185 324
242 3300015682 Ga0183373_1003 Ga0183373_1003455 324
243 3300017792 Ga0163161_10000046 Ga0163161_1000004636 324
244 3300017792 Ga0163161_10000353 Ga0163161_100003532 324
245 3300025899 Ga0207642_10082110 Ga0207642_100821102 324
246 3300025900 Ga0207710_10003395 Ga0207710_100033955 324
247 3300025903 Ga0207680_10263429 Ga0207680_102634291 324
248 3300025917 Ga0207660_10052361 Ga0207660_100523612 324
249 3300025919 Ga0207657_10010871 Ga0207657_100108718 324
250 3300025919 Ga0207657_10038399 Ga0207657_100383992 324
251 3300025920 Ga0207649_10019656 Ga0207649_100196563 324
252 3300025925 Ga0207650_10056156 Ga0207650_100561563 324
253 3300025933 Ga0207706_10013744 Ga0207706_100137443 324
254 3300025934 Ga0207686_10184344 Ga0207686_101843442 324
255 3300025942 Ga0207689_10045098 Ga0207689_100450982 324
256 3300025945 Ga0207679_10019874 Ga0207679_100198744 324
257 3300025960 Ga0207651_10129209 Ga0207651_101292091 324
258 3300025972 Ga0207668_10282881 Ga0207668_102828812 324
259 3300025986 Ga0207658_10057763 Ga0207658_100577633 324
260 3300026035 Ga0207703_10115096 Ga0207703_101150962 324
261 3300026041 Ga0207639_10030508 Ga0207639_100305082 324
262 3300026095 Ga0207676_10051795 Ga0207676_100517952 324
263 3300026095 Ga0207676_10360961 Ga0207676_103609611 324
264 3300026116 Ga0207674_10007033 Ga0207674_100070339 324
265 3300026142 Ga0207698_10007582 Ga0207698_100075825 324
266 3300028380 Ga0268265_10026968 Ga0268265_100269682 324
267 3300028380 Ga0268265_10029771 Ga0268265_100297711 324
268 3300028381 Ga0268264_10007504 Ga0268264_100075043 324
269 3300028794 Ga0307515_10055300 Ga0307515_100553005 324
270 3300031727 Ga0316576_10014153 Ga0316576_100141532 324
271 3300031733 Ga0316577_10008235 Ga0316577_100082356 324
272 3300032137 Ga0316585_10030773 Ga0316585_100307732 324
273 3300033180 Ga0307510_10007160 Ga0307510_100071607 324
274 3300036712 Ga0316584_0001102 Ga0316584_0001102_5357_6346 324
275 3300046460 Ga0495638_0000113 Ga0495638_0000113_125560_126543 324
276 3300046512 Ga0495610_0000045 Ga0495610_0000045_80524_81501 324
277 3300047320 Ga0495672_0108655 Ga0495672_0108655_133_1113 324
278 3300049652 Ga0501202_003236 Ga0501202_003236_567_1544 324
279 3300049663 Ga0501223_005336 Ga0501223_005336_172_1149 324
280 3300049664 Ga0501224_004818 Ga0501224_004818_906_1883 324
281 3300049675 Ga0501243_000292 Ga0501243_000292_5465_6442 324
282 3300049688 Ga0501259_000215 Ga0501259_000215_6411_7388 324
283 3300049704 Ga0501221_002494 Ga0501221_002494_110_1087 324
284 3300049705 Ga0501225_0050373 Ga0501225_0050373_35_1012 324
285 3300049779 Ga0501283_012107 Ga0501283_012107_102_1079 324
286 3300053139 Ga0500568_0052130 Ga0500568_0052130_163_1143 324
287 3300053153 Ga0500616_0000004 Ga0500616_0000004_225955_226935 324
288 iso_pu_bacteria 2738541284 2738761112 324
289 2162886007 SwRhRL2b_contig_2517045 SwRhRL2b_0493.00001990 325
290 2162886007 SwRhRL2b_contig_3952261 SwRhRL2b_0141.00000030 325
291 3300002773 JGI25152J39213_1000168 JGI25152J39213_100016832 325
292 3300002774 JGI25150J39212_1000019 JGI25150J39212_100001966 325
293 3300003187 JGI25151J46595_10000074 JGI25151J46595_1000007466 325
294 3300003215 JGI25153J46596_10000056 JGI25153J46596_1000005666 325
295 3300003320 rootH2_10263957 rootH2_102639572 325
296 3300003323 rootH1_10005337 rootH1_100053372 325
297 3300003323 rootH1_10053218 rootH1_1005321813 325
298 3300003781 Ga0055536_1000016 Ga0055536_1000016130 325
299 3300003791 Ga0055530_10001822 Ga0055530_1000182211 325
300 3300005288 Ga0065714_10002765 Ga0065714_1000276514 325
301 3300005288 Ga0065714_10064461 Ga0065714_1006446126 325
302 3300005289 Ga0065704_10070264 Ga0065704_1007026411 325
303 3300005289 Ga0065704_10140669 Ga0065704_101406692 325
304 3300005328 Ga0070676_10004115 Ga0070676_100041152 325
305 3300005329 Ga0070683_100068855 Ga0070683_1000688554 325
306 3300005330 Ga0070690_100038452 Ga0070690_1000384522 325
307 3300005331 Ga0070670_100341524 Ga0070670_1003415242 325
308 3300005334 Ga0068869_100038806 Ga0068869_1000388064 325
309 3300005334 Ga0068869_100044660 Ga0068869_1000446602 325
310 3300005335 Ga0070666_10007962 Ga0070666_100079623 325
311 3300005338 Ga0068868_100001438 Ga0068868_10000143818 325
312 3300005338 Ga0068868_100018256 Ga0068868_1000182565 325
313 3300005338 Ga0068868_100029755 Ga0068868_1000297554 325
314 3300005347 Ga0070668_100172871 Ga0070668_1001728712 325
315 3300005353 Ga0070669_100001549 Ga0070669_1000015498 325
316 3300005353 Ga0070669_100192309 Ga0070669_1001923092 325
317 3300005354 Ga0070675_100017889 Ga0070675_1000178894 325
318 3300005354 Ga0070675_100043377 Ga0070675_1000433773 325
319 3300005354 Ga0070675_100136541 Ga0070675_1001365412 325
320 3300005355 Ga0070671_100115784 Ga0070671_1001157843 325
321 3300005364 Ga0070673_100253691 Ga0070673_1002536912 325
322 3300005367 Ga0070667_100007783 Ga0070667_1000077836 325
323 3300005367 Ga0070667_100009777 Ga0070667_10000977711 325
324 3300005367 Ga0070667_100023337 Ga0070667_1000233376 325
325 3300005457 Ga0070662_100009312 Ga0070662_1000093125 325
326 3300005457 Ga0070662_100061043 Ga0070662_1000610431 325
327 3300005457 Ga0070662_100211161 Ga0070662_1002111612 325
328 3300005459 Ga0068867_100038192 Ga0068867_1000381924 325
329 3300005466 Ga0070685_10018684 Ga0070685_100186842 325
330 3300005466 Ga0070685_10068077 Ga0070685_100680772 325
331 3300005466 Ga0070685_10112079 Ga0070685_101120792 325
332 3300005548 Ga0070665_100106920 Ga0070665_1001069203 325
333 3300005564 Ga0070664_100041551 Ga0070664_1000415515 325
334 3300005577 Ga0068857_100043387 Ga0068857_1000433874 325
335 3300005578 Ga0068854_100154543 Ga0068854_1001545431 325
336 3300005578 Ga0068854_100223785 Ga0068854_1002237851 325
337 3300005578 Ga0068854_100274702 Ga0068854_1002747022 325
338 3300005616 Ga0068852_100305900 Ga0068852_1003059001 325
339 3300005616 Ga0068852_100312144 Ga0068852_1003121442 325
340 3300005617 Ga0068859_100000186 Ga0068859_10000018625 325
341 3300005617 Ga0068859_100007864 Ga0068859_1000078647 325
342 3300005617 Ga0068859_100034457 Ga0068859_1000344575 325
343 3300005617 Ga0068859_100287430 Ga0068859_1002874302 325
344 3300005618 Ga0068864_100121847 Ga0068864_1001218473 325
345 3300005618 Ga0068864_100140768 Ga0068864_1001407682 325
346 3300005719 Ga0068861_100021056 Ga0068861_1000210564 325
347 3300005834 Ga0068851_10025552 Ga0068851_100255523 325
348 3300005842 Ga0068858_100028292 Ga0068858_1000282923 325
349 3300005843 Ga0068860_100038641 Ga0068860_1000386415 325
350 3300006163 Ga0070715_10153841 Ga0070715_101538411 325
351 3300006237 Ga0097621_100001612 Ga0097621_1000016126 325
352 3300006358 Ga0068871_100092578 Ga0068871_1000925782 325
353 3300006358 Ga0068871_100132237 Ga0068871_1001322373 325
354 3300006358 Ga0068871_100154447 Ga0068871_1001544473 325
355 3300006844 Ga0075428_100057980 Ga0075428_1000579802 325
356 3300006880 Ga0075429_100213814 Ga0075429_1002138142 325
357 3300006881 Ga0068865_100043995 Ga0068865_1000439954 325
358 3300006931 Ga0097620_100000186 Ga0097620_10000018637 325
359 3300006931 Ga0097620_100007864 Ga0097620_1000078647 325
360 3300006931 Ga0097620_100034457 Ga0097620_1000344572 325
361 3300006931 Ga0097620_100287452 Ga0097620_1002874522 325
362 3300009093 Ga0105240_10253733 Ga0105240_102537332 325
363 3300009094 Ga0111539_10004826 Ga0111539_100048267 325
364 3300009094 Ga0111539_10011457 Ga0111539_1001145710 325
365 3300009101 Ga0105247_10015899 Ga0105247_100158992 325
366 3300009101 Ga0105247_10129083 Ga0105247_101290832 325
367 3300009174 Ga0105241_10011692 Ga0105241_100116923 325
368 3300009174 Ga0105241_10135616 Ga0105241_101356161 325
369 3300009176 Ga0105242_10187885 Ga0105242_101878852 325
370 3300009545 Ga0105237_10019727 Ga0105237_100197272 325
371 3300009545 Ga0105237_10109176 Ga0105237_101091762 325
372 3300009553 Ga0105249_10096546 Ga0105249_100965463 325
373 3300009553 Ga0105249_10149714 Ga0105249_101497142 325
374 3300010375 Ga0105239_10122906 Ga0105239_101229061 325
375 3300011119 Ga0105246_10022520 Ga0105246_100225203 325
376 3300011119 Ga0105246_10074523 Ga0105246_100745232 325
377 3300013100 Ga0157373_10000043 Ga0157373_1000004359 325
378 3300013102 Ga0157371_10000416 Ga0157371_1000041623 325
379 3300013102 Ga0157371_10001802 Ga0157371_1000180210 325
380 3300013104 Ga0157370_10016180 Ga0157370_100161806 325
381 3300013104 Ga0157370_10084206 Ga0157370_100842061 325
382 3300013104 Ga0157370_10158677 Ga0157370_101586773 325
383 3300013104 Ga0157370_10328564 Ga0157370_103285642 325
384 3300013296 Ga0157374_10110262 Ga0157374_101102623 325
385 3300013296 Ga0157374_10214314 Ga0157374_102143142 325
386 3300013297 Ga0157378_10046526 Ga0157378_100465262 325
387 3300013297 Ga0157378_10069477 Ga0157378_100694773 325
388 3300013297 Ga0157378_10082166 Ga0157378_100821662 325
389 3300013306 Ga0163162_10000503 Ga0163162_1000050310 325
390 3300013306 Ga0163162_10004595 Ga0163162_100045958 325
391 3300013306 Ga0163162_10018243 Ga0163162_100182436 325
392 3300013307 Ga0157372_10021922 Ga0157372_100219223 325
393 3300013308 Ga0157375_10011168 Ga0157375_100111688 325
394 3300013308 Ga0157375_10033185 Ga0157375_100331854 325
395 3300013308 Ga0157375_10129449 Ga0157375_101294493 325
396 3300014325 Ga0163163_10060041 Ga0163163_100600413 325
397 3300014325 Ga0163163_10095282 Ga0163163_100952822 325
398 3300014326 Ga0157380_10004237 Ga0157380_100042379 325
399 3300014497 Ga0182008_10000018 Ga0182008_100000185 325
400 3300014745 Ga0157377_10001470 Ga0157377_100014702 325
401 3300014745 Ga0157377_10017466 Ga0157377_100174663 325
402 3300014968 Ga0157379_10122738 Ga0157379_101227382 325
403 3300014969 Ga0157376_10003846 Ga0157376_100038467 325
404 3300017792 Ga0163161_10000589 Ga0163161_100005897 325
405 3300017792 Ga0163161_10014202 Ga0163161_100142024 325
406 3300025245 Ga0207425_1000007 Ga0207425_1000007253 325
407 3300025258 Ga0209129_1000006 Ga0209129_1000006253 325
408 3300025292 Ga0209676_1000106 Ga0209676_100010674 325
409 3300025294 Ga0209025_1000025 Ga0209025_100002583 325
410 3300025297 Ga0209758_1000016 Ga0209758_1000016253 325
411 3300025298 Ga0209050_1000174 Ga0209050_100017484 325
412 3300025903 Ga0207680_10003295 Ga0207680_100032957 325
413 3300025903 Ga0207680_10081168 Ga0207680_100811681 325
414 3300025908 Ga0207643_10163065 Ga0207643_101630652 325
415 3300025914 Ga0207671_10014727 Ga0207671_100147276 325
416 3300025919 Ga0207657_10399191 Ga0207657_103991912 325
417 3300025920 Ga0207649_10099074 Ga0207649_100990742 325
418 3300025923 Ga0207681_10032416 Ga0207681_100324164 325
419 3300025923 Ga0207681_10177672 Ga0207681_101776722 325
420 3300025926 Ga0207659_10020890 Ga0207659_100208902 325
421 3300025927 Ga0207687_10332335 Ga0207687_103323352 325
422 3300025933 Ga0207706_10008726 Ga0207706_100087262 325
423 3300025933 Ga0207706_10251978 Ga0207706_102519782 325
424 3300025933 Ga0207706_10295269 Ga0207706_102952692 325
425 3300025942 Ga0207689_10000687 Ga0207689_1000068725 325
426 3300025942 Ga0207689_10025599 Ga0207689_100255993 325
427 3300025942 Ga0207689_10136814 Ga0207689_101368142 325
428 3300025944 Ga0207661_10299507 Ga0207661_102995072 325
429 3300025960 Ga0207651_10058606 Ga0207651_100586062 325
430 3300025960 Ga0207651_10155248 Ga0207651_101552482 325
431 3300025961 Ga0207712_10088556 Ga0207712_100885562 325
432 3300025961 Ga0207712_10092051 Ga0207712_100920513 325
433 3300025972 Ga0207668_10023595 Ga0207668_100235954 325
434 3300025972 Ga0207668_10173599 Ga0207668_101735992 325
435 3300025986 Ga0207658_10006184 Ga0207658_100061846 325
436 3300025986 Ga0207658_10029037 Ga0207658_100290372 325
437 3300026023 Ga0207677_10030084 Ga0207677_100300844 325
438 3300026035 Ga0207703_10011809 Ga0207703_100118096 325
439 3300026035 Ga0207703_10038406 Ga0207703_100384064 325
440 3300026075 Ga0207708_10228745 Ga0207708_102287452 325
441 3300026088 Ga0207641_10000194 Ga0207641_1000019424 325
442 3300026088 Ga0207641_10113982 Ga0207641_101139822 325
443 3300026095 Ga0207676_10064162 Ga0207676_100641624 325
444 3300026116 Ga0207674_10007660 Ga0207674_100076607 325
445 3300026118 Ga0207675_100000594 Ga0207675_10000059411 325
446 3300026121 Ga0207683_10025740 Ga0207683_100257404 325
447 3300026142 Ga0207698_10036485 Ga0207698_100364853 325
448 3300026142 Ga0207698_10252944 Ga0207698_102529442 325
449 3300026142 Ga0207698_10270350 Ga0207698_102703501 325
450 3300027907 Ga0207428_10048260 Ga0207428_100482602 325
451 3300028380 Ga0268265_10009189 Ga0268265_100091894 325
452 3300028381 Ga0268264_10004807 Ga0268264_100048073 325
453 3300028794 Ga0307515_10000074 Ga0307515_1000007425 325
454 3300031548 Ga0307408_100000386 Ga0307408_1000003865 325
455 3300031548 Ga0307408_100000742 Ga0307408_1000007424 325
456 3300031548 Ga0307408_100000797 Ga0307408_10000079712 325
457 3300031901 Ga0307406_10056092 Ga0307406_100560922 325
458 3300031911 Ga0307412_10000075 Ga0307412_1000007524 325
459 3300031911 Ga0307412_10010592 Ga0307412_100105922 325
460 3300036401 Ga0373937_0034836 Ga0373937_0034836_2098_3084 325
461 3300037418 Ga0395900_0507140 Ga0395900_0507140_96_1103 325
462 3300037466 Ga0395898_0133908 Ga0395898_0133908_160_1167 325
463 3300038443 Ga0395901_0074536 Ga0395901_0074536_841_1848 325
464 3300042014 Ga0439457_020374 Ga0439457_020374_317_1294 325
465 3300046454 Ga0495592_0299194 Ga0495592_0299194_43_1029 325
466 3300046517 Ga0495630_0010504 Ga0495630_0010504_5136_6122 325
467 3300046642 Ga0495634_0084695 Ga0495634_0084695_1052_2038 325
468 3300046663 Ga0495635_0094258 Ga0495635_0094258_500_1486 325
469 3300046694 Ga0495649_0075065 Ga0495649_0075065_677_1660 325
470 3300047321 Ga0495676_0209650 Ga0495676_0209650_150_1136 325
471 3300047471 Ga0495684_0058258 Ga0495684_0058258_1724_2710 325
472 3300048917 Ga0496114_0201595 Ga0496114_0201595_216_1196 325
473 3300048925 Ga0496122_0005517 Ga0496122_0005517_9601_10581 325
474 3300048926 Ga0496123_0014761 Ga0496123_0014761_872_1852 325
475 3300049568 Ga0501031_0188861 Ga0501031_0188861_234_1223 325
476 3300049569 Ga0501032_0010676 Ga0501032_0010676_1045_2028 325
477 3300049570 Ga0501033_0046070 Ga0501033_0046070_2049_3032 325
478 3300049571 Ga0501034_0034920 Ga0501034_0034920_122_1105 325
479 3300049572 Ga0501036_0037380 Ga0501036_0037380_2242_3225 325
480 3300049572 Ga0501036_0101626 Ga0501036_0101626_1040_2029 325
481 3300049573 Ga0501037_0009716 Ga0501037_0009716_4449_5432 325
482 3300049574 Ga0501038_0079991 Ga0501038_0079991_1201_2190 325
483 3300049575 Ga0501039_0012871 Ga0501039_0012871_2464_3447 325
484 3300049575 Ga0501039_0118407 Ga0501039_0118407_42_1031 325
485 3300049579 Ga0501043_0010274 Ga0501043_0010274_4901_5884 325
486 3300049581 Ga0501047_0053728 Ga0501047_0053728_1333_2316 325
487 3300049581 Ga0501047_0152208 Ga0501047_0152208_328_1317 325
488 3300049705 Ga0501225_0024874 Ga0501225_0024874_254_1237 325
489 3300049758 Ga0501241_005449 Ga0501241_005449_349_1335 325
490 3300049822 Ga0501035_0082133 Ga0501035_0082133_1380_2369 325
491 3300049822 Ga0501035_0091174 Ga0501035_0091174_702_1685 325
492 3300049823 Ga0501044_0031349 Ga0501044_0031349_4486_5475 325
493 3300050511 nmdc:mga08y16_5445_c1 nmdc:mga08y16_5445_c1_7892_8878 325
494 3300050511 nmdc:mga08y16_8130_c1 nmdc:mga08y16_8130_c1_2138_3148 325
495 3300053093 Ga0500651_0000204 Ga0500651_0000204_16827_17807 325
496 3300053727 Ga0500611_000059 Ga0500611_000059_47683_48675 325
497 iso_pu_bacteria 2738541276 2738716432 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

39

159

0.96

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

167

295

0.96

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

171

360

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zh8-assembly1.cif.gz_B crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution 0.91 3 320
3evn-assembly1.cif.gz_A crystal structure of putative oxidoreductase from streptococcus agalactiae 2603v/r 0.8998 3 321
3e9m-assembly2.cif.gz_C-2 crystal structure of an oxidoreductase from enterococcus faecalis 0.8879 3 321
1h6d-assembly3.cif.gz_I oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol 0.8861 1 319
4had-assembly1.cif.gz_D crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.8858 3 321
ID Description Score Start End Superfamily
2glxE01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9578 5 122 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9506 4 122 3.40.50.720
af_Q2G1E5_4_119_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9459 4 120 3.40.50.720
4hadB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9437 3 120 3.40.50.720
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9428 4 120 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7G5DXT4-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9829 3 325 GO:0000166
GO:0016491
AF-A0A537K046-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9828 1 321 GO:0000166
GO:0016491
AF-A0A0P7YWM2-F1-model_v4 Putative dehydrogenase 0.9783 1 100 GO:0000166
AF-A0A7G5DXT4-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.974 3 325 GO:0000166
GO:0016491
AF-A0A2V9TAZ6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9696 4 108 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.3 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map