F455044

General Info

Members Datasets Scaffolds Average Seq Length
497 255 490 123

Family's Representative Sequence

Representative Sequence 3300025261|Ga0209233_1019062|Ga0209233_10190622
Length 139
Sequence MLSDSVINPRKHHGSNVKKTELRNDFLELRELIREFVSERDWDKFHTPKNLATALSVEASELLEPFQWLVSGDKSELDEAKETAIRHEMADVLVYLVRLADKLDVDLFQAVVEKMALNRQKYPVDKVRGDSRKYSEYKD

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
4 2818991436 Collimonas arenae 515 Isolate Unclassified
5 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
59 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
60 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
61 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
99 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
100 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
101 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
116 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
117 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
215 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
247 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
248 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
255 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 1.41
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 0
Rhizoplane 3.02
Rhizosphere 85.11
Stem 0
Stem Tuber 0
Unclassified 6.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000172 3300002705 Bacteria 47326
2 JGI25162J39368_1000001 3300002737 Bacteria 740113
3 JGI25163J39215_1004836 3300002771 Bacteria 908
4 JGI25165J46597_1000001 3300003214 Bacteria 1111887
5 rootH1_10064325 3300003316 Unclassified 2412
6 rootL2_10019994 3300003322 Bacteria 3537
7 rootL2_10207789 3300003322 Bacteria 1730
8 Ga0055538_1000001 3300003751 Bacteria 1111887
9 Ga0055539_1000001 3300003752 Bacteria 1111887
10 Ga0055533_1000003 3300003756 Bacteria 1111887
11 Ga0055525_1000003 3300003759 Bacteria 962094
12 Ga0055525_1000081 3300003759 Bacteria 161329
13 Ga0055541_1000001 3300003841 Bacteria 1111887
14 Ga0065165_1025259 3300005262 Bacteria 1980
15 Ga0065704_10152495 3300005289 Bacteria 1417
16 Ga0065715_10191815 3300005293 Bacteria 1410
17 Ga0070658_10147010 3300005327 Bacteria 1971
18 Ga0070658_10224488 3300005327 Bacteria 1589
19 Ga0070658_10302699 3300005327 Bacteria 1363
20 Ga0070683_100417412 3300005329 Bacteria 1280
21 Ga0070670_100001679 3300005331 Bacteria 17970
22 Ga0070680_100107996 3300005336 Bacteria 2315
23 Ga0070660_100064765 3300005339 Bacteria 2844
24 Ga0070660_100161014 3300005339 Bacteria 1808
25 Ga0070671_101372271 3300005355 Unclassified 624
26 Ga0070659_100021372 3300005366 Bacteria 4928
27 Ga0070659_100568809 3300005366 Bacteria 972
28 Ga0070701_11091575 3300005438 Unclassified 561
29 Ga0070662_100306060 3300005457 Bacteria 1292
30 Ga0070662_100876736 3300005457 Bacteria 765
31 Ga0070681_10125076 3300005458 Bacteria 2504
32 Ga0068867_101079674 3300005459 Bacteria 732
33 Ga0070672_100493732 3300005543 Bacteria 1058
34 Ga0070665_100002338 3300005548 Bacteria 21033
35 Ga0070664_100062278 3300005564 Bacteria 3180
36 Ga0070664_100589376 3300005564 Bacteria 1030
37 Ga0068854_101065089 3300005578 Bacteria 719
38 Ga0068852_100276130 3300005616 Bacteria 1618
39 Ga0075366_10386276 3300006195 Bacteria 861
40 Ga0097621_100428147 3300006237 Bacteria 1189
41 Ga0068865_100112929 3300006881 Bacteria 2007
42 Ga0105244_10239869 3300009036 Bacteria 847
43 Ga0111539_10596812 3300009094 Bacteria 1286
44 Ga0105245_10198451 3300009098 Bacteria 1926
45 Ga0105245_10494651 3300009098 Bacteria 1238
46 Ga0105243_10035911 3300009148 Bacteria 3844
47 Ga0105242_10112144 3300009176 Bacteria 2327
48 Ga0105242_10713201 3300009176 Bacteria 983
49 Ga0105248_11306142 3300009177 Bacteria 821
50 Ga0105237_10155715 3300009545 Bacteria 2282
51 Ga0105238_10206328 3300009551 Bacteria 1941
52 Ga0105239_10671124 3300010375 Bacteria 1184
53 Ga0105239_12838752 3300010375 Bacteria 565
54 Ga0157373_10128552 3300013100 Bacteria 1782
55 Ga0157373_11050708 3300013100 Bacteria 609
56 Ga0157370_10030749 3300013104 Bacteria 5260
57 Ga0157370_10958895 3300013104 Unclassified 775
58 Ga0157374_10863390 3300013296 Bacteria 922
59 Ga0163162_10006946 3300013306 Bacteria 10976
60 Ga0163162_11497342 3300013306 Bacteria 769
61 Ga0157372_10235715 3300013307 Bacteria 2122
62 Ga0163163_10071146 3300014325 Bacteria 3465
63 Ga0182008_10178202 3300014497 Bacteria 1075
64 Ga0182006_1013493 3300015261 Bacteria 3544
65 Ga0182007_10000603 3300015262 Bacteria 21037
66 Ga0182007_10002074 3300015262 Bacteria 10299
67 Ga0182007_10003306 3300015262 Bacteria 7639
68 Ga0182007_10181171 3300015262 Bacteria 729
69 Ga0182005_1000162 3300015265 Bacteria 46144
70 Ga0183366_1001 3300015679 Bacteria 2743932
71 Ga0183370_1001 3300015680 Bacteria 2743932
72 Ga0183369_1001 3300015685 Bacteria 2743932
73 Ga0183368_1001 3300015687 Bacteria 2743932
74 Ga0213872_10000494 3300021361 Bacteria 31496
75 Ga0213876_10181779 3300021384 Bacteria 1118
76 Ga0209784_100004 3300025224 Bacteria 1378156
77 Ga0209566_100004 3300025225 Bacteria 1531866
78 Ga0209674_100006 3300025226 Bacteria 1531866
79 Ga0209563_100009 3300025230 Bacteria 1378156
80 Ga0209563_100015 3300025230 Bacteria 879901
81 Ga0207427_100300 3300025231 Bacteria 34562
82 Ga0209437_100004 3300025233 Bacteria 1378156
83 Ga0209677_100005 3300025253 Bacteria 1378156
84 Ga0209677_105323 3300025253 Bacteria 3392
85 Ga0209759_1000044 3300025256 Bacteria 241431
86 Ga0209233_1000005 3300025261 Bacteria 1531866
87 Ga0209233_1019062 3300025261 Bacteria 1831
88 Ga0207647_10371485 3300025904 Bacteria 808
89 Ga0207705_10035870 3300025909 Bacteria 3548
90 Ga0207705_10593497 3300025909 Bacteria 861
91 Ga0207707_10013939 3300025912 Bacteria 7008
92 Ga0207671_10946258 3300025914 Bacteria 680
93 Ga0207660_10028089 3300025917 Bacteria 3846
94 Ga0207657_10129140 3300025919 Bacteria 2073
95 Ga0207649_11545004 3300025920 Bacteria 525
96 Ga0207694_10012523 3300025924 Bacteria 6395
97 Ga0207694_10195736 3300025924 Bacteria 1643
98 Ga0207650_10009507 3300025925 Bacteria 6643
99 Ga0207687_10834639 3300025927 Bacteria 787
100 Ga0207690_11241308 3300025932 Bacteria 622
101 Ga0207706_10804347 3300025933 Bacteria 798
102 Ga0207686_10078241 3300025934 Bacteria 2150
103 Ga0207669_10479928 3300025937 Bacteria 991
104 Ga0207704_10747411 3300025938 Bacteria 813
105 Ga0207691_10573950 3300025940 Bacteria 956
106 Ga0207691_10626305 3300025940 Bacteria 910
107 Ga0207661_11857612 3300025944 Bacteria 548
108 Ga0207679_10563543 3300025945 Bacteria 1023
109 Ga0207679_10685012 3300025945 Bacteria 929
110 Ga0207667_10024708 3300025949 Bacteria 6590
111 Ga0207640_10281115 3300025981 Bacteria 1307
112 Ga0207658_10038190 3300025986 Bacteria 3457
113 Ga0207658_10213553 3300025986 Bacteria 1619
114 Ga0207702_10763433 3300026078 Bacteria 955
115 Ga0207648_11685177 3300026089 Bacteria 595
116 Ga0207674_10138308 3300026116 Bacteria 2396
117 Ga0268266_10004389 3300028379 Bacteria 13532
118 Ga0316177_1169245 3300030731 Bacteria 1947
119 Ga0316180_1009533 3300030736 Bacteria 2041
120 Ga0316183_1074355 3300030742 Bacteria 649
121 Ga0316182_1007574 3300030745 Bacteria 1821
122 Ga0316182_1164309 3300030745 Bacteria 1804
123 Ga0373926_0259165 3300035083 Bacteria 675
124 Ga0373925_1103872 3300037068 Bacteria 653
125 Ga0395899_0000207 3300037312 Bacteria 86182
126 Ga0395899_0018315 3300037312 Bacteria 5324
127 Ga0395899_0036161 3300037312 Bacteria 3705
128 Ga0395899_0060743 3300037312 Bacteria 2784
129 Ga0395899_0067433 3300037312 Bacteria 2625
130 Ga0395899_0079470 3300037312 Bacteria 2388
131 Ga0395899_0289995 3300037312 Bacteria 1110
132 Ga0395899_0352895 3300037312 Bacteria 983
133 Ga0395899_0840200 3300037312 Bacteria 564
134 Ga0395900_0001085 3300037418 Bacteria 34636
135 Ga0395900_0004368 3300037418 Bacteria 14997
136 Ga0395900_0086594 3300037418 Bacteria 3219
137 Ga0395900_0365942 3300037418 Bacteria 1412
138 Ga0395900_1228462 3300037418 Bacteria 664
139 Ga0395898_0013866 3300037466 Bacteria 8284
140 Ga0395898_0041653 3300037466 Bacteria 4535
141 Ga0395898_0109689 3300037466 Bacteria 2645
142 Ga0395898_0199604 3300037466 Bacteria 1910
143 Ga0395898_0264498 3300037466 Bacteria 1640
144 Ga0395898_0566339 3300037466 Bacteria 1078
145 Ga0395905_0091303 3300037471 Bacteria 2855
146 Ga0395905_0146265 3300037471 Bacteria 2223
147 Ga0395905_0356413 3300037471 Bacteria 1355
148 Ga0395905_0423956 3300037471 Bacteria 1227
149 Ga0395905_0954643 3300037471 Bacteria 760
150 Ga0395901_0002559 3300038443 Bacteria 18423
151 Ga0395901_0065527 3300038443 Bacteria 3782
152 Ga0395901_0070358 3300038443 Bacteria 3645
153 Ga0395901_0165731 3300038443 Bacteria 2320
154 Ga0395901_0188979 3300038443 Bacteria 2160
155 Ga0395901_0855446 3300038443 Bacteria 894
156 Ga0395901_1065887 3300038443 Bacteria 780
157 Ga0395901_1953738 3300038443 Bacteria 533
158 Ga0400483_200851 3300039062 Bacteria 3195
159 Ga0436365_0730722 3300039437 Bacteria 1200
160 Ga0436361_0062839 3300039447 Bacteria 58101
161 Ga0436361_0862518 3300039447 Bacteria 2367
162 Ga0439453_0155591 3300041408 Bacteria 545
163 Ga0439448_0003199 3300042005 Bacteria 4520
164 Ga0439448_0008221 3300042005 Bacteria 3049
165 Ga0439449_0179474 3300042007 Bacteria 791
166 Ga0439455_0077113 3300042012 Bacteria 902
167 Ga0450904_000393 3300042139 Bacteria 9037
168 Ga0439458_0008630 3300042157 Bacteria 2271
169 Ga0439435_0096237 3300042436 Bacteria 905
170 Ga0450893_0129709 3300042532 Bacteria 532
171 Ga0466969_0285914 3300044656 Bacteria 746
172 Ga0466972_0013270 3300044658 Bacteria 4136
173 Ga0466965_0029894 3300044683 Bacteria 2652
174 Ga0466966_0047538 3300044684 Bacteria 2735
175 Ga0466966_0217953 3300044684 Bacteria 1152
176 Ga0466961_0052934 3300044693 Bacteria 2591
177 Ga0466963_1247735 3300044694 Bacteria 522
178 Ga0466970_0099844 3300044765 Bacteria 1580
179 Ga0466957_0001772 3300044842 Bacteria 11366
180 Ga0466957_0030187 3300044842 Bacteria 3236
181 Ga0466957_0133277 3300044842 Bacteria 1594
182 Ga0466960_0057503 3300044901 Bacteria 1897
183 Ga0466959_0059528 3300045049 Bacteria 2781
184 Ga0466958_0106481 3300045836 Bacteria 1748
185 Ga0466958_0324002 3300045836 Bacteria 990
186 Ga0466967_0013652 3300045976 Bacteria 6288
187 Ga0466967_0583381 3300045976 Bacteria 1102
188 Ga0466967_0630782 3300045976 Bacteria 1059
189 Ga0495617_005348 3300046452 Bacteria 4561
190 Ga0495617_102141 3300046452 Bacteria 932
191 Ga0495627_007535 3300046453 Bacteria 4161
192 Ga0495592_0012109 3300046454 Bacteria 6543
193 Ga0495592_0258393 3300046454 Bacteria 1148
194 Ga0495603_0103657 3300046455 Bacteria 1660
195 Ga0495590_0011799 3300046457 Bacteria 3257
196 Ga0495590_0030542 3300046457 Bacteria 1888
197 Ga0495629_0000143 3300046459 Bacteria 63075
198 Ga0495638_0012658 3300046460 Bacteria 5771
199 Ga0495638_0114699 3300046460 Bacteria 1597
200 Ga0495651_0042791 3300046462 Bacteria 3515
201 Ga0495651_0045228 3300046462 Bacteria 3411
202 Ga0495651_0047691 3300046462 Bacteria 3311
203 Ga0495651_0051362 3300046462 Bacteria 3178
204 Ga0495651_0237076 3300046462 Bacteria 1253
205 Ga0495653_0000737 3300046463 Bacteria 24985
206 Ga0495653_0171042 3300046463 Bacteria 1499
207 Ga0495653_0618128 3300046463 Unclassified 664
208 Ga0495650_0001898 3300046471 Bacteria 18542
209 Ga0495650_0005971 3300046471 Bacteria 7716
210 Ga0495580_0018442 3300046472 Bacteria 5194
211 Ga0495580_0412393 3300046472 Bacteria 909
212 Ga0495582_0046759 3300046473 Bacteria 2384
213 Ga0495605_0000725 3300046474 Bacteria 24295
214 Ga0495605_0003042 3300046474 Bacteria 10121
215 Ga0495605_0005292 3300046474 Bacteria 7529
216 Ga0495605_0025373 3300046474 Bacteria 3088
217 Ga0495605_0198026 3300046474 Bacteria 876
218 Ga0495584_0000044 3300046491 Bacteria 89613
219 Ga0495584_0010342 3300046491 Bacteria 4796
220 Ga0495584_0016426 3300046491 Bacteria 3774
221 Ga0495584_0020931 3300046491 Bacteria 3320
222 Ga0495584_0023296 3300046491 Bacteria 3139
223 Ga0495584_0024396 3300046491 Bacteria 3067
224 Ga0495584_0028181 3300046491 Bacteria 2845
225 Ga0495584_0099683 3300046491 Bacteria 1468
226 Ga0495585_0000373 3300046492 Bacteria 43211
227 Ga0495585_0012001 3300046492 Bacteria 5113
228 Ga0495585_0023426 3300046492 Bacteria 3542
229 Ga0495585_0026238 3300046492 Bacteria 3328
230 Ga0495585_0045372 3300046492 Bacteria 2453
231 Ga0495585_0122601 3300046492 Bacteria 1374
232 Ga0495585_0156421 3300046492 Bacteria 1185
233 Ga0495585_0224200 3300046492 Bacteria 947
234 Ga0495585_0316797 3300046492 Bacteria 763
235 Ga0495594_0055675 3300046499 Bacteria 2181
236 Ga0495596_0004031 3300046500 Bacteria 7235
237 Ga0495596_0008067 3300046500 Bacteria 4702
238 Ga0495596_0008865 3300046500 Bacteria 4451
239 Ga0495607_0002063 3300046501 Bacteria 16805
240 Ga0495607_0014708 3300046501 Bacteria 5086
241 Ga0495607_0025736 3300046501 Bacteria 3658
242 Ga0495607_0027351 3300046501 Bacteria 3527
243 Ga0495583_0000222 3300046506 Bacteria 95964
244 Ga0495583_0000416 3300046506 Bacteria 64790
245 Ga0495583_0019083 3300046506 Bacteria 3588
246 Ga0495583_0027919 3300046506 Bacteria 2779
247 Ga0495583_0060754 3300046506 Bacteria 1688
248 Ga0495583_0066423 3300046506 Bacteria 1595
249 Ga0495583_0125539 3300046506 Bacteria 1077
250 Ga0495606_0021344 3300046507 Bacteria 4744
251 Ga0495606_0068915 3300046507 Bacteria 2237
252 Ga0495606_0161448 3300046507 Bacteria 1307
253 Ga0495606_0421492 3300046507 Bacteria 690
254 Ga0495606_0486685 3300046507 Bacteria 625
255 Ga0495608_0014555 3300046511 Bacteria 5457
256 Ga0495608_0190075 3300046511 Bacteria 1296
257 Ga0495610_0202429 3300046512 Bacteria 812
258 Ga0495616_0000786 3300046513 Bacteria 23181
259 Ga0495616_0007605 3300046513 Bacteria 6480
260 Ga0495616_0015523 3300046513 Bacteria 4234
261 Ga0495618_0111649 3300046514 Bacteria 1750
262 Ga0495618_0401435 3300046514 Unclassified 838
263 Ga0495620_0028381 3300046515 Bacteria 2603
264 Ga0495628_0000452 3300046516 Bacteria 37463
265 Ga0495628_0016341 3300046516 Bacteria 6192
266 Ga0495628_0023833 3300046516 Bacteria 5018
267 Ga0495628_0073075 3300046516 Bacteria 2672
268 Ga0495628_0080501 3300046516 Bacteria 2532
269 Ga0495630_0016134 3300046517 Bacteria 5458
270 Ga0495631_0004022 3300046518 Bacteria 7914
271 Ga0495631_0005941 3300046518 Bacteria 6350
272 Ga0495631_0010417 3300046518 Bacteria 4598
273 Ga0495631_0159979 3300046518 Bacteria 966
274 Ga0495632_0070038 3300046519 Bacteria 1687
275 Ga0495643_0002952 3300046522 Bacteria 12877
276 Ga0495643_0013272 3300046522 Bacteria 4937
277 Ga0495643_0025510 3300046522 Bacteria 3343
278 Ga0495643_0412725 3300046522 Bacteria 593
279 Ga0495644_0026955 3300046523 Bacteria 2179
280 Ga0495644_0028755 3300046523 Bacteria 2102
281 Ga0495644_0058902 3300046523 Bacteria 1444
282 Ga0495648_0000460 3300046524 Bacteria 44135
283 Ga0495648_0012270 3300046524 Bacteria 6401
284 Ga0495648_0047540 3300046524 Bacteria 2650
285 Ga0495663_0006532 3300046525 Bacteria 3218
286 Ga0495663_0028693 3300046525 Bacteria 1639
287 Ga0495663_0198995 3300046525 Bacteria 699
288 Ga0495666_0034508 3300046526 Bacteria 2469
289 Ga0495666_0061503 3300046526 Bacteria 1794
290 Ga0495642_0000515 3300046528 Bacteria 19938
291 Ga0495642_0004529 3300046528 Bacteria 5392
292 Ga0495642_0008794 3300046528 Bacteria 3860
293 Ga0495642_0038027 3300046528 Bacteria 1949
294 Ga0495642_0131488 3300046528 Bacteria 1077
295 Ga0495652_0009820 3300046529 Bacteria 8677
296 Ga0495652_0051905 3300046529 Bacteria 3499
297 Ga0495652_0055538 3300046529 Bacteria 3367
298 Ga0495665_0066667 3300046531 Bacteria 1899
299 Ga0495640_0343030 3300046533 Unclassified 923
300 Ga0495586_0109905 3300046535 Bacteria 1534
301 Ga0495609_0000028 3300046538 Bacteria 219908
302 Ga0495597_0011740 3300046542 Bacteria 4241
303 Ga0495597_0040478 3300046542 Bacteria 2083
304 Ga0495597_0202510 3300046542 Bacteria 794
305 Ga0495597_0213539 3300046542 Bacteria 768
306 Ga0495645_0057145 3300046543 Bacteria 2833
307 Ga0495645_0238808 3300046543 Bacteria 1213
308 Ga0495622_0023304 3300046557 Bacteria 2885
309 Ga0495622_0023818 3300046557 Bacteria 2856
310 Ga0495633_0009578 3300046558 Bacteria 5339
311 Ga0495633_0010467 3300046558 Bacteria 5058
312 Ga0495633_0014279 3300046558 Bacteria 4158
313 Ga0495633_0042910 3300046558 Bacteria 2146
314 Ga0495656_0001130 3300046615 Bacteria 8676
315 Ga0495656_0059289 3300046615 Bacteria 1665
316 Ga0495656_0089141 3300046615 Bacteria 1407
317 Ga0495668_0004042 3300046616 Bacteria 10671
318 Ga0495668_0017959 3300046616 Bacteria 4096
319 Ga0495668_0261612 3300046616 Bacteria 947
320 Ga0495668_0634090 3300046616 Bacteria 590
321 Ga0495611_0002946 3300046648 Bacteria 7585
322 Ga0495611_0010111 3300046648 Bacteria 3993
323 Ga0495611_0012917 3300046648 Bacteria 3550
324 Ga0495611_0022679 3300046648 Bacteria 2717
325 Ga0495611_0243850 3300046648 Bacteria 833
326 Ga0495625_0024656 3300046660 Bacteria 4573
327 Ga0495659_0036121 3300046664 Bacteria 1744
328 Ga0495659_0038115 3300046664 Bacteria 1706
329 Ga0495661_0000682 3300046665 Bacteria 33847
330 Ga0495661_0013786 3300046665 Bacteria 5424
331 Ga0495661_0028764 3300046665 Bacteria 3553
332 Ga0495661_0065792 3300046665 Bacteria 2135
333 Ga0495661_0089898 3300046665 Bacteria 1749
334 Ga0495661_0092044 3300046665 Bacteria 1723
335 Ga0495661_0135339 3300046665 Bacteria 1345
336 Ga0495661_0209902 3300046665 Bacteria 1014
337 Ga0495661_0232083 3300046665 Bacteria 951
338 Ga0495588_0321700 3300046674 Bacteria 813
339 Ga0495657_0030667 3300046675 Bacteria 3764
340 Ga0495599_0028483 3300046678 Bacteria 3501
341 Ga0495623_0018389 3300046679 Bacteria 4513
342 Ga0495623_0046002 3300046679 Bacteria 2770
343 Ga0495623_0062397 3300046679 Bacteria 2336
344 Ga0495623_0145743 3300046679 Bacteria 1404
345 Ga0495646_0000468 3300046680 Bacteria 21500
346 Ga0495646_0001706 3300046680 Bacteria 13171
347 Ga0495646_0003033 3300046680 Bacteria 10400
348 Ga0495669_0085332 3300046684 Bacteria 1453
349 Ga0495613_0364602 3300046689 Bacteria 990
350 Ga0495624_0004685 3300046690 Bacteria 9957
351 Ga0495624_0026721 3300046690 Bacteria 3781
352 Ga0495624_0074389 3300046690 Bacteria 2110
353 Ga0495624_0090294 3300046690 Bacteria 1890
354 Ga0495670_0006178 3300046691 Bacteria 5884
355 Ga0495670_0014035 3300046691 Bacteria 3941
356 Ga0495670_0022667 3300046691 Bacteria 3101
357 Ga0495670_0333983 3300046691 Bacteria 814
358 Ga0495671_0040871 3300046692 Bacteria 2337
359 Ga0495671_0079396 3300046692 Bacteria 1608
360 Ga0495671_0099941 3300046692 Bacteria 1418
361 Ga0495649_0054601 3300046694 Bacteria 2159
362 Ga0495649_0090405 3300046694 Bacteria 1632
363 Ga0495649_0326525 3300046694 Bacteria 778
364 Ga0495589_0000903 3300046794 Bacteria 18338
365 Ga0495589_0005971 3300046794 Bacteria 6430
366 Ga0495589_0033365 3300046794 Bacteria 2586
367 Ga0495589_0058759 3300046794 Bacteria 1891
368 Ga0495589_0062633 3300046794 Bacteria 1824
369 Ga0495600_0003838 3300046809 Bacteria 8910
370 Ga0495600_0531646 3300046809 Unclassified 720
371 Ga0495600_0765337 3300046809 Bacteria 577
372 Ga0495660_0000734 3300046810 Bacteria 24893
373 Ga0495660_0048898 3300046810 Bacteria 2311
374 Ga0495660_0270635 3300046810 Bacteria 781
375 Ga0495604_0000506 3300047317 Bacteria 34325
376 Ga0495604_0029840 3300047317 Bacteria 4337
377 Ga0495636_0002048 3300047318 Bacteria 7737
378 Ga0495636_0019766 3300047318 Bacteria 2709
379 Ga0495636_0025367 3300047318 Bacteria 2406
380 Ga0495636_0055980 3300047318 Bacteria 1659
381 Ga0495636_0070508 3300047318 Bacteria 1491
382 Ga0495636_0073743 3300047318 Bacteria 1461
383 Ga0495674_0053146 3300047319 Bacteria 3562
384 Ga0495674_0083858 3300047319 Bacteria 2731
385 Ga0495674_0372909 3300047319 Bacteria 1156
386 Ga0495672_0000865 3300047320 Bacteria 31951
387 Ga0495672_0112561 3300047320 Bacteria 1458
388 Ga0495676_0127282 3300047321 Bacteria 1844
389 Ga0495676_0317222 3300047321 Bacteria 1048
390 Ga0495680_0052414 3300047322 Bacteria 3180
391 Ga0495683_0017061 3300047323 Bacteria 3767
392 Ga0495683_0038604 3300047323 Bacteria 2417
393 Ga0495683_0043793 3300047323 Bacteria 2252
394 Ga0495683_0055478 3300047323 Bacteria 1972
395 Ga0495683_0102790 3300047323 Bacteria 1372
396 Ga0495683_0211567 3300047323 Bacteria 869
397 Ga0495683_0231405 3300047323 Bacteria 819
398 Ga0495683_0407382 3300047323 Bacteria 564
399 Ga0495687_000288 3300047443 Bacteria 66346
400 Ga0495687_000866 3300047443 Bacteria 32045
401 Ga0495687_005011 3300047443 Bacteria 8642
402 Ga0495675_0093745 3300047444 Bacteria 1883
403 Ga0495675_0260376 3300047444 Bacteria 1039
404 Ga0495677_0000143 3300047445 Bacteria 34260
405 Ga0495677_0014080 3300047445 Bacteria 2913
406 Ga0495677_0015939 3300047445 Bacteria 2728
407 Ga0495677_0017412 3300047445 Bacteria 2605
408 Ga0495677_0034264 3300047445 Bacteria 1852
409 Ga0495677_0227433 3300047445 Bacteria 727
410 Ga0495679_000012 3300047446 Bacteria 319098
411 Ga0495685_005168 3300047447 Bacteria 4252
412 Ga0495685_147037 3300047447 Bacteria 766
413 Ga0495673_0005688 3300047469 Bacteria 7492
414 Ga0495673_0047988 3300047469 Bacteria 1884
415 Ga0495681_0008471 3300047470 Bacteria 6449
416 Ga0495681_0025651 3300047470 Bacteria 3080
417 Ga0495681_0072980 3300047470 Bacteria 1550
418 Ga0495681_0161495 3300047470 Bacteria 933
419 Ga0495686_0023321 3300047472 Bacteria 4083
420 Ga0495593_0066505 3300047673 Bacteria 1878
421 Ga0495602_0004974 3300048088 Bacteria 13929
422 Ga0495602_0070594 3300048088 Bacteria 2988
423 Ga0495602_0073487 3300048088 Bacteria 2911
424 Ga0495602_0429400 3300048088 Bacteria 936
425 Ga0495602_0497661 3300048088 Bacteria 852
426 Ga0495614_0078881 3300048089 Bacteria 1425
427 Ga0495615_0002497 3300048090 Bacteria 2957
428 Ga0495615_0025086 3300048090 Bacteria 1381
429 Ga0495626_0000292 3300048091 Bacteria 53923
430 Ga0495626_0001135 3300048091 Bacteria 22262
431 Ga0495626_0006150 3300048091 Bacteria 6875
432 Ga0495626_0010284 3300048091 Bacteria 5007
433 Ga0495626_0012583 3300048091 Bacteria 4427
434 Ga0495626_0050303 3300048091 Bacteria 1925
435 Ga0495626_0108160 3300048091 Bacteria 1206
436 Ga0496100_0127994 3300048903 Bacteria 1785
437 Ga0496101_1027355 3300048904 Bacteria 648
438 Ga0496102_0000544 3300048905 Bacteria 40620
439 Ga0496102_0033091 3300048905 Bacteria 4645
440 Ga0496102_0098291 3300048905 Bacteria 2716
441 Ga0496103_0003867 3300048906 Bacteria 9114
442 Ga0496103_0104571 3300048906 Bacteria 1795
443 Ga0496103_0230749 3300048906 Bacteria 1191
444 Ga0496103_0500256 3300048906 Bacteria 778
445 Ga0496104_0671635 3300048907 Bacteria 944
446 Ga0496104_0966225 3300048907 Bacteria 756
447 Ga0496105_0103795 3300048908 Bacteria 2348
448 Ga0496106_0434079 3300048909 Bacteria 1055
449 Ga0496108_1319747 3300048911 Bacteria 606
450 Ga0496109_1294841 3300048912 Bacteria 665
451 Ga0496117_0000020 3300048920 Bacteria 458405
452 Ga0496117_0011765 3300048920 Bacteria 7800
453 Ga0496117_0208307 3300048920 Bacteria 1098
454 Ga0496118_0000015 3300048921 Bacteria 551359
455 Ga0496118_0013271 3300048921 Bacteria 7809
456 Ga0496118_0022515 3300048921 Bacteria 5504
457 Ga0496121_0471665 3300048924 Bacteria 804
458 Ga0496122_0040393 3300048925 Bacteria 3708
459 Ga0496122_0213582 3300048925 Bacteria 1114
460 Ga0496123_0012823 3300048926 Bacteria 7102
461 Ga0496123_0034056 3300048926 Bacteria 3655
462 Ga0496124_0266113 3300048927 Bacteria 1258
463 Ga0496125_0359344 3300048928 Bacteria 866
464 Ga0496126_0023421 3300048929 Bacteria 5985
465 Ga0496126_0047653 3300048929 Bacteria 3923
466 Ga0496126_1110577 3300048929 Bacteria 587
467 Ga0495678_027223 3300049459 Bacteria 2428
468 Ga0495682_0028211 3300049460 Bacteria 2081
469 Ga0495682_0029723 3300049460 Bacteria 2024
470 Ga0501036_0086461 3300049572 Bacteria 2650
471 Ga0501036_0706883 3300049572 Bacteria 833
472 Ga0501039_0920868 3300049575 Unclassified 680
473 Ga0501040_0294898 3300049576 Archaea 1159
474 Ga0501075_0883378 3300049591 Unclassified 680
475 Ga0501226_043196 3300049853 Bacteria 518
476 nmdc:mga00v17_129537_c1 3300050491 Bacteria 1611
477 nmdc:mga0k408_278314_c1 3300050493 Bacteria 999
478 Ga0495601_0030533 3300053077 Bacteria 3346
479 Ga0495612_0600603 3300053078 Unclassified 508
480 Ga0500595_001123 3300053119 Bacteria 14822
481 Ga0500559_0505415 3300053136 Unclassified 555
482 Ga0500574_000576 3300053141 Bacteria 4731
483 Ga0500619_000426 3300053154 Bacteria 7632
484 Ga0587066_194466 3300059490 Bacteria 530
485 Ga0587090_079620 3300059510 Bacteria 654
486 Ga0587090_113954 3300059510 Bacteria 580
487 Ga0587091_020697 3300059511 Bacteria 1145
488 Ga0587106_025083 3300059605 Bacteria 916
489 Ga0587072_105306 3300059643 Bacteria 638
490 Ga0587079_172985 3300059647 Bacteria 573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10386276 Ga0075366_103862762 112
2 3300041408 Ga0439453_0155591 Ga0439453_0155591_12_350 112
3 3300050493 nmdc:mga0k408_278314_c1 nmdc:mga0k408_278314_c1_406_744 112
4 3300009098 Ga0105245_10198451 Ga0105245_101984516 113
5 3300009094 Ga0111539_10596812 Ga0111539_105968121 114
6 3300046524 Ga0495648_0012270 Ga0495648_0012270_4652_4999 114
7 3300049572 Ga0501036_0706883 Ga0501036_0706883_140_484 114
8 3300049575 Ga0501039_0920868 Ga0501039_0920868_302_646 114
9 3300049576 Ga0501040_0294898 Ga0501040_0294898_281_625 114
10 3300049591 Ga0501075_0883378 Ga0501075_0883378_93_437 114
11 3300005458 Ga0070681_10125076 Ga0070681_101250762 115
12 3300013104 Ga0157370_10958895 Ga0157370_109588952 115
13 3300025912 Ga0207707_10013939 Ga0207707_100139398 115
14 3300025940 Ga0207691_10573950 Ga0207691_105739502 115
15 3300035083 Ga0373926_0259165 Ga0373926_0259165_193_540 115
16 3300037068 Ga0373925_1103872 Ga0373925_1103872_253_600 115
17 3300039062 Ga0400483_200851 Ga0400483_200851_785_1132 115
18 3300042139 Ga0450904_000393 Ga0450904_000393_1241_1627 115
19 3300049572 Ga0501036_0086461 Ga0501036_0086461_2036_2386 116
20 iso_pu_bacteria 2643221556 2643800522 116
21 iso_pu_bacteria 2643221684 2644470431 116
22 3300005289 Ga0065704_10152495 Ga0065704_101524952 117
23 3300005548 Ga0070665_100002338 Ga0070665_1000023389 117
24 3300015679 Ga0183366_1001 Ga0183366_10011663 117
25 3300015680 Ga0183370_1001 Ga0183370_10011663 117
26 3300015685 Ga0183369_1001 Ga0183369_10011663 117
27 3300015687 Ga0183368_1001 Ga0183368_10011663 117
28 3300028379 Ga0268266_10004389 Ga0268266_100043898 117
29 3300046453 Ga0495627_007535 Ga0495627_007535_1544_1897 117
30 3300046460 Ga0495638_0012658 Ga0495638_0012658_2696_3061 117
31 3300046474 Ga0495605_0198026 Ga0495605_0198026_15_380 117
32 3300046491 Ga0495584_0010342 Ga0495584_0010342_3250_3603 117
33 3300046491 Ga0495584_0023296 Ga0495584_0023296_63_428 117
34 3300046492 Ga0495585_0012001 Ga0495585_0012001_1939_2292 117
35 3300046492 Ga0495585_0026238 Ga0495585_0026238_2495_2860 117
36 3300046500 Ga0495596_0008865 Ga0495596_0008865_914_1282 117
37 3300046501 Ga0495607_0014708 Ga0495607_0014708_1765_2130 117
38 3300046501 Ga0495607_0025736 Ga0495607_0025736_2544_2912 117
39 3300046506 Ga0495583_0027919 Ga0495583_0027919_2326_2679 117
40 3300046506 Ga0495583_0066423 Ga0495583_0066423_784_1149 117
41 3300046512 Ga0495610_0202429 Ga0495610_0202429_371_736 117
42 3300046518 Ga0495631_0005941 Ga0495631_0005941_4843_5196 117
43 3300046519 Ga0495632_0070038 Ga0495632_0070038_748_1113 117
44 3300046522 Ga0495643_0025510 Ga0495643_0025510_1774_2139 117
45 3300046523 Ga0495644_0028755 Ga0495644_0028755_518_883 117
46 3300046523 Ga0495644_0058902 Ga0495644_0058902_1011_1364 117
47 3300046525 Ga0495663_0006532 Ga0495663_0006532_2109_2462 117
48 3300046525 Ga0495663_0198995 Ga0495663_0198995_188_544 117
49 3300046526 Ga0495666_0061503 Ga0495666_0061503_1347_1700 117
50 3300046528 Ga0495642_0008794 Ga0495642_0008794_875_1240 117
51 3300046528 Ga0495642_0131488 Ga0495642_0131488_377_730 117
52 3300046558 Ga0495633_0009578 Ga0495633_0009578_1019_1387 117
53 3300046558 Ga0495633_0014279 Ga0495633_0014279_1302_1655 117
54 3300046615 Ga0495656_0001130 Ga0495656_0001130_2908_3261 117
55 3300046616 Ga0495668_0004042 Ga0495668_0004042_8992_9345 117
56 3300046616 Ga0495668_0634090 Ga0495668_0634090_12_377 117
57 3300046648 Ga0495611_0010111 Ga0495611_0010111_950_1315 117
58 3300046648 Ga0495611_0012917 Ga0495611_0012917_3073_3441 117
59 3300046648 Ga0495611_0243850 Ga0495611_0243850_110_463 117
60 3300046660 Ga0495625_0024656 Ga0495625_0024656_2964_3329 117
61 3300046664 Ga0495659_0038115 Ga0495659_0038115_755_1120 117
62 3300046665 Ga0495661_0028764 Ga0495661_0028764_890_1243 117
63 3300046665 Ga0495661_0209902 Ga0495661_0209902_454_819 117
64 3300046674 Ga0495588_0321700 Ga0495588_0321700_107_460 117
65 3300046679 Ga0495623_0062397 Ga0495623_0062397_512_874 117
66 3300046691 Ga0495670_0006178 Ga0495670_0006178_4181_4534 117
67 3300046691 Ga0495670_0022667 Ga0495670_0022667_2380_2748 117
68 3300046794 Ga0495589_0062633 Ga0495589_0062633_273_638 117
69 3300047318 Ga0495636_0025367 Ga0495636_0025367_1463_1819 117
70 3300047318 Ga0495636_0073743 Ga0495636_0073743_588_944 117
71 3300047323 Ga0495683_0038604 Ga0495683_0038604_862_1227 117
72 3300047443 Ga0495687_005011 Ga0495687_005011_7163_7519 117
73 3300047445 Ga0495677_0014080 Ga0495677_0014080_1057_1410 117
74 3300047445 Ga0495677_0017412 Ga0495677_0017412_813_1178 117
75 3300047445 Ga0495677_0227433 Ga0495677_0227433_298_666 117
76 3300047447 Ga0495685_005168 Ga0495685_005168_2554_2919 117
77 3300047470 Ga0495681_0008471 Ga0495681_0008471_3458_3811 117
78 3300047470 Ga0495681_0072980 Ga0495681_0072980_1173_1538 117
79 3300048091 Ga0495626_0012583 Ga0495626_0012583_3932_4285 117
80 3300048091 Ga0495626_0050303 Ga0495626_0050303_202_567 117
81 3300048091 Ga0495626_0108160 Ga0495626_0108160_711_1064 117
82 3300048905 Ga0496102_0000544 Ga0496102_0000544_1798_2154 117
83 3300048906 Ga0496103_0003867 Ga0496103_0003867_848_1204 117
84 3300048920 Ga0496117_0000020 Ga0496117_0000020_326875_327228 117
85 3300048920 Ga0496117_0011765 Ga0496117_0011765_1879_2232 117
86 3300048921 Ga0496118_0000015 Ga0496118_0000015_342084_342437 117
87 3300048921 Ga0496118_0013271 Ga0496118_0013271_5590_5943 117
88 3300048929 Ga0496126_0023421 Ga0496126_0023421_1495_1848 117
89 3300048929 Ga0496126_0047653 Ga0496126_0047653_1654_2007 117
90 3300048929 Ga0496126_1110577 Ga0496126_1110577_41_394 117
91 3300049460 Ga0495682_0028211 Ga0495682_0028211_58_423 117
92 3300050491 nmdc:mga00v17_129537_c1 nmdc:mga00v17_129537_c1_59_412 117
93 iso_pu_bacteria 8047673197 8047678827 117
94 3300005331 Ga0070670_100001679 Ga0070670_1000016793 118
95 3300025925 Ga0207650_10009507 Ga0207650_100095072 118
96 3300030745 Ga0316182_1007574 Ga0316182_10075742 118
97 3300046506 Ga0495583_0000222 Ga0495583_0000222_65428_65784 118
98 3300046506 Ga0495583_0125539 Ga0495583_0125539_83_442 118
99 3300046522 Ga0495643_0412725 Ga0495643_0412725_146_505 118
100 3300046525 Ga0495663_0028693 Ga0495663_0028693_230_589 118
101 3300046615 Ga0495656_0089141 Ga0495656_0089141_506_865 118
102 3300046664 Ga0495659_0036121 Ga0495659_0036121_1319_1678 118
103 3300046665 Ga0495661_0232083 Ga0495661_0232083_488_853 118
104 3300047445 Ga0495677_0034264 Ga0495677_0034264_371_730 118
105 3300048090 Ga0495615_0002497 Ga0495615_0002497_1745_2104 118
106 3300048925 Ga0496122_0040393 Ga0496122_0040393_980_1336 118
107 3300048926 Ga0496123_0012823 Ga0496123_0012823_5667_6023 118
108 3300005293 Ga0065715_10191815 Ga0065715_101918152 119
109 3300030731 Ga0316177_1169245 Ga0316177_11692452 119
110 3300030736 Ga0316180_1009533 Ga0316180_10095331 119
111 3300030742 Ga0316183_1074355 Ga0316183_10743552 119
112 3300030745 Ga0316182_1164309 Ga0316182_11643092 119
113 3300039447 Ga0436361_0862518 Ga0436361_0862518_1503_1862 119
114 3300042436 Ga0439435_0096237 Ga0439435_0096237_134_496 119
115 3300046506 Ga0495583_0060754 Ga0495583_0060754_168_530 119
116 3300046542 Ga0495597_0011740 Ga0495597_0011740_2197_2568 119
117 3300047318 Ga0495636_0019766 Ga0495636_0019766_2272_2634 119
118 3300047447 Ga0495685_147037 Ga0495685_147037_171_533 119
119 3300048905 Ga0496102_0033091 Ga0496102_0033091_3090_3458 119
120 3300048906 Ga0496103_0500256 Ga0496103_0500256_183_545 119
121 iso_pu_bacteria 2808606418 2809144034 119
122 iso_pu_bacteria 2818991436 2819543623 119
123 iso_pu_bacteria 2900634093 2900638967 119
124 iso_pu_bacteria 642555113 642618192 119
125 3300003316 rootH1_10064325 rootH1_100643252 120
126 3300003322 rootL2_10019994 rootL2_100199942 120
127 3300003322 rootL2_10207789 rootL2_102077891 120
128 3300005262 Ga0065165_1025259 Ga0065165_10252592 120
129 3300005327 Ga0070658_10147010 Ga0070658_101470102 120
130 3300005327 Ga0070658_10302699 Ga0070658_103026992 120
131 3300005329 Ga0070683_100417412 Ga0070683_1004174121 120
132 3300005339 Ga0070660_100064765 Ga0070660_1000647652 120
133 3300005339 Ga0070660_100161014 Ga0070660_1001610143 120
134 3300005366 Ga0070659_100021372 Ga0070659_1000213724 120
135 3300005366 Ga0070659_100568809 Ga0070659_1005688093 120
136 3300005457 Ga0070662_100306060 Ga0070662_1003060602 120
137 3300005459 Ga0068867_101079674 Ga0068867_1010796742 120
138 3300005543 Ga0070672_100493732 Ga0070672_1004937322 120
139 3300005564 Ga0070664_100062278 Ga0070664_1000622782 120
140 3300005564 Ga0070664_100589376 Ga0070664_1005893762 120
141 3300005578 Ga0068854_101065089 Ga0068854_1010650892 120
142 3300005616 Ga0068852_100276130 Ga0068852_1002761303 120
143 3300006237 Ga0097621_100428147 Ga0097621_1004281472 120
144 3300006881 Ga0068865_100112929 Ga0068865_1001129293 120
145 3300009036 Ga0105244_10239869 Ga0105244_102398692 120
146 3300009098 Ga0105245_10494651 Ga0105245_104946512 120
147 3300009148 Ga0105243_10035911 Ga0105243_100359114 120
148 3300009176 Ga0105242_10112144 Ga0105242_101121443 120
149 3300009176 Ga0105242_10713201 Ga0105242_107132012 120
150 3300009545 Ga0105237_10155715 Ga0105237_101557152 120
151 3300009551 Ga0105238_10206328 Ga0105238_102063282 120
152 3300013100 Ga0157373_10128552 Ga0157373_101285523 120
153 3300013296 Ga0157374_10863390 Ga0157374_108633902 120
154 3300013307 Ga0157372_10235715 Ga0157372_102357153 120
155 3300015262 Ga0182007_10181171 Ga0182007_101811712 120
156 3300025909 Ga0207705_10035870 Ga0207705_100358704 120
157 3300025914 Ga0207671_10946258 Ga0207671_109462582 120
158 3300025919 Ga0207657_10129140 Ga0207657_101291402 120
159 3300025920 Ga0207649_11545004 Ga0207649_115450041 120
160 3300025924 Ga0207694_10195736 Ga0207694_101957362 120
161 3300025927 Ga0207687_10834639 Ga0207687_108346391 120
162 3300025932 Ga0207690_11241308 Ga0207690_112413081 120
163 3300025934 Ga0207686_10078241 Ga0207686_100782412 120
164 3300025937 Ga0207669_10479928 Ga0207669_104799282 120
165 3300025938 Ga0207704_10747411 Ga0207704_107474112 120
166 3300025940 Ga0207691_10626305 Ga0207691_106263052 120
167 3300025944 Ga0207661_11857612 Ga0207661_118576122 120
168 3300025945 Ga0207679_10563543 Ga0207679_105635432 120
169 3300025945 Ga0207679_10685012 Ga0207679_106850122 120
170 3300025949 Ga0207667_10024708 Ga0207667_100247082 120
171 3300025981 Ga0207640_10281115 Ga0207640_102811152 120
172 3300026078 Ga0207702_10763433 Ga0207702_107634332 120
173 3300026089 Ga0207648_11685177 Ga0207648_116851771 120
174 3300026116 Ga0207674_10138308 Ga0207674_101383084 120
175 3300037312 Ga0395899_0060743 Ga0395899_0060743_2070_2432 120
176 3300037312 Ga0395899_0067433 Ga0395899_0067433_1175_1537 120
177 3300037312 Ga0395899_0079470 Ga0395899_0079470_123_485 120
178 3300037312 Ga0395899_0840200 Ga0395899_0840200_80_442 120
179 3300037418 Ga0395900_0004368 Ga0395900_0004368_13207_13569 120
180 3300037418 Ga0395900_0365942 Ga0395900_0365942_527_889 120
181 3300037418 Ga0395900_1228462 Ga0395900_1228462_95_457 120
182 3300037466 Ga0395898_0013866 Ga0395898_0013866_6877_7239 120
183 3300037471 Ga0395905_0091303 Ga0395905_0091303_1812_2174 120
184 3300037471 Ga0395905_0146265 Ga0395905_0146265_561_923 120
185 3300037471 Ga0395905_0356413 Ga0395905_0356413_491_853 120
186 3300037471 Ga0395905_0954643 Ga0395905_0954643_304_666 120
187 3300038443 Ga0395901_0002559 Ga0395901_0002559_1051_1413 120
188 3300038443 Ga0395901_1065887 Ga0395901_1065887_152_514 120
189 3300038443 Ga0395901_1953738 Ga0395901_1953738_143_505 120
190 3300042005 Ga0439448_0003199 Ga0439448_0003199_2690_3052 120
191 3300042005 Ga0439448_0008221 Ga0439448_0008221_322_684 120
192 3300042007 Ga0439449_0179474 Ga0439449_0179474_11_373 120
193 3300042012 Ga0439455_0077113 Ga0439455_0077113_255_617 120
194 3300042157 Ga0439458_0008630 Ga0439458_0008630_1252_1614 120
195 3300042532 Ga0450893_0129709 Ga0450893_0129709_56_418 120
196 3300044656 Ga0466969_0285914 Ga0466969_0285914_343_705 120
197 3300044658 Ga0466972_0013270 Ga0466972_0013270_1248_1622 120
198 3300044683 Ga0466965_0029894 Ga0466965_0029894_1908_2270 120
199 3300044684 Ga0466966_0047538 Ga0466966_0047538_414_776 120
200 3300044684 Ga0466966_0217953 Ga0466966_0217953_242_604 120
201 3300044693 Ga0466961_0052934 Ga0466961_0052934_1940_2302 120
202 3300044694 Ga0466963_1247735 Ga0466963_1247735_19_381 120
203 3300044765 Ga0466970_0099844 Ga0466970_0099844_842_1204 120
204 3300044842 Ga0466957_0001772 Ga0466957_0001772_1280_1642 120
205 3300044842 Ga0466957_0030187 Ga0466957_0030187_2285_2647 120
206 3300044842 Ga0466957_0133277 Ga0466957_0133277_218_580 120
207 3300044901 Ga0466960_0057503 Ga0466960_0057503_1268_1630 120
208 3300045049 Ga0466959_0059528 Ga0466959_0059528_824_1186 120
209 3300045836 Ga0466958_0106481 Ga0466958_0106481_233_595 120
210 3300045836 Ga0466958_0324002 Ga0466958_0324002_451_813 120
211 3300045976 Ga0466967_0013652 Ga0466967_0013652_1914_2276 120
212 3300045976 Ga0466967_0583381 Ga0466967_0583381_626_988 120
213 3300045976 Ga0466967_0630782 Ga0466967_0630782_77_439 120
214 3300046457 Ga0495590_0030542 Ga0495590_0030542_1248_1610 120
215 3300046474 Ga0495605_0000725 Ga0495605_0000725_1379_1741 120
216 3300046474 Ga0495605_0003042 Ga0495605_0003042_410_772 120
217 3300046491 Ga0495584_0016426 Ga0495584_0016426_2288_2650 120
218 3300046501 Ga0495607_0002063 Ga0495607_0002063_2504_2866 120
219 3300046501 Ga0495607_0027351 Ga0495607_0027351_1287_1649 120
220 3300046507 Ga0495606_0486685 Ga0495606_0486685_202_564 120
221 3300046513 Ga0495616_0000786 Ga0495616_0000786_1350_1712 120
222 3300046513 Ga0495616_0015523 Ga0495616_0015523_247_612 120
223 3300046518 Ga0495631_0159979 Ga0495631_0159979_236_598 120
224 3300046522 Ga0495643_0002952 Ga0495643_0002952_11134_11496 120
225 3300046538 Ga0495609_0000028 Ga0495609_0000028_163941_164303 120
226 3300046542 Ga0495597_0213539 Ga0495597_0213539_155_517 120
227 3300046665 Ga0495661_0000682 Ga0495661_0000682_30859_31221 120
228 3300046665 Ga0495661_0092044 Ga0495661_0092044_535_900 120
229 3300046665 Ga0495661_0135339 Ga0495661_0135339_71_433 120
230 3300046694 Ga0495649_0090405 Ga0495649_0090405_145_507 120
231 3300046694 Ga0495649_0326525 Ga0495649_0326525_108_470 120
232 3300046794 Ga0495589_0000903 Ga0495589_0000903_3301_3663 120
233 3300046794 Ga0495589_0005971 Ga0495589_0005971_2636_2998 120
234 3300046810 Ga0495660_0000734 Ga0495660_0000734_3399_3761 120
235 3300047320 Ga0495672_0000865 Ga0495672_0000865_30607_30969 120
236 3300047323 Ga0495683_0017061 Ga0495683_0017061_674_1036 120
237 3300047443 Ga0495687_000288 Ga0495687_000288_63174_63536 120
238 3300047443 Ga0495687_000866 Ga0495687_000866_30613_30975 120
239 3300047445 Ga0495677_0000143 Ga0495677_0000143_30856_31218 120
240 3300047445 Ga0495677_0015939 Ga0495677_0015939_1254_1616 120
241 3300048091 Ga0495626_0000292 Ga0495626_0000292_41327_41689 120
242 3300048091 Ga0495626_0001135 Ga0495626_0001135_20654_21016 120
243 3300048903 Ga0496100_0127994 Ga0496100_0127994_988_1350 120
244 3300048904 Ga0496101_1027355 Ga0496101_1027355_204_566 120
245 3300048905 Ga0496102_0098291 Ga0496102_0098291_2297_2659 120
246 3300048906 Ga0496103_0230749 Ga0496103_0230749_195_557 120
247 3300048907 Ga0496104_0671635 Ga0496104_0671635_474_836 120
248 3300048908 Ga0496105_0103795 Ga0496105_0103795_400_762 120
249 3300048909 Ga0496106_0434079 Ga0496106_0434079_416_778 120
250 3300048911 Ga0496108_1319747 Ga0496108_1319747_206_568 120
251 3300048912 Ga0496109_1294841 Ga0496109_1294841_151_513 120
252 3300048924 Ga0496121_0471665 Ga0496121_0471665_74_439 120
253 3300048927 Ga0496124_0266113 Ga0496124_0266113_376_738 120
254 3300049853 Ga0501226_043196 Ga0501226_043196_146_508 120
255 3300059510 Ga0587090_113954 Ga0587090_113954_124_486 120
256 3300059511 Ga0587091_020697 Ga0587091_020697_661_1023 120
257 3300003759 Ga0055525_1000081 Ga0055525_1000081111 121
258 3300005327 Ga0070658_10224488 Ga0070658_102244882 121
259 3300005336 Ga0070680_100107996 Ga0070680_1001079963 121
260 3300005355 Ga0070671_101372271 Ga0070671_1013722711 121
261 3300005438 Ga0070701_11091575 Ga0070701_110915751 121
262 3300005457 Ga0070662_100876736 Ga0070662_1008767362 121
263 3300009177 Ga0105248_11306142 Ga0105248_113061421 121
264 3300010375 Ga0105239_10671124 Ga0105239_106711242 121
265 3300010375 Ga0105239_12838752 Ga0105239_128387521 121
266 3300013100 Ga0157373_11050708 Ga0157373_110507082 121
267 3300013104 Ga0157370_10030749 Ga0157370_100307492 121
268 3300013306 Ga0163162_11497342 Ga0163162_114973421 121
269 3300014325 Ga0163163_10071146 Ga0163163_100711462 121
270 3300015261 Ga0182006_1013493 Ga0182006_10134932 121
271 3300015262 Ga0182007_10003306 Ga0182007_1000330610 121
272 3300025230 Ga0209563_100015 Ga0209563_100015677 121
273 3300025253 Ga0209677_105323 Ga0209677_1053234 121
274 3300025904 Ga0207647_10371485 Ga0207647_103714852 121
275 3300025909 Ga0207705_10593497 Ga0207705_105934972 121
276 3300025917 Ga0207660_10028089 Ga0207660_100280893 121
277 3300025924 Ga0207694_10012523 Ga0207694_100125232 121
278 3300025933 Ga0207706_10804347 Ga0207706_108043472 121
279 3300025986 Ga0207658_10038190 Ga0207658_100381902 121
280 3300025986 Ga0207658_10213553 Ga0207658_102135532 121
281 3300037312 Ga0395899_0000207 Ga0395899_0000207_35103_35477 121
282 3300037312 Ga0395899_0018315 Ga0395899_0018315_1188_1553 121
283 3300037312 Ga0395899_0036161 Ga0395899_0036161_2052_2417 121
284 3300037312 Ga0395899_0352895 Ga0395899_0352895_150_515 121
285 3300037418 Ga0395900_0001085 Ga0395900_0001085_1757_2122 121
286 3300037466 Ga0395898_0041653 Ga0395898_0041653_3779_4144 121
287 3300037466 Ga0395898_0264498 Ga0395898_0264498_951_1316 121
288 3300037466 Ga0395898_0566339 Ga0395898_0566339_405_770 121
289 3300037471 Ga0395905_0423956 Ga0395905_0423956_358_723 121
290 3300038443 Ga0395901_0070358 Ga0395901_0070358_654_1019 121
291 3300038443 Ga0395901_0188979 Ga0395901_0188979_1472_1837 121
292 3300046455 Ga0495603_0103657 Ga0495603_0103657_591_974 121
293 3300046491 Ga0495584_0028181 Ga0495584_0028181_1397_1780 121
294 3300046492 Ga0495585_0122601 Ga0495585_0122601_744_1115 121
295 3300046492 Ga0495585_0316797 Ga0495585_0316797_201_584 121
296 3300046499 Ga0495594_0055675 Ga0495594_0055675_737_1108 121
297 3300046507 Ga0495606_0161448 Ga0495606_0161448_65_445 121
298 3300046507 Ga0495606_0421492 Ga0495606_0421492_159_542 121
299 3300046518 Ga0495631_0010417 Ga0495631_0010417_3461_3859 121
300 3300046528 Ga0495642_0000515 Ga0495642_0000515_1121_1486 121
301 3300046528 Ga0495642_0004529 Ga0495642_0004529_3811_4203 121
302 3300046542 Ga0495597_0202510 Ga0495597_0202510_78_476 121
303 3300046557 Ga0495622_0023818 Ga0495622_0023818_919_1302 121
304 3300046615 Ga0495656_0059289 Ga0495656_0059289_1147_1545 121
305 3300046616 Ga0495668_0017959 Ga0495668_0017959_123_521 121
306 3300046648 Ga0495611_0022679 Ga0495611_0022679_1177_1560 121
307 3300046665 Ga0495661_0013786 Ga0495661_0013786_2440_2838 121
308 3300046684 Ga0495669_0085332 Ga0495669_0085332_1023_1421 121
309 3300046691 Ga0495670_0333983 Ga0495670_0333983_195_578 121
310 3300046692 Ga0495671_0040871 Ga0495671_0040871_11_409 121
311 3300046692 Ga0495671_0079396 Ga0495671_0079396_1017_1415 121
312 3300046794 Ga0495589_0033365 Ga0495589_0033365_252_635 121
313 3300046810 Ga0495660_0048898 Ga0495660_0048898_62_430 121
314 3300047318 Ga0495636_0002048 Ga0495636_0002048_68_451 121
315 3300047318 Ga0495636_0055980 Ga0495636_0055980_1234_1617 121
316 3300047321 Ga0495676_0127282 Ga0495676_0127282_383_766 121
317 3300047323 Ga0495683_0211567 Ga0495683_0211567_104_502 121
318 3300047323 Ga0495683_0407382 Ga0495683_0407382_71_442 121
319 3300047470 Ga0495681_0161495 Ga0495681_0161495_312_680 121
320 3300048090 Ga0495615_0025086 Ga0495615_0025086_694_1089 121
321 3300048906 Ga0496103_0104571 Ga0496103_0104571_417_782 121
322 3300048907 Ga0496104_0966225 Ga0496104_0966225_289_669 121
323 3300048925 Ga0496122_0213582 Ga0496122_0213582_214_579 121
324 3300048926 Ga0496123_0034056 Ga0496123_0034056_3010_3375 121
325 3300048928 Ga0496125_0359344 Ga0496125_0359344_155_520 121
326 3300053136 Ga0500559_0505415 Ga0500559_0505415_53_418 121
327 3300059490 Ga0587066_194466 Ga0587066_194466_80_460 121
328 3300059510 Ga0587090_079620 Ga0587090_079620_60_425 121
329 3300059605 Ga0587106_025083 Ga0587106_025083_11_376 121
330 3300059643 Ga0587072_105306 Ga0587072_105306_159_524 121
331 3300059647 Ga0587079_172985 Ga0587079_172985_50_415 121
332 3300037312 Ga0395899_0289995 Ga0395899_0289995_64_462 122
333 3300037418 Ga0395900_0086594 Ga0395900_0086594_2175_2555 122
334 3300037466 Ga0395898_0109689 Ga0395898_0109689_1813_2211 122
335 3300037466 Ga0395898_0199604 Ga0395898_0199604_1286_1666 122
336 3300038443 Ga0395901_0065527 Ga0395901_0065527_3221_3619 122
337 3300038443 Ga0395901_0165731 Ga0395901_0165731_711_1091 122
338 3300038443 Ga0395901_0855446 Ga0395901_0855446_259_639 122
339 3300046452 Ga0495617_102141 Ga0495617_102141_434_808 122
340 3300046474 Ga0495605_0025373 Ga0495605_0025373_1732_2106 122
341 3300046491 Ga0495584_0020931 Ga0495584_0020931_358_732 122
342 3300046491 Ga0495584_0024396 Ga0495584_0024396_2365_2739 122
343 3300046492 Ga0495585_0045372 Ga0495585_0045372_537_911 122
344 3300046492 Ga0495585_0156421 Ga0495585_0156421_546_971 122
345 3300046492 Ga0495585_0224200 Ga0495585_0224200_209_580 122
346 3300046500 Ga0495596_0008067 Ga0495596_0008067_2651_3025 122
347 3300046506 Ga0495583_0000416 Ga0495583_0000416_7184_7558 122
348 3300046518 Ga0495631_0004022 Ga0495631_0004022_5685_6059 122
349 3300046522 Ga0495643_0013272 Ga0495643_0013272_1976_2350 122
350 3300046523 Ga0495644_0026955 Ga0495644_0026955_1700_2074 122
351 3300046557 Ga0495622_0023304 Ga0495622_0023304_39_413 122
352 3300046616 Ga0495668_0261612 Ga0495668_0261612_125_499 122
353 3300046648 Ga0495611_0002946 Ga0495611_0002946_3298_3672 122
354 3300047318 Ga0495636_0070508 Ga0495636_0070508_744_1118 122
355 3300047320 Ga0495672_0112561 Ga0495672_0112561_855_1229 122
356 3300047323 Ga0495683_0102790 Ga0495683_0102790_95_520 122
357 3300047323 Ga0495683_0231405 Ga0495683_0231405_210_584 122
358 3300047469 Ga0495673_0005688 Ga0495673_0005688_3865_4239 122
359 3300047470 Ga0495681_0025651 Ga0495681_0025651_654_1052 122
360 3300048091 Ga0495626_0006150 Ga0495626_0006150_3820_4194 122
361 3300002705 JGI25156J39149_1000172 JGI25156J39149_100017241 123
362 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001107 123
363 3300002771 JGI25163J39215_1004836 JGI25163J39215_10048362 123
364 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001103 123
365 3300003751 Ga0055538_1000001 Ga0055538_1000001930 123
366 3300003752 Ga0055539_1000001 Ga0055539_1000001930 123
367 3300003756 Ga0055533_1000003 Ga0055533_1000003103 123
368 3300003759 Ga0055525_1000003 Ga0055525_1000003103 123
369 3300003841 Ga0055541_1000001 Ga0055541_1000001103 123
370 3300013306 Ga0163162_10006946 Ga0163162_100069467 123
371 3300014497 Ga0182008_10178202 Ga0182008_101782022 123
372 3300015262 Ga0182007_10000603 Ga0182007_1000060315 123
373 3300015262 Ga0182007_10002074 Ga0182007_100020744 123
374 3300015265 Ga0182005_1000162 Ga0182005_10001622 123
375 3300021361 Ga0213872_10000494 Ga0213872_1000049419 123
376 3300021384 Ga0213876_10181779 Ga0213876_101817792 123
377 3300025224 Ga0209784_100004 Ga0209784_100004104 123
378 3300025225 Ga0209566_100004 Ga0209566_100004261 123
379 3300025226 Ga0209674_100006 Ga0209674_100006261 123
380 3300025230 Ga0209563_100009 Ga0209563_100009104 123
381 3300025231 Ga0207427_100300 Ga0207427_10030025 123
382 3300025233 Ga0209437_100004 Ga0209437_100004104 123
383 3300025253 Ga0209677_100005 Ga0209677_100005104 123
384 3300025256 Ga0209759_1000044 Ga0209759_100004467 123
385 3300025261 Ga0209233_1000005 Ga0209233_1000005261 123
386 3300025261 Ga0209233_1019062 Ga0209233_10190622 123
387 3300039437 Ga0436365_0730722 Ga0436365_0730722_696_1076 123
388 3300039447 Ga0436361_0062839 Ga0436361_0062839_34828_35202 123
389 3300046452 Ga0495617_005348 Ga0495617_005348_1312_1698 123
390 3300046454 Ga0495592_0012109 Ga0495592_0012109_5941_6315 123
391 3300046454 Ga0495592_0258393 Ga0495592_0258393_475_846 123
392 3300046457 Ga0495590_0011799 Ga0495590_0011799_619_1038 123
393 3300046459 Ga0495629_0000143 Ga0495629_0000143_15148_15567 123
394 3300046460 Ga0495638_0114699 Ga0495638_0114699_488_907 123
395 3300046462 Ga0495651_0042791 Ga0495651_0042791_1955_2329 123
396 3300046462 Ga0495651_0045228 Ga0495651_0045228_1476_1895 123
397 3300046462 Ga0495651_0047691 Ga0495651_0047691_1686_2060 123
398 3300046462 Ga0495651_0051362 Ga0495651_0051362_851_1225 123
399 3300046462 Ga0495651_0237076 Ga0495651_0237076_115_501 123
400 3300046463 Ga0495653_0000737 Ga0495653_0000737_9132_9551 123
401 3300046463 Ga0495653_0171042 Ga0495653_0171042_356_730 123
402 3300046463 Ga0495653_0618128 Ga0495653_0618128_12_386 123
403 3300046471 Ga0495650_0001898 Ga0495650_0001898_14802_15221 123
404 3300046471 Ga0495650_0005971 Ga0495650_0005971_2228_2680 123
405 3300046472 Ga0495580_0018442 Ga0495580_0018442_812_1231 123
406 3300046472 Ga0495580_0412393 Ga0495580_0412393_296_715 123
407 3300046473 Ga0495582_0046759 Ga0495582_0046759_866_1285 123
408 3300046474 Ga0495605_0005292 Ga0495605_0005292_4608_5027 123
409 3300046491 Ga0495584_0000044 Ga0495584_0000044_54718_55104 123
410 3300046491 Ga0495584_0099683 Ga0495584_0099683_412_831 123
411 3300046492 Ga0495585_0000373 Ga0495585_0000373_40081_40467 123
412 3300046492 Ga0495585_0023426 Ga0495585_0023426_1228_1611 123
413 3300046500 Ga0495596_0004031 Ga0495596_0004031_2592_3011 123
414 3300046506 Ga0495583_0019083 Ga0495583_0019083_861_1280 123
415 3300046507 Ga0495606_0021344 Ga0495606_0021344_3538_3957 123
416 3300046507 Ga0495606_0068915 Ga0495606_0068915_810_1196 123
417 3300046511 Ga0495608_0014555 Ga0495608_0014555_4106_4480 123
418 3300046511 Ga0495608_0190075 Ga0495608_0190075_170_544 123
419 3300046513 Ga0495616_0007605 Ga0495616_0007605_4644_5030 123
420 3300046514 Ga0495618_0111649 Ga0495618_0111649_54_428 123
421 3300046514 Ga0495618_0401435 Ga0495618_0401435_120_494 123
422 3300046515 Ga0495620_0028381 Ga0495620_0028381_301_720 123
423 3300046516 Ga0495628_0000452 Ga0495628_0000452_19848_20222 123
424 3300046516 Ga0495628_0016341 Ga0495628_0016341_5549_5923 123
425 3300046516 Ga0495628_0023833 Ga0495628_0023833_673_1092 123
426 3300046516 Ga0495628_0073075 Ga0495628_0073075_1520_1906 123
427 3300046516 Ga0495628_0080501 Ga0495628_0080501_736_1107 123
428 3300046517 Ga0495630_0016134 Ga0495630_0016134_4962_5381 123
429 3300046524 Ga0495648_0000460 Ga0495648_0000460_1328_1714 123
430 3300046524 Ga0495648_0047540 Ga0495648_0047540_1101_1520 123
431 3300046526 Ga0495666_0034508 Ga0495666_0034508_1578_1997 123
432 3300046528 Ga0495642_0038027 Ga0495642_0038027_612_1031 123
433 3300046529 Ga0495652_0009820 Ga0495652_0009820_1254_1628 123
434 3300046529 Ga0495652_0051905 Ga0495652_0051905_87_461 123
435 3300046529 Ga0495652_0055538 Ga0495652_0055538_2119_2505 123
436 3300046531 Ga0495665_0066667 Ga0495665_0066667_991_1410 123
437 3300046533 Ga0495640_0343030 Ga0495640_0343030_447_818 123
438 3300046535 Ga0495586_0109905 Ga0495586_0109905_847_1218 123
439 3300046542 Ga0495597_0040478 Ga0495597_0040478_1563_1982 123
440 3300046543 Ga0495645_0057145 Ga0495645_0057145_1632_2006 123
441 3300046543 Ga0495645_0238808 Ga0495645_0238808_85_456 123
442 3300046558 Ga0495633_0010467 Ga0495633_0010467_2699_3082 123
443 3300046558 Ga0495633_0042910 Ga0495633_0042910_492_878 123
444 3300046665 Ga0495661_0065792 Ga0495661_0065792_1115_1534 123
445 3300046665 Ga0495661_0089898 Ga0495661_0089898_1324_1707 123
446 3300046675 Ga0495657_0030667 Ga0495657_0030667_937_1311 123
447 3300046678 Ga0495599_0028483 Ga0495599_0028483_228_602 123
448 3300046679 Ga0495623_0018389 Ga0495623_0018389_2173_2547 123
449 3300046679 Ga0495623_0046002 Ga0495623_0046002_1324_1743 123
450 3300046679 Ga0495623_0145743 Ga0495623_0145743_978_1352 123
451 3300046680 Ga0495646_0000468 Ga0495646_0000468_15188_15574 123
452 3300046680 Ga0495646_0001706 Ga0495646_0001706_6717_7091 123
453 3300046680 Ga0495646_0003033 Ga0495646_0003033_4611_5030 123
454 3300046689 Ga0495613_0364602 Ga0495613_0364602_605_976 123
455 3300046690 Ga0495624_0004685 Ga0495624_0004685_7688_8062 123
456 3300046690 Ga0495624_0026721 Ga0495624_0026721_2661_3080 123
457 3300046690 Ga0495624_0074389 Ga0495624_0074389_990_1409 123
458 3300046690 Ga0495624_0090294 Ga0495624_0090294_973_1359 123
459 3300046691 Ga0495670_0014035 Ga0495670_0014035_1145_1528 123
460 3300046692 Ga0495671_0099941 Ga0495671_0099941_951_1370 123
461 3300046694 Ga0495649_0054601 Ga0495649_0054601_1122_1541 123
462 3300046794 Ga0495589_0058759 Ga0495589_0058759_1473_1862 123
463 3300046809 Ga0495600_0003838 Ga0495600_0003838_4153_4527 123
464 3300046809 Ga0495600_0531646 Ga0495600_0531646_277_651 123
465 3300046809 Ga0495600_0765337 Ga0495600_0765337_17_388 123
466 3300046810 Ga0495660_0270635 Ga0495660_0270635_267_686 123
467 3300047317 Ga0495604_0000506 Ga0495604_0000506_13140_13559 123
468 3300047317 Ga0495604_0029840 Ga0495604_0029840_22_396 123
469 3300047319 Ga0495674_0053146 Ga0495674_0053146_2465_2884 123
470 3300047319 Ga0495674_0083858 Ga0495674_0083858_1322_1741 123
471 3300047319 Ga0495674_0372909 Ga0495674_0372909_299_670 123
472 3300047321 Ga0495676_0317222 Ga0495676_0317222_404_778 123
473 3300047322 Ga0495680_0052414 Ga0495680_0052414_961_1380 123
474 3300047323 Ga0495683_0043793 Ga0495683_0043793_733_1152 123
475 3300047323 Ga0495683_0055478 Ga0495683_0055478_933_1319 123
476 3300047444 Ga0495675_0093745 Ga0495675_0093745_1002_1421 123
477 3300047444 Ga0495675_0260376 Ga0495675_0260376_257_628 123
478 3300047446 Ga0495679_000012 Ga0495679_000012_303692_304111 123
479 3300047469 Ga0495673_0047988 Ga0495673_0047988_1010_1429 123
480 3300047472 Ga0495686_0023321 Ga0495686_0023321_1315_1734 123
481 3300047673 Ga0495593_0066505 Ga0495593_0066505_687_1106 123
482 3300048088 Ga0495602_0004974 Ga0495602_0004974_10898_11317 123
483 3300048088 Ga0495602_0070594 Ga0495602_0070594_44_415 123
484 3300048088 Ga0495602_0073487 Ga0495602_0073487_1497_1871 123
485 3300048088 Ga0495602_0429400 Ga0495602_0429400_215_589 123
486 3300048088 Ga0495602_0497661 Ga0495602_0497661_131_505 123
487 3300048089 Ga0495614_0078881 Ga0495614_0078881_112_531 123
488 3300048091 Ga0495626_0010284 Ga0495626_0010284_3147_3566 123
489 3300048920 Ga0496117_0208307 Ga0496117_0208307_142_561 123
490 3300048921 Ga0496118_0022515 Ga0496118_0022515_2406_2825 123
491 3300049459 Ga0495678_027223 Ga0495678_027223_1174_1593 123
492 3300049460 Ga0495682_0029723 Ga0495682_0029723_619_1038 123
493 3300053077 Ga0495601_0030533 Ga0495601_0030533_1561_1935 123
494 3300053078 Ga0495612_0600603 Ga0495612_0600603_112_486 123
495 3300053119 Ga0500595_001123 Ga0500595_001123_886_1260 123
496 3300053141 Ga0500574_000576 Ga0500574_000576_109_483 123
497 3300053154 Ga0500619_000426 Ga0500619_000426_3337_3711 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12643

MazG-like

MazG-like family

53

137

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mu5-assembly1.cif.gz_C human dctpp1 bound to triptolide 0.954 10 107
7mu5-assembly2.cif.gz_H human dctpp1 bound to triptolide 0.9533 10 107
7mu5-assembly1.cif.gz_G human dctpp1 bound to triptolide 0.9426 10 106
6sqw-assembly1.cif.gz_A mouse dctpase in complex with 5-me-dcmp 0.9314 10 109
7mu5-assembly1.cif.gz_A human dctpp1 bound to triptolide 0.9297 10 107
ID Description Score Start End Superfamily
af_C6T106_4_117_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9397 10 109 1.10.287.1080
2oieC00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9255 10 97 1.10.287.1080
2oigB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9183 10 98 1.10.287.1080
2oieB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9132 10 100 1.10.287.1080
2oieA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9083 10 98 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A6L6PH18-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9726 3 108 GO:0005829
GO:0006253
GO:0042262
GO:0047840
AF-A0A7X0E5V1-F1-model_v4 NTP pyrophosphatase (Non-canonical NTP hydrolase) 0.9638 10 122 GO:0009143
GO:0047429
AF-B2TAF5-F1-model_v4 MazG nucleotide pyrophosphohydrolase 0.9624 1 123 GO:0005829
GO:0006253
GO:0042262
GO:0047840
AF-A0A7L9C354-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9622 10 114 GO:0009143
GO:0047429
AF-A0A6B3SQY8-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9602 9 118 GO:0005829
GO:0006253
GO:0042262
GO:0047840

Feature Viewer

pLDDT pTM Quality
90.99 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map