F454962

General Info

Members Datasets Scaffolds Average Seq Length
496 219 496 218

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0307897|Ga0501039_0307897_409_1068
Length 214
Sequence MNQIFPRSANAAARMSLAGLAVFVLLVVWIVFALMRSSWATGQADYVQQPIQFSHAHHAGGMGIDCRYCHTSVENSAFAGIPPTQTCMNWNAAPILEPVRSSFRDDTNLTWIRVHDLPDFVYFNHQIHVKQGVGCATCHGEVDKMPLMYQANSLLMEWCLDCHRAPERYLRPRDQVFNMTYVPPANQLELGRQLRQEYNVASVEHLTSCSICHR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10303023 3300005289 Bacteria 882
2 Ga0065715_10296995 3300005293 Bacteria 1050
3 Ga0065707_10237816 3300005295 Bacteria 1166
4 Ga0070676_10004427 3300005328 Bacteria 7391
5 Ga0070676_10397364 3300005328 Bacteria 958
6 Ga0070690_100001847 3300005330 Bacteria 11237
7 Ga0070690_100172214 3300005330 Bacteria 1490
8 Ga0070690_100251981 3300005330 Bacteria 1249
9 Ga0070670_100244085 3300005331 Bacteria 1564
10 Ga0070677_10040692 3300005333 Bacteria 1830
11 Ga0070677_10069726 3300005333 Bacteria 1475
12 Ga0068869_100003009 3300005334 Bacteria 10251
13 Ga0068869_100121910 3300005334 Bacteria 1995
14 Ga0070666_10020274 3300005335 Bacteria 4297
15 Ga0068868_100131885 3300005338 Bacteria 2045
16 Ga0068868_100483542 3300005338 Bacteria 1082
17 Ga0070689_100001026 3300005340 Bacteria 17536
18 Ga0070689_100012981 3300005340 Bacteria 6018
19 Ga0070689_100201105 3300005340 Bacteria 1627
20 Ga0070689_100246987 3300005340 Bacteria 1471
21 Ga0070689_100719447 3300005340 Bacteria 873
22 Ga0070687_100019141 3300005343 Bacteria 3181
23 Ga0070668_100282806 3300005347 Bacteria 1386
24 Ga0070669_100000204 3300005353 Bacteria 50400
25 Ga0070669_100001921 3300005353 Bacteria 15002
26 Ga0070669_100047640 3300005353 Bacteria 3127
27 Ga0070669_100153753 3300005353 Bacteria 1782
28 Ga0070675_100000792 3300005354 Bacteria 22172
29 Ga0070675_100002457 3300005354 Bacteria 13856
30 Ga0070675_100017840 3300005354 Bacteria 5646
31 Ga0070675_100660296 3300005354 Bacteria 951
32 Ga0070671_100012074 3300005355 Bacteria 6949
33 Ga0070674_100223550 3300005356 Bacteria 1466
34 Ga0070674_100283767 3300005356 Bacteria 1313
35 Ga0070674_100467575 3300005356 Bacteria 1044
36 Ga0070673_100001253 3300005364 Bacteria 14749
37 Ga0070673_100088189 3300005364 Bacteria 2530
38 Ga0070673_100339261 3300005364 Unclassified 1331
39 Ga0070673_100868242 3300005364 Bacteria 835
40 Ga0070688_100005362 3300005365 Bacteria 6743
41 Ga0070688_100027813 3300005365 Bacteria 3369
42 Ga0070667_100124283 3300005367 Bacteria 2247
43 Ga0070701_10385147 3300005438 Bacteria 885
44 Ga0070700_100002155 3300005441 Bacteria 9985
45 Ga0070700_100610795 3300005441 Bacteria 856
46 Ga0070708_100332703 3300005445 Bacteria 1431
47 Ga0070678_100093947 3300005456 Bacteria 2307
48 Ga0070662_100021258 3300005457 Bacteria 4429
49 Ga0070662_100187738 3300005457 Bacteria 1632
50 Ga0068867_100042301 3300005459 Bacteria 3333
51 Ga0068867_100047466 3300005459 Bacteria 3157
52 Ga0068867_100118094 3300005459 Bacteria 2046
53 Ga0070685_10316989 3300005466 Bacteria 1055
54 Ga0070706_100556577 3300005467 Bacteria 1067
55 Ga0070698_100768551 3300005471 Bacteria 907
56 Ga0070672_100000166 3300005543 Bacteria 36328
57 Ga0070672_100000377 3300005543 Bacteria 25848
58 Ga0070672_100005035 3300005543 Bacteria 8711
59 Ga0070686_100057140 3300005544 Bacteria 2505
60 Ga0070695_100637872 3300005545 Bacteria 840
61 Ga0070693_100046269 3300005547 Bacteria 2470
62 Ga0070665_101246628 3300005548 Bacteria 754
63 Ga0070664_100685925 3300005564 Bacteria 954
64 Ga0070702_100336631 3300005615 Bacteria 1057
65 Ga0068859_100024990 3300005617 Bacteria 5996
66 Ga0068859_100143105 3300005617 Bacteria 2465
67 Ga0068859_100448159 3300005617 Bacteria 1387
68 Ga0068864_100000103 3300005618 Bacteria 82304
69 Ga0068864_100167229 3300005618 Bacteria 2003
70 Ga0068866_10074339 3300005718 Bacteria 1806
71 Ga0068866_10286939 3300005718 Bacteria 1022
72 Ga0068861_100017558 3300005719 Bacteria 5083
73 Ga0068861_100157170 3300005719 Bacteria 1872
74 Ga0068851_10083905 3300005834 Bacteria 1668
75 Ga0068870_10000136 3300005840 Bacteria 25517
76 Ga0068863_100217597 3300005841 Bacteria 1840
77 Ga0068858_100003612 3300005842 Bacteria 15307
78 Ga0068858_100043606 3300005842 Bacteria 4160
79 Ga0068858_100250184 3300005842 Bacteria 1683
80 Ga0068858_100813936 3300005842 Bacteria 911
81 Ga0068860_100021753 3300005843 Bacteria 6205
82 Ga0068860_100394869 3300005843 Bacteria 1367
83 Ga0068860_100489210 3300005843 Bacteria 1227
84 Ga0068862_100002024 3300005844 Bacteria 18363
85 Ga0068862_100010364 3300005844 Bacteria 7692
86 Ga0081539_10088914 3300005985 Bacteria 1601
87 Ga0070717_10000085 3300006028 Bacteria 74645
88 Ga0070716_100008169 3300006173 Bacteria 5185
89 Ga0097621_100139051 3300006237 Bacteria 2074
90 Ga0097621_100339302 3300006237 Bacteria 1334
91 Ga0097621_100448379 3300006237 Bacteria 1162
92 Ga0068871_100239846 3300006358 Bacteria 1576
93 Ga0068871_100526082 3300006358 Bacteria 1068
94 Ga0068871_100713322 3300006358 Bacteria 920
95 Ga0075428_100086622 3300006844 Bacteria 3416
96 Ga0075428_100423096 3300006844 Bacteria 1427
97 Ga0075430_100032876 3300006846 Bacteria 4402
98 Ga0075431_100028000 3300006847 Bacteria 5784
99 Ga0075431_100537042 3300006847 Bacteria 1158
100 Ga0075433_10000481 3300006852 Bacteria 26021
101 Ga0075433_10056089 3300006852 Bacteria 3441
102 Ga0075433_10163807 3300006852 Bacteria 1979
103 Ga0075434_100003939 3300006871 Bacteria 13303
104 Ga0075434_100047741 3300006871 Bacteria 4248
105 Ga0075434_100255478 3300006871 Bacteria 1771
106 Ga0075434_100387258 3300006871 Bacteria 1419
107 Ga0075429_100151566 3300006880 Bacteria 2030
108 Ga0075429_100192861 3300006880 Unclassified 1785
109 Ga0075429_100535021 3300006880 Bacteria 1027
110 Ga0068865_100006527 3300006881 Bacteria 7125
111 Ga0068865_100036383 3300006881 Bacteria 3319
112 Ga0075436_100033223 3300006914 Bacteria 3556
113 Ga0097620_100024991 3300006931 Bacteria 5996
114 Ga0097620_100044246 3300006931 Bacteria 4474
115 Ga0097620_100143099 3300006931 Bacteria 2465
116 Ga0097620_100448200 3300006931 Bacteria 1387
117 Ga0075435_100036163 3300007076 Bacteria 3922
118 Ga0075435_100207770 3300007076 Bacteria 1660
119 Ga0111539_10001618 3300009094 Bacteria 30088
120 Ga0111539_10002531 3300009094 Bacteria 24206
121 Ga0111539_10010349 3300009094 Bacteria 11743
122 Ga0111539_10015487 3300009094 Bacteria 9479
123 Ga0111539_10018366 3300009094 Bacteria 8662
124 Ga0111539_10166497 3300009094 Bacteria 2577
125 Ga0111539_10284448 3300009094 Bacteria 1924
126 Ga0111539_10512224 3300009094 Unclassified 1398
127 Ga0105245_10000197 3300009098 Bacteria 57534
128 Ga0105245_10477248 3300009098 Bacteria 1260
129 Ga0105245_10656295 3300009098 Bacteria 1079
130 Ga0105247_10225770 3300009101 Bacteria 1270
131 Ga0114129_10003254 3300009147 Bacteria 22796
132 Ga0114129_10009517 3300009147 Bacteria 13860
133 Ga0105248_10031430 3300009177 Bacteria 5935
134 Ga0105248_10158636 3300009177 Bacteria 2552
135 Ga0105248_10231299 3300009177 Bacteria 2081
136 Ga0105248_10510942 3300009177 Unclassified 1355
137 Ga0105238_10006933 3300009551 Bacteria 11320
138 Ga0105249_10003075 3300009553 Bacteria 14408
139 Ga0105249_10030684 3300009553 Bacteria 4860
140 Ga0105249_10129266 3300009553 Bacteria 2409
141 Ga0105249_10200372 3300009553 Bacteria 1953
142 Ga0105249_10436605 3300009553 Bacteria 1346
143 Ga0105239_10033584 3300010375 Bacteria 5633
144 Ga0105246_10005224 3300011119 Bacteria 7898
145 Ga0157371_10258152 3300013102 Bacteria 1256
146 Ga0157371_10378177 3300013102 Bacteria 1034
147 Ga0157370_10156992 3300013104 Bacteria 2117
148 Ga0157378_10007716 3300013297 Bacteria 9389
149 Ga0157378_10022713 3300013297 Bacteria 5522
150 Ga0163162_10092151 3300013306 Bacteria 3114
151 Ga0163162_11085619 3300013306 Bacteria 906
152 Ga0157375_10000055 3300013308 Bacteria 126704
153 Ga0157375_10466079 3300013308 Bacteria 1429
154 Ga0157375_10766785 3300013308 Bacteria 1115
155 Ga0163163_10000036 3300014325 Bacteria 156659
156 Ga0163163_10033269 3300014325 Bacteria 4986
157 Ga0157380_10022872 3300014326 Bacteria 4713
158 Ga0157380_10031216 3300014326 Bacteria 4089
159 Ga0157380_10054507 3300014326 Bacteria 3173
160 Ga0157380_10122012 3300014326 Bacteria 2209
161 Ga0157380_10617230 3300014326 Bacteria 1076
162 Ga0157377_10000129 3300014745 Bacteria 48882
163 Ga0157377_10132146 3300014745 Bacteria 1526
164 Ga0157377_10377545 3300014745 Bacteria 959
165 Ga0157379_10635560 3300014968 Bacteria 998
166 Ga0157376_10315935 3300014969 Bacteria 1484
167 Ga0157376_10579745 3300014969 Bacteria 1114
168 Ga0213876_10002777 3300021384 Bacteria 10199
169 Ga0213875_10004038 3300021388 Bacteria 8167
170 Ga0207697_10008801 3300025315 Bacteria 4394
171 Ga0207682_10000719 3300025893 Bacteria 15392
172 Ga0207682_10042166 3300025893 Bacteria 1864
173 Ga0207682_10150837 3300025893 Bacteria 1048
174 Ga0207688_10007346 3300025901 Bacteria 5997
175 Ga0207680_10028203 3300025903 Bacteria 3137
176 Ga0207680_10309423 3300025903 Bacteria 1103
177 Ga0207680_10322774 3300025903 Bacteria 1080
178 Ga0207645_10015529 3300025907 Bacteria 5057
179 Ga0207645_10029155 3300025907 Bacteria 3558
180 Ga0207643_10000507 3300025908 Bacteria 24887
181 Ga0207643_10213109 3300025908 Bacteria 1180
182 Ga0207684_10097188 3300025910 Bacteria 2514
183 Ga0207684_10709280 3300025910 Bacteria 854
184 Ga0207695_10012508 3300025913 Bacteria 10179
185 Ga0207662_10032012 3300025918 Bacteria 3058
186 Ga0207662_10063488 3300025918 Bacteria 2221
187 Ga0207657_10776527 3300025919 Bacteria 741
188 Ga0207681_10000044 3300025923 Bacteria 128566
189 Ga0207681_10002712 3300025923 Bacteria 11216
190 Ga0207681_10370114 3300025923 Bacteria 1151
191 Ga0207694_10460187 3300025924 Bacteria 1063
192 Ga0207650_10184095 3300025925 Bacteria 1666
193 Ga0207659_10005272 3300025926 Bacteria 7833
194 Ga0207659_10005315 3300025926 Bacteria 7805
195 Ga0207659_10341435 3300025926 Bacteria 1240
196 Ga0207659_10458552 3300025926 Bacteria 1074
197 Ga0207659_10851328 3300025926 Bacteria 784
198 Ga0207687_10000438 3300025927 Bacteria 28280
199 Ga0207644_10037133 3300025931 Bacteria 3425
200 Ga0207644_10408291 3300025931 Unclassified 1111
201 Ga0207706_10005693 3300025933 Bacteria 11608
202 Ga0207706_10124291 3300025933 Bacteria 2270
203 Ga0207686_10013548 3300025934 Bacteria 4514
204 Ga0207709_10050331 3300025935 Bacteria 2547
205 Ga0207670_10000713 3300025936 Bacteria 17545
206 Ga0207670_10162242 3300025936 Bacteria 1669
207 Ga0207670_10204070 3300025936 Bacteria 1503
208 Ga0207670_10297795 3300025936 Bacteria 1262
209 Ga0207670_10333476 3300025936 Bacteria 1197
210 Ga0207670_10429625 3300025936 Bacteria 1061
211 Ga0207669_10060168 3300025937 Bacteria 2327
212 Ga0207704_10002954 3300025938 Bacteria 7675
213 Ga0207704_10022859 3300025938 Bacteria 3359
214 Ga0207704_10236903 3300025938 Bacteria 1361
215 Ga0207665_10020525 3300025939 Bacteria 4342
216 Ga0207691_10000782 3300025940 Bacteria 31580
217 Ga0207691_10017673 3300025940 Bacteria 6760
218 Ga0207691_10083337 3300025940 Bacteria 2871
219 Ga0207691_10189898 3300025940 Bacteria 1792
220 Ga0207691_10192204 3300025940 Bacteria 1780
221 Ga0207711_10019915 3300025941 Bacteria 5592
222 Ga0207689_10002833 3300025942 Bacteria 16002
223 Ga0207689_10023937 3300025942 Bacteria 5122
224 Ga0207689_10275166 3300025942 Bacteria 1394
225 Ga0207689_10349612 3300025942 Bacteria 1229
226 Ga0207679_10305103 3300025945 Bacteria 1374
227 Ga0207651_10069418 3300025960 Bacteria 2488
228 Ga0207651_10114761 3300025960 Bacteria 2029
229 Ga0207712_10008085 3300025961 Bacteria 6654
230 Ga0207712_10041201 3300025961 Bacteria 3173
231 Ga0207712_10368034 3300025961 Bacteria 1199
232 Ga0207712_10480682 3300025961 Bacteria 1059
233 Ga0207712_10948942 3300025961 Bacteria 762
234 Ga0207640_10181153 3300025981 Bacteria 1580
235 Ga0207677_10071022 3300026023 Bacteria 2456
236 Ga0207677_10430755 3300026023 Bacteria 1126
237 Ga0207703_10008543 3300026035 Bacteria 8088
238 Ga0207703_10011194 3300026035 Bacteria 6979
239 Ga0207639_10000118 3300026041 Bacteria 60793
240 Ga0207678_10030476 3300026067 Bacteria 4708
241 Ga0207641_10215348 3300026088 Bacteria 1778
242 Ga0207641_10410419 3300026088 Bacteria 1302
243 Ga0207648_10000493 3300026089 Bacteria 43940
244 Ga0207648_10064149 3300026089 Bacteria 3202
245 Ga0207648_10068021 3300026089 Bacteria 3104
246 Ga0207676_10000023 3300026095 Bacteria 266848
247 Ga0207676_10087149 3300026095 Bacteria 2553
248 Ga0207676_10155631 3300026095 Bacteria 1974
249 Ga0207675_100086303 3300026118 Bacteria 2947
250 Ga0207683_10059425 3300026121 Bacteria 3358
251 Ga0209983_1035992 3300027665 Bacteria 1063
252 Ga0207428_10000568 3300027907 Bacteria 43738
253 Ga0207428_10004803 3300027907 Bacteria 12761
254 Ga0207428_10039098 3300027907 Bacteria 3852
255 Ga0207428_10209144 3300027907 Bacteria 1466
256 Ga0207428_10232609 3300027907 Bacteria 1379
257 Ga0207428_10484116 3300027907 Bacteria 900
258 Ga0268265_10000973 3300028380 Bacteria 26200
259 Ga0268265_10006037 3300028380 Bacteria 8237
260 Ga0268264_10021243 3300028381 Bacteria 5304
261 Ga0268264_10217561 3300028381 Bacteria 1757
262 Ga0268264_10524289 3300028381 Bacteria 1159
263 Ga0268264_10840106 3300028381 Bacteria 919
264 Ga0268264_10875544 3300028381 Bacteria 900
265 Ga0265320_10137160 3300031240 Unclassified 1109
266 Ga0307408_100146533 3300031548 Bacteria 1859
267 Ga0307408_100164665 3300031548 Bacteria 1765
268 Ga0307408_100466620 3300031548 Bacteria 1098
269 Ga0307508_10008339 3300031616 Bacteria 9581
270 Ga0307405_10256625 3300031731 Bacteria 1303
271 Ga0307405_10290290 3300031731 Bacteria 1236
272 Ga0307413_10125893 3300031824 Bacteria 1745
273 Ga0307413_10240019 3300031824 Bacteria 1337
274 Ga0307406_10238679 3300031901 Bacteria 1362
275 Ga0307407_10016839 3300031903 Bacteria 3650
276 Ga0307407_10061999 3300031903 Bacteria 2188
277 Ga0307407_10471380 3300031903 Bacteria 915
278 Ga0307409_100096252 3300031995 Bacteria 2442
279 Ga0307409_100116575 3300031995 Bacteria 2252
280 Ga0307409_100120658 3300031995 Bacteria 2219
281 Ga0307416_100083906 3300032002 Bacteria 2705
282 Ga0307416_100333149 3300032002 Bacteria 1526
283 Ga0307416_100593461 3300032002 Bacteria 1186
284 Ga0307414_10081139 3300032004 Bacteria 2374
285 Ga0307411_10754864 3300032005 Bacteria 852
286 Ga0307415_100801265 3300032126 Bacteria 860
287 Ga0373938_0013981 3300034957 Bacteria 1533
288 Ga0373929_0000007 3300035085 Bacteria 315743
289 Ga0373934_0009716 3300035086 Bacteria 3608
290 Ga0373949_0007515 3300035090 Bacteria 2386
291 Ga0373932_0000109 3300035112 Bacteria 22698
292 Ga0373932_0158944 3300035112 Bacteria 780
293 Ga0373939_0013080 3300035114 Bacteria 2128
294 Ga0373956_0009437 3300035119 Bacteria 3971
295 Ga0373960_0067439 3300035121 Bacteria 1099
296 Ga0373943_0030662 3300035170 Bacteria 2547
297 Ga0373955_0005371 3300035172 Bacteria 5753
298 Ga0373935_0000591 3300035692 Bacteria 18897
299 Ga0373947_0469667 3300035725 Bacteria 853
300 Ga0373937_0000120 3300036401 Bacteria 74752
301 Ga0436364_1222727 3300037853 Bacteria 13098
302 Ga0436365_0302944 3300039437 Bacteria 12196
303 Ga0436363_1149248 3300039450 Bacteria 772
304 Ga0439453_0029461 3300041408 Bacteria 1034
305 Ga0439457_113939 3300042014 Bacteria 636
306 Ga0439462_0061659 3300042015 Bacteria 1015
307 Ga0439446_0024602 3300042156 Bacteria 1719
308 Ga0439435_0011963 3300042436 Bacteria 2091
309 Ga0451577_0081593 3300042876 Bacteria 2885
310 Ga0453684_0074668 3300044712 Unclassified 4267
311 Ga0451576_0009423 3300045051 Bacteria 11317
312 Ga0451576_0086600 3300045051 Bacteria 3258
313 Ga0495592_0222647 3300046454 Bacteria 1261
314 Ga0495653_0037781 3300046463 Bacteria 3791
315 Ga0495580_0545515 3300046472 Bacteria 770
316 Ga0495618_0347217 3300046514 Bacteria 915
317 Ga0495630_0498199 3300046517 Bacteria 934
318 Ga0495587_0212517 3300046536 Bacteria 1092
319 Ga0495599_0090282 3300046678 Bacteria 1912
320 Ga0495670_0146209 3300046691 Bacteria 1239
321 Ga0496105_0041841 3300048908 Bacteria 3776
322 Ga0496110_0666138 3300048913 Bacteria 941
323 Ga0496114_0000031 3300048917 Bacteria 168230
324 Ga0496114_0107733 3300048917 Bacteria 2385
325 Ga0501031_0001183 3300049568 Bacteria 15890
326 Ga0501031_0001190 3300049568 Bacteria 15840
327 Ga0501031_0255586 3300049568 Bacteria 1138
328 Ga0501032_0004343 3300049569 Bacteria 10704
329 Ga0501032_0113003 3300049569 Bacteria 1796
330 Ga0501032_0143255 3300049569 Bacteria 1573
331 Ga0501033_0102506 3300049570 Bacteria 2087
332 Ga0501033_0118091 3300049570 Bacteria 1926
333 Ga0501033_0149397 3300049570 Bacteria 1686
334 Ga0501034_0012290 3300049571 Bacteria 8847
335 Ga0501034_0043515 3300049571 Bacteria 4544
336 Ga0501034_0171517 3300049571 Bacteria 2136
337 Ga0501034_0257964 3300049571 Bacteria 1686
338 Ga0501034_0306193 3300049571 Bacteria 1524
339 Ga0501036_0022584 3300049572 Bacteria 5292
340 Ga0501036_0027980 3300049572 Bacteria 4765
341 Ga0501036_0122262 3300049572 Bacteria 2198
342 Ga0501036_0294322 3300049572 Unclassified 1358
343 Ga0501036_0525889 3300049572 Bacteria 983
344 Ga0501037_0005122 3300049573 Bacteria 9534
345 Ga0501037_0014483 3300049573 Bacteria 5803
346 Ga0501037_0098698 3300049573 Bacteria 2109
347 Ga0501037_0117646 3300049573 Bacteria 1912
348 Ga0501038_0004539 3300049574 Bacteria 12924
349 Ga0501038_0009083 3300049574 Bacteria 9124
350 Ga0501038_0184001 3300049574 Bacteria 1684
351 Ga0501038_0528365 3300049574 Bacteria 899
352 Ga0501039_0015360 3300049575 Bacteria 5862
353 Ga0501039_0046168 3300049575 Bacteria 3365
354 Ga0501039_0307897 3300049575 Unclassified 1245
355 Ga0501039_0836537 3300049575 Bacteria 717
356 Ga0501040_0037381 3300049576 Bacteria 3298
357 Ga0501040_0154341 3300049576 Unclassified 1621
358 Ga0501042_0026348 3300049578 Bacteria 4086
359 Ga0501042_0081135 3300049578 Bacteria 2324
360 Ga0501042_0394607 3300049578 Bacteria 1002
361 Ga0501042_0523579 3300049578 Unclassified 861
362 Ga0501043_0004096 3300049579 Bacteria 11901
363 Ga0501043_0004714 3300049579 Bacteria 11054
364 Ga0501043_0023942 3300049579 Bacteria 4790
365 Ga0501043_0035802 3300049579 Bacteria 3905
366 Ga0501043_0091942 3300049579 Bacteria 2385
367 Ga0501046_0003842 3300049580 Bacteria 13746
368 Ga0501046_0020286 3300049580 Bacteria 5499
369 Ga0501046_0043392 3300049580 Bacteria 3580
370 Ga0501046_0044537 3300049580 Bacteria 3529
371 Ga0501046_0116864 3300049580 Bacteria 2032
372 Ga0501046_0225506 3300049580 Archaea 1386
373 Ga0501046_0350469 3300049580 Bacteria 1072
374 Ga0501047_0009933 3300049581 Bacteria 8999
375 Ga0501047_0016447 3300049581 Bacteria 7061
376 Ga0501047_0031197 3300049581 Bacteria 5140
377 Ga0501047_0063863 3300049581 Bacteria 3551
378 Ga0501047_0102423 3300049581 Bacteria 2742
379 Ga0501047_0122486 3300049581 Bacteria 2481
380 Ga0501048_0005757 3300049582 Bacteria 9418
381 Ga0501048_0010673 3300049582 Bacteria 6852
382 Ga0501048_0017460 3300049582 Bacteria 5284
383 Ga0501048_0053291 3300049582 Bacteria 2877
384 Ga0501048_0100888 3300049582 Bacteria 2036
385 Ga0501048_0116121 3300049582 Bacteria 1891
386 Ga0501067_0001823 3300049583 Bacteria 11705
387 Ga0501067_0012492 3300049583 Bacteria 4710
388 Ga0501067_0082157 3300049583 Bacteria 1786
389 Ga0501067_0171987 3300049583 Bacteria 1206
390 Ga0501068_0001010 3300049584 Bacteria 14839
391 Ga0501068_0001517 3300049584 Bacteria 12348
392 Ga0501068_0565983 3300049584 Bacteria 739
393 Ga0501069_0000216 3300049585 Bacteria 25612
394 Ga0501069_0002540 3300049585 Bacteria 9319
395 Ga0501069_0065646 3300049585 Bacteria 2029
396 Ga0501069_0399309 3300049585 Bacteria 813
397 Ga0501070_0012415 3300049586 Bacteria 7185
398 Ga0501070_0085552 3300049586 Bacteria 2610
399 Ga0501070_0092709 3300049586 Bacteria 2499
400 Ga0501070_0106693 3300049586 Bacteria 2315
401 Ga0501070_0110718 3300049586 Bacteria 2269
402 Ga0501071_0039220 3300049587 Bacteria 3388
403 Ga0501071_0188302 3300049587 Bacteria 1547
404 Ga0501071_0382276 3300049587 Bacteria 1074
405 Ga0501071_0448720 3300049587 Bacteria 987
406 Ga0501072_0056176 3300049588 Bacteria 3102
407 Ga0501072_0250702 3300049588 Bacteria 1410
408 Ga0501072_0374112 3300049588 Bacteria 1130
409 Ga0501073_0002939 3300049589 Bacteria 12777
410 Ga0501073_0005121 3300049589 Bacteria 9832
411 Ga0501073_0019205 3300049589 Bacteria 4937
412 Ga0501073_0052424 3300049589 Bacteria 2856
413 Ga0501073_0258933 3300049589 Bacteria 1200
414 Ga0501074_0000433 3300049590 Bacteria 25024
415 Ga0501074_0111283 3300049590 Bacteria 1959
416 Ga0501074_0183223 3300049590 Bacteria 1493
417 Ga0501074_0598770 3300049590 Bacteria 779
418 Ga0501075_0011141 3300049591 Bacteria 6355
419 Ga0501075_0028160 3300049591 Bacteria 4145
420 Ga0501075_0163203 3300049591 Bacteria 1700
421 Ga0501076_0021628 3300049592 Bacteria 4936
422 Ga0501076_0040623 3300049592 Bacteria 3656
423 Ga0501076_0058028 3300049592 Bacteria 3075
424 Ga0501076_0303225 3300049592 Bacteria 1310
425 Ga0501076_0322259 3300049592 Bacteria 1267
426 Ga0501076_0433979 3300049592 Bacteria 1081
427 Ga0501077_0009094 3300049593 Bacteria 6165
428 Ga0501079_0010714 3300049741 Bacteria 6981
429 Ga0501079_0068041 3300049741 Bacteria 2749
430 Ga0501079_0182131 3300049741 Bacteria 1639
431 Ga0501079_0248346 3300049741 Bacteria 1390
432 Ga0501080_0004916 3300049742 Bacteria 11911
433 Ga0501080_0138013 3300049742 Bacteria 2255
434 Ga0501080_0248387 3300049742 Bacteria 1622
435 Ga0501080_0295690 3300049742 Bacteria 1469
436 Ga0501081_0218826 3300049743 Bacteria 1385
437 Ga0501081_0261674 3300049743 Unclassified 1264
438 Ga0501083_0002660 3300049744 Bacteria 12302
439 Ga0501083_0008054 3300049744 Bacteria 7455
440 Ga0501083_0016765 3300049744 Bacteria 5116
441 Ga0501083_0019371 3300049744 Bacteria 4741
442 Ga0501035_0004668 3300049822 Bacteria 13005
443 Ga0501035_0015543 3300049822 Bacteria 7022
444 Ga0501035_0153045 3300049822 Bacteria 2000
445 Ga0501035_0164111 3300049822 Bacteria 1922
446 Ga0501044_0007986 3300049823 Bacteria 11625
447 Ga0501044_0010566 3300049823 Bacteria 10013
448 Ga0501044_0183438 3300049823 Bacteria 2058
449 Ga0501044_0373734 3300049823 Bacteria 1341
450 Ga0501045_0149462 3300049824 Bacteria 1738
451 Ga0501045_0157868 3300049824 Unclassified 1688
452 Ga0501045_0197364 3300049824 Bacteria 1499
453 nmdc:mga05p37_1932_c1 3300050507 Bacteria 24124
454 nmdc:mga05p37_1_c1 3300050507 Bacteria 177088
455 nmdc:mga05p37_854057_c1 3300050507 Bacteria 988
456 nmdc:mga09592_12830_c1 3300050508 Bacteria 6832
457 nmdc:mga0qj67_294562_c1 3300050509 Bacteria 1315
458 nmdc:mga06r32_181522_c1 3300050510 Bacteria 2090
459 nmdc:mga06r32_346778_c1 3300050510 Bacteria 1469
460 nmdc:mga06r32_85895_c1 3300050510 Bacteria 3068
461 nmdc:mga08y16_31914_c1 3300050511 Bacteria 5539
462 nmdc:mga08y16_34492_c1 3300050511 Bacteria 5315
463 nmdc:mga08y16_3928_c1 3300050511 Bacteria 15483
464 nmdc:mga08y16_43009_c1 3300050511 Bacteria 4732
465 nmdc:mga08y16_52679_c1 3300050511 Bacteria 4257
466 nmdc:mga08y16_63864_c1 3300050511 Bacteria 3846
467 nmdc:mga08y16_654565_c1 3300050511 Bacteria 1054
468 nmdc:mga0n895_1100158_c1 3300050512 Unclassified 772
469 nmdc:mga0n895_12148_c1 3300050512 Bacteria 7708
470 nmdc:mga0n895_247176_c1 3300050512 Bacteria 1810
471 nmdc:mga0n895_6378_c1 3300050512 Bacteria 10010
472 nmdc:mga0n895_88618_c1 3300050512 Bacteria 3094
473 nmdc:mga0rr50_109764_c1 3300050513 Bacteria 2181
474 nmdc:mga0rr50_81029_c1 3300050513 Bacteria 2504
475 nmdc:mga08x19_22603_c1 3300050514 Bacteria 3895
476 nmdc:mga08x19_312488_c1 3300050514 Bacteria 1093
477 nmdc:mga08x19_31299_c1 3300050514 Bacteria 3347
478 nmdc:mga0a205_1555_c1 3300050515 Bacteria 19642
479 nmdc:mga0a205_24529_c1 3300050515 Bacteria 5737
480 nmdc:mga0a205_26824_c1 3300050515 Bacteria 5497
481 Ga0495601_0131855 3300053077 Bacteria 1628
482 Ga0495619_0162780 3300053085 Bacteria 1541
483 Ga0501084_0003896 3300054114 Bacteria 12150
484 Ga0501084_0005648 3300054114 Bacteria 10271
485 Ga0501084_0126184 3300054114 Bacteria 2153
486 Ga0501084_0228747 3300054114 Bacteria 1569
487 Ga0590071_002507 3300059421 Bacteria 4621
488 Ga0501082_0000325 3300060353 Bacteria 42343
489 Ga0501082_0004480 3300060353 Bacteria 12200
490 Ga0501082_0012451 3300060353 Bacteria 7308
491 Ga0501082_0023808 3300060353 Bacteria 5280
492 Ga0501082_0072535 3300060353 Bacteria 2965
493 Ga0501082_0135294 3300060353 Bacteria 2138
494 Ga0501082_0148171 3300060353 Unclassified 2038
495 Ga0501082_0259194 3300060353 Bacteria 1513
496 Ga0530510_0212359 3300061734 Bacteria 1438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0433979 Ga0501076_0433979_489_1046 180
2 3300049822 Ga0501035_0164111 Ga0501035_0164111_17_589 187
3 3300042014 Ga0439457_113939 Ga0439457_113939_20_604 189
4 3300042015 Ga0439462_0061659 Ga0439462_0061659_178_762 189
5 3300048913 Ga0496110_0666138 Ga0496110_0666138_338_925 195
6 3300050507 nmdc:mga05p37_854057_c1 nmdc:mga05p37_854057_c1_378_968 196
7 3300021388 Ga0213875_10004038 Ga0213875_100040385 198
8 3300006844 Ga0075428_100423096 Ga0075428_1004230962 199
9 3300031548 Ga0307408_100466620 Ga0307408_1004666202 199
10 3300031731 Ga0307405_10256625 Ga0307405_102566251 199
11 3300031824 Ga0307413_10240019 Ga0307413_102400191 199
12 3300031903 Ga0307407_10061999 Ga0307407_100619992 199
13 3300032002 Ga0307416_100593461 Ga0307416_1005934612 199
14 3300032005 Ga0307411_10754864 Ga0307411_107548641 199
15 3300005364 Ga0070673_100868242 Ga0070673_1008682421 200
16 3300006237 Ga0097621_100139051 Ga0097621_1001390512 200
17 3300014326 Ga0157380_10617230 Ga0157380_106172302 200
18 3300046463 Ga0495653_0037781 Ga0495653_0037781_2651_3268 200
19 3300005356 Ga0070674_100467575 Ga0070674_1004675752 202
20 3300005617 Ga0068859_100448159 Ga0068859_1004481592 202
21 3300006931 Ga0097620_100448200 Ga0097620_1004482002 202
22 3300009094 Ga0111539_10284448 Ga0111539_102844481 202
23 3300009553 Ga0105249_10030684 Ga0105249_100306843 202
24 3300025961 Ga0207712_10041201 Ga0207712_100412013 202
25 3300027907 Ga0207428_10484116 Ga0207428_104841161 202
26 3300005445 Ga0070708_100332703 Ga0070708_1003327032 206
27 3300049824 Ga0501045_0157868 Ga0501045_0157868_454_1104 206
28 3300049575 Ga0501039_0307897 Ga0501039_0307897_409_1068 209
29 3300049576 Ga0501040_0037381 Ga0501040_0037381_1674_2333 209
30 3300049578 Ga0501042_0523579 Ga0501042_0523579_169_828 209
31 3300049580 Ga0501046_0225506 Ga0501046_0225506_436_1095 209
32 3300049591 Ga0501075_0028160 Ga0501075_0028160_2170_2829 209
33 3300049592 Ga0501076_0021628 Ga0501076_0021628_2603_3262 209
34 3300060353 Ga0501082_0148171 Ga0501082_0148171_806_1465 209
35 3300005293 Ga0065715_10296995 Ga0065715_102969951 211
36 3300005334 Ga0068869_100121910 Ga0068869_1001219103 211
37 3300005340 Ga0070689_100001026 Ga0070689_1000010262 211
38 3300005340 Ga0070689_100201105 Ga0070689_1002011052 211
39 3300005340 Ga0070689_100719447 Ga0070689_1007194472 211
40 3300005364 Ga0070673_100088189 Ga0070673_1000881892 211
41 3300005459 Ga0068867_100047466 Ga0068867_1000474662 211
42 3300005459 Ga0068867_100118094 Ga0068867_1001180942 211
43 3300005467 Ga0070706_100556577 Ga0070706_1005565771 211
44 3300005543 Ga0070672_100000377 Ga0070672_10000037726 211
45 3300005547 Ga0070693_100046269 Ga0070693_1000462692 211
46 3300005618 Ga0068864_100000103 Ga0068864_10000010363 211
47 3300005842 Ga0068858_100003612 Ga0068858_1000036123 211
48 3300006028 Ga0070717_10000085 Ga0070717_1000008534 211
49 3300006173 Ga0070716_100008169 Ga0070716_1000081692 211
50 3300006358 Ga0068871_100713322 Ga0068871_1007133222 211
51 3300009098 Ga0105245_10000197 Ga0105245_1000019762 211
52 3300010375 Ga0105239_10033584 Ga0105239_100335846 211
53 3300013102 Ga0157371_10258152 Ga0157371_102581522 211
54 3300013297 Ga0157378_10007716 Ga0157378_100077169 211
55 3300013308 Ga0157375_10000055 Ga0157375_100000553 211
56 3300014326 Ga0157380_10022872 Ga0157380_100228727 211
57 3300014745 Ga0157377_10000129 Ga0157377_1000012925 211
58 3300014745 Ga0157377_10132146 Ga0157377_101321462 211
59 3300014969 Ga0157376_10315935 Ga0157376_103159352 211
60 3300021384 Ga0213876_10002777 Ga0213876_100027777 211
61 3300025910 Ga0207684_10097188 Ga0207684_100971884 211
62 3300025910 Ga0207684_10709280 Ga0207684_107092801 211
63 3300025913 Ga0207695_10012508 Ga0207695_1001250811 211
64 3300025927 Ga0207687_10000438 Ga0207687_1000043817 211
65 3300025931 Ga0207644_10408291 Ga0207644_104082912 211
66 3300025936 Ga0207670_10000713 Ga0207670_1000071317 211
67 3300025936 Ga0207670_10333476 Ga0207670_103334762 211
68 3300025936 Ga0207670_10429625 Ga0207670_104296252 211
69 3300025938 Ga0207704_10236903 Ga0207704_102369032 211
70 3300025939 Ga0207665_10020525 Ga0207665_100205252 211
71 3300025940 Ga0207691_10000782 Ga0207691_1000078213 211
72 3300025942 Ga0207689_10349612 Ga0207689_103496122 211
73 3300025960 Ga0207651_10069418 Ga0207651_100694182 211
74 3300026035 Ga0207703_10008543 Ga0207703_100085434 211
75 3300026041 Ga0207639_10000118 Ga0207639_1000011856 211
76 3300026089 Ga0207648_10064149 Ga0207648_100641492 211
77 3300026095 Ga0207676_10000023 Ga0207676_1000002364 211
78 3300035112 Ga0373932_0000109 Ga0373932_0000109_8105_8752 211
79 3300035170 Ga0373943_0030662 Ga0373943_0030662_700_1347 211
80 3300035725 Ga0373947_0469667 Ga0373947_0469667_139_786 211
81 3300039437 Ga0436365_0302944 Ga0436365_0302944_6769_7416 211
82 3300039450 Ga0436363_1149248 Ga0436363_1149248_44_691 211
83 3300013297 Ga0157378_10022713 Ga0157378_100227134 212
84 3300031240 Ga0265320_10137160 Ga0265320_101371602 212
85 3300041408 Ga0439453_0029461 Ga0439453_0029461_124_774 212
86 3300005328 Ga0070676_10397364 Ga0070676_103973641 213
87 3300005364 Ga0070673_100339261 Ga0070673_1003392611 213
88 3300005719 Ga0068861_100157170 Ga0068861_1001571702 213
89 3300005844 Ga0068862_100010364 Ga0068862_1000103642 213
90 3300006852 Ga0075433_10056089 Ga0075433_100560892 213
91 3300006871 Ga0075434_100047741 Ga0075434_1000477413 213
92 3300006871 Ga0075434_100387258 Ga0075434_1003872581 213
93 3300006914 Ga0075436_100033223 Ga0075436_1000332231 213
94 3300007076 Ga0075435_100207770 Ga0075435_1002077702 213
95 3300013308 Ga0157375_10466079 Ga0157375_104660792 213
96 3300025903 Ga0207680_10322774 Ga0207680_103227742 213
97 3300025923 Ga0207681_10000044 Ga0207681_1000004425 213
98 3300028380 Ga0268265_10000973 Ga0268265_1000097310 213
99 3300031616 Ga0307508_10008339 Ga0307508_100083399 213
100 3300035085 Ga0373929_0000007 Ga0373929_0000007_308942_309658 213
101 3300035692 Ga0373935_0000591 Ga0373935_0000591_13397_14053 213
102 3300042876 Ga0451577_0081593 Ga0451577_0081593_637_1293 213
103 3300044712 Ga0453684_0074668 Ga0453684_0074668_3346_4002 213
104 3300046472 Ga0495580_0545515 Ga0495580_0545515_23_670 213
105 3300048908 Ga0496105_0041841 Ga0496105_0041841_1661_2317 213
106 3300048917 Ga0496114_0000031 Ga0496114_0000031_130901_131557 213
107 3300049582 Ga0501048_0116121 Ga0501048_0116121_500_1156 213
108 3300049583 Ga0501067_0171987 Ga0501067_0171987_121_777 213
109 3300049584 Ga0501068_0565983 Ga0501068_0565983_25_681 213
110 3300049591 Ga0501075_0011141 Ga0501075_0011141_4803_5459 213
111 3300049592 Ga0501076_0303225 Ga0501076_0303225_11_667 213
112 3300049593 Ga0501077_0009094 Ga0501077_0009094_1371_2027 213
113 3300049742 Ga0501080_0248387 Ga0501080_0248387_911_1567 213
114 3300049743 Ga0501081_0218826 Ga0501081_0218826_55_711 213
115 3300050512 nmdc:mga0n895_12148_c1 nmdc:mga0n895_12148_c1_6931_7587 213
116 3300050512 nmdc:mga0n895_247176_c1 nmdc:mga0n895_247176_c1_768_1424 213
117 3300050513 nmdc:mga0rr50_109764_c1 nmdc:mga0rr50_109764_c1_644_1300 213
118 3300050514 nmdc:mga08x19_22603_c1 nmdc:mga08x19_22603_c1_235_891 213
119 3300050514 nmdc:mga08x19_312488_c1 nmdc:mga08x19_312488_c1_221_877 213
120 3300050514 nmdc:mga08x19_31299_c1 nmdc:mga08x19_31299_c1_235_891 213
121 3300050515 nmdc:mga0a205_24529_c1 nmdc:mga0a205_24529_c1_1534_2190 213
122 3300060353 Ga0501082_0000325 Ga0501082_0000325_40067_40723 213
123 3300005338 Ga0068868_100483542 Ga0068868_1004835421 214
124 3300005353 Ga0070669_100000204 Ga0070669_10000020430 214
125 3300005353 Ga0070669_100047640 Ga0070669_1000476402 214
126 3300005459 Ga0068867_100042301 Ga0068867_1000423012 214
127 3300005843 Ga0068860_100489210 Ga0068860_1004892102 214
128 3300005985 Ga0081539_10088914 Ga0081539_100889142 214
129 3300006237 Ga0097621_100339302 Ga0097621_1003393022 214
130 3300006237 Ga0097621_100448379 Ga0097621_1004483792 214
131 3300006846 Ga0075430_100032876 Ga0075430_1000328762 214
132 3300006847 Ga0075431_100537042 Ga0075431_1005370422 214
133 3300006871 Ga0075434_100255478 Ga0075434_1002554781 214
134 3300006880 Ga0075429_100192861 Ga0075429_1001928612 214
135 3300006880 Ga0075429_100535021 Ga0075429_1005350212 214
136 3300009094 Ga0111539_10002531 Ga0111539_100025312 214
137 3300009177 Ga0105248_10510942 Ga0105248_105109422 214
138 3300009553 Ga0105249_10200372 Ga0105249_102003722 214
139 3300013104 Ga0157370_10156992 Ga0157370_101569923 214
140 3300025926 Ga0207659_10851328 Ga0207659_108513281 214
141 3300025961 Ga0207712_10948942 Ga0207712_109489421 214
142 3300026023 Ga0207677_10430755 Ga0207677_104307551 214
143 3300026089 Ga0207648_10068021 Ga0207648_100680212 214
144 3300027907 Ga0207428_10209144 Ga0207428_102091442 214
145 3300028381 Ga0268264_10524289 Ga0268264_105242891 214
146 3300031548 Ga0307408_100164665 Ga0307408_1001646652 214
147 3300031731 Ga0307405_10290290 Ga0307405_102902902 214
148 3300031903 Ga0307407_10471380 Ga0307407_104713802 214
149 3300031995 Ga0307409_100116575 Ga0307409_1001165753 214
150 3300032002 Ga0307416_100083906 Ga0307416_1000839063 214
151 3300032126 Ga0307415_100801265 Ga0307415_1008012652 214
152 3300037853 Ga0436364_1222727 Ga0436364_1222727_6323_6982 214
153 3300042156 Ga0439446_0024602 Ga0439446_0024602_913_1566 214
154 3300048917 Ga0496114_0107733 Ga0496114_0107733_297_956 214
155 3300049568 Ga0501031_0001183 Ga0501031_0001183_4854_5513 214
156 3300049568 Ga0501031_0001190 Ga0501031_0001190_4793_5452 214
157 3300049568 Ga0501031_0255586 Ga0501031_0255586_24_683 214
158 3300049569 Ga0501032_0004343 Ga0501032_0004343_70_729 214
159 3300049569 Ga0501032_0113003 Ga0501032_0113003_475_1134 214
160 3300049569 Ga0501032_0143255 Ga0501032_0143255_878_1537 214
161 3300049570 Ga0501033_0102506 Ga0501033_0102506_1359_2018 214
162 3300049570 Ga0501033_0118091 Ga0501033_0118091_793_1452 214
163 3300049570 Ga0501033_0149397 Ga0501033_0149397_208_867 214
164 3300049571 Ga0501034_0012290 Ga0501034_0012290_48_707 214
165 3300049571 Ga0501034_0043515 Ga0501034_0043515_2415_3074 214
166 3300049571 Ga0501034_0171517 Ga0501034_0171517_71_730 214
167 3300049571 Ga0501034_0257964 Ga0501034_0257964_486_1145 214
168 3300049571 Ga0501034_0306193 Ga0501034_0306193_530_1189 214
169 3300049572 Ga0501036_0022584 Ga0501036_0022584_3182_3841 214
170 3300049572 Ga0501036_0027980 Ga0501036_0027980_22_681 214
171 3300049572 Ga0501036_0122262 Ga0501036_0122262_1498_2157 214
172 3300049572 Ga0501036_0294322 Ga0501036_0294322_313_972 214
173 3300049572 Ga0501036_0525889 Ga0501036_0525889_288_947 214
174 3300049573 Ga0501037_0005122 Ga0501037_0005122_8805_9464 214
175 3300049573 Ga0501037_0014483 Ga0501037_0014483_1049_1708 214
176 3300049573 Ga0501037_0098698 Ga0501037_0098698_44_703 214
177 3300049573 Ga0501037_0117646 Ga0501037_0117646_1225_1884 214
178 3300049574 Ga0501038_0004539 Ga0501038_0004539_12229_12888 214
179 3300049574 Ga0501038_0009083 Ga0501038_0009083_8396_9055 214
180 3300049574 Ga0501038_0184001 Ga0501038_0184001_842_1501 214
181 3300049574 Ga0501038_0528365 Ga0501038_0528365_70_729 214
182 3300049575 Ga0501039_0015360 Ga0501039_0015360_1683_2342 214
183 3300049575 Ga0501039_0046168 Ga0501039_0046168_1169_1828 214
184 3300049575 Ga0501039_0836537 Ga0501039_0836537_35_694 214
185 3300049576 Ga0501040_0154341 Ga0501040_0154341_712_1371 214
186 3300049578 Ga0501042_0026348 Ga0501042_0026348_1901_2560 214
187 3300049578 Ga0501042_0081135 Ga0501042_0081135_776_1435 214
188 3300049578 Ga0501042_0394607 Ga0501042_0394607_24_683 214
189 3300049579 Ga0501043_0004096 Ga0501043_0004096_9504_10163 214
190 3300049579 Ga0501043_0004714 Ga0501043_0004714_1970_2629 214
191 3300049579 Ga0501043_0023942 Ga0501043_0023942_3317_3976 214
192 3300049579 Ga0501043_0035802 Ga0501043_0035802_1038_1697 214
193 3300049579 Ga0501043_0091942 Ga0501043_0091942_793_1452 214
194 3300049580 Ga0501046_0003842 Ga0501046_0003842_2073_2732 214
195 3300049580 Ga0501046_0020286 Ga0501046_0020286_1852_2511 214
196 3300049580 Ga0501046_0043392 Ga0501046_0043392_2264_2923 214
197 3300049580 Ga0501046_0044537 Ga0501046_0044537_1687_2346 214
198 3300049580 Ga0501046_0116864 Ga0501046_0116864_1108_1767 214
199 3300049580 Ga0501046_0350469 Ga0501046_0350469_105_764 214
200 3300049581 Ga0501047_0009933 Ga0501047_0009933_1150_1809 214
201 3300049581 Ga0501047_0016447 Ga0501047_0016447_5991_6650 214
202 3300049581 Ga0501047_0031197 Ga0501047_0031197_4412_5071 214
203 3300049581 Ga0501047_0063863 Ga0501047_0063863_127_786 214
204 3300049581 Ga0501047_0102423 Ga0501047_0102423_1691_2350 214
205 3300049581 Ga0501047_0122486 Ga0501047_0122486_143_802 214
206 3300049582 Ga0501048_0005757 Ga0501048_0005757_258_917 214
207 3300049582 Ga0501048_0010673 Ga0501048_0010673_6131_6790 214
208 3300049582 Ga0501048_0017460 Ga0501048_0017460_3597_4256 214
209 3300049582 Ga0501048_0053291 Ga0501048_0053291_401_1060 214
210 3300049582 Ga0501048_0100888 Ga0501048_0100888_951_1610 214
211 3300049583 Ga0501067_0001823 Ga0501067_0001823_10815_11474 214
212 3300049583 Ga0501067_0012492 Ga0501067_0012492_1314_1973 214
213 3300049583 Ga0501067_0082157 Ga0501067_0082157_851_1510 214
214 3300049584 Ga0501068_0001010 Ga0501068_0001010_1406_2065 214
215 3300049584 Ga0501068_0001517 Ga0501068_0001517_9843_10502 214
216 3300049585 Ga0501069_0000216 Ga0501069_0000216_12476_13135 214
217 3300049585 Ga0501069_0002540 Ga0501069_0002540_256_915 214
218 3300049585 Ga0501069_0065646 Ga0501069_0065646_704_1363 214
219 3300049585 Ga0501069_0399309 Ga0501069_0399309_140_799 214
220 3300049586 Ga0501070_0012415 Ga0501070_0012415_940_1599 214
221 3300049586 Ga0501070_0085552 Ga0501070_0085552_1234_1893 214
222 3300049586 Ga0501070_0092709 Ga0501070_0092709_1525_2184 214
223 3300049586 Ga0501070_0106693 Ga0501070_0106693_477_1136 214
224 3300049586 Ga0501070_0110718 Ga0501070_0110718_329_988 214
225 3300049587 Ga0501071_0039220 Ga0501071_0039220_2284_2943 214
226 3300049587 Ga0501071_0188302 Ga0501071_0188302_869_1528 214
227 3300049587 Ga0501071_0382276 Ga0501071_0382276_369_1028 214
228 3300049587 Ga0501071_0448720 Ga0501071_0448720_196_855 214
229 3300049588 Ga0501072_0056176 Ga0501072_0056176_66_725 214
230 3300049588 Ga0501072_0250702 Ga0501072_0250702_113_772 214
231 3300049588 Ga0501072_0374112 Ga0501072_0374112_226_885 214
232 3300049589 Ga0501073_0002939 Ga0501073_0002939_10621_11280 214
233 3300049589 Ga0501073_0005121 Ga0501073_0005121_70_729 214
234 3300049589 Ga0501073_0019205 Ga0501073_0019205_2843_3502 214
235 3300049589 Ga0501073_0052424 Ga0501073_0052424_592_1251 214
236 3300049589 Ga0501073_0258933 Ga0501073_0258933_505_1164 214
237 3300049590 Ga0501074_0000433 Ga0501074_0000433_11466_12125 214
238 3300049590 Ga0501074_0111283 Ga0501074_0111283_496_1155 214
239 3300049590 Ga0501074_0183223 Ga0501074_0183223_820_1479 214
240 3300049590 Ga0501074_0598770 Ga0501074_0598770_79_738 214
241 3300049591 Ga0501075_0163203 Ga0501075_0163203_777_1436 214
242 3300049592 Ga0501076_0040623 Ga0501076_0040623_2545_3204 214
243 3300049592 Ga0501076_0058028 Ga0501076_0058028_2399_3058 214
244 3300049592 Ga0501076_0322259 Ga0501076_0322259_178_837 214
245 3300049741 Ga0501079_0010714 Ga0501079_0010714_143_802 214
246 3300049741 Ga0501079_0068041 Ga0501079_0068041_1425_2084 214
247 3300049741 Ga0501079_0182131 Ga0501079_0182131_71_730 214
248 3300049741 Ga0501079_0248346 Ga0501079_0248346_34_693 214
249 3300049742 Ga0501080_0004916 Ga0501080_0004916_9446_10105 214
250 3300049742 Ga0501080_0138013 Ga0501080_0138013_663_1322 214
251 3300049742 Ga0501080_0295690 Ga0501080_0295690_367_1026 214
252 3300049743 Ga0501081_0261674 Ga0501081_0261674_83_742 214
253 3300049744 Ga0501083_0002660 Ga0501083_0002660_2766_3425 214
254 3300049744 Ga0501083_0008054 Ga0501083_0008054_5588_6247 214
255 3300049744 Ga0501083_0016765 Ga0501083_0016765_2673_3332 214
256 3300049744 Ga0501083_0019371 Ga0501083_0019371_1219_1878 214
257 3300049822 Ga0501035_0004668 Ga0501035_0004668_11083_11742 214
258 3300049822 Ga0501035_0015543 Ga0501035_0015543_2741_3400 214
259 3300049822 Ga0501035_0153045 Ga0501035_0153045_63_722 214
260 3300049823 Ga0501044_0007986 Ga0501044_0007986_7123_7782 214
261 3300049823 Ga0501044_0010566 Ga0501044_0010566_9120_9779 214
262 3300049823 Ga0501044_0183438 Ga0501044_0183438_70_729 214
263 3300049823 Ga0501044_0373734 Ga0501044_0373734_239_898 214
264 3300049824 Ga0501045_0149462 Ga0501045_0149462_1010_1669 214
265 3300049824 Ga0501045_0197364 Ga0501045_0197364_418_1077 214
266 3300050510 nmdc:mga06r32_181522_c1 nmdc:mga06r32_181522_c1_479_1135 214
267 3300050511 nmdc:mga08y16_34492_c1 nmdc:mga08y16_34492_c1_1503_2162 214
268 3300050511 nmdc:mga08y16_654565_c1 nmdc:mga08y16_654565_c1_250_915 214
269 3300050512 nmdc:mga0n895_1100158_c1 nmdc:mga0n895_1100158_c1_54_713 214
270 3300050512 nmdc:mga0n895_88618_c1 nmdc:mga0n895_88618_c1_1266_1925 214
271 3300054114 Ga0501084_0003896 Ga0501084_0003896_3074_3733 214
272 3300054114 Ga0501084_0005648 Ga0501084_0005648_9465_10124 214
273 3300054114 Ga0501084_0126184 Ga0501084_0126184_708_1367 214
274 3300054114 Ga0501084_0228747 Ga0501084_0228747_49_708 214
275 3300060353 Ga0501082_0004480 Ga0501082_0004480_10621_11280 214
276 3300060353 Ga0501082_0012451 Ga0501082_0012451_5992_6651 214
277 3300060353 Ga0501082_0023808 Ga0501082_0023808_413_1072 214
278 3300060353 Ga0501082_0072535 Ga0501082_0072535_2123_2782 214
279 3300060353 Ga0501082_0135294 Ga0501082_0135294_725_1384 214
280 3300060353 Ga0501082_0259194 Ga0501082_0259194_662_1321 214
281 3300061734 Ga0530510_0212359 Ga0530510_0212359_259_918 214
282 3300025926 Ga0207659_10458552 Ga0207659_104585522 215
283 3300031901 Ga0307406_10238679 Ga0307406_102386792 215
284 3300031995 Ga0307409_100120658 Ga0307409_1001206582 215
285 3300032004 Ga0307414_10081139 Ga0307414_100811392 215
286 3300050510 nmdc:mga06r32_346778_c1 nmdc:mga06r32_346778_c1_124_786 215
287 3300005289 Ga0065704_10303023 Ga0065704_103030231 216
288 3300005295 Ga0065707_10237816 Ga0065707_102378161 216
289 3300005328 Ga0070676_10004427 Ga0070676_100044276 216
290 3300005330 Ga0070690_100001847 Ga0070690_10000184710 216
291 3300005330 Ga0070690_100172214 Ga0070690_1001722142 216
292 3300005330 Ga0070690_100251981 Ga0070690_1002519812 216
293 3300005331 Ga0070670_100244085 Ga0070670_1002440852 216
294 3300005333 Ga0070677_10040692 Ga0070677_100406923 216
295 3300005333 Ga0070677_10069726 Ga0070677_100697262 216
296 3300005334 Ga0068869_100003009 Ga0068869_1000030095 216
297 3300005335 Ga0070666_10020274 Ga0070666_100202743 216
298 3300005338 Ga0068868_100131885 Ga0068868_1001318852 216
299 3300005340 Ga0070689_100012981 Ga0070689_1000129813 216
300 3300005340 Ga0070689_100246987 Ga0070689_1002469872 216
301 3300005343 Ga0070687_100019141 Ga0070687_1000191412 216
302 3300005347 Ga0070668_100282806 Ga0070668_1002828062 216
303 3300005353 Ga0070669_100001921 Ga0070669_1000019216 216
304 3300005353 Ga0070669_100153753 Ga0070669_1001537532 216
305 3300005354 Ga0070675_100000792 Ga0070675_1000007922 216
306 3300005354 Ga0070675_100002457 Ga0070675_10000245713 216
307 3300005354 Ga0070675_100017840 Ga0070675_1000178402 216
308 3300005354 Ga0070675_100660296 Ga0070675_1006602962 216
309 3300005355 Ga0070671_100012074 Ga0070671_10001207410 216
310 3300005356 Ga0070674_100223550 Ga0070674_1002235501 216
311 3300005356 Ga0070674_100283767 Ga0070674_1002837671 216
312 3300005364 Ga0070673_100001253 Ga0070673_10000125314 216
313 3300005365 Ga0070688_100005362 Ga0070688_1000053622 216
314 3300005365 Ga0070688_100027813 Ga0070688_1000278132 216
315 3300005367 Ga0070667_100124283 Ga0070667_1001242832 216
316 3300005438 Ga0070701_10385147 Ga0070701_103851471 216
317 3300005441 Ga0070700_100002155 Ga0070700_1000021559 216
318 3300005441 Ga0070700_100610795 Ga0070700_1006107951 216
319 3300005456 Ga0070678_100093947 Ga0070678_1000939472 216
320 3300005457 Ga0070662_100021258 Ga0070662_1000212583 216
321 3300005457 Ga0070662_100187738 Ga0070662_1001877381 216
322 3300005466 Ga0070685_10316989 Ga0070685_103169891 216
323 3300005471 Ga0070698_100768551 Ga0070698_1007685511 216
324 3300005543 Ga0070672_100000166 Ga0070672_1000001662 216
325 3300005543 Ga0070672_100005035 Ga0070672_1000050359 216
326 3300005544 Ga0070686_100057140 Ga0070686_1000571403 216
327 3300005545 Ga0070695_100637872 Ga0070695_1006378721 216
328 3300005548 Ga0070665_101246628 Ga0070665_1012466281 216
329 3300005564 Ga0070664_100685925 Ga0070664_1006859252 216
330 3300005615 Ga0070702_100336631 Ga0070702_1003366312 216
331 3300005617 Ga0068859_100024990 Ga0068859_1000249902 216
332 3300005617 Ga0068859_100143105 Ga0068859_1001431052 216
333 3300005618 Ga0068864_100167229 Ga0068864_1001672292 216
334 3300005718 Ga0068866_10074339 Ga0068866_100743392 216
335 3300005718 Ga0068866_10286939 Ga0068866_102869391 216
336 3300005719 Ga0068861_100017558 Ga0068861_1000175582 216
337 3300005834 Ga0068851_10083905 Ga0068851_100839052 216
338 3300005840 Ga0068870_10000136 Ga0068870_1000013610 216
339 3300005841 Ga0068863_100217597 Ga0068863_1002175973 216
340 3300005842 Ga0068858_100043606 Ga0068858_1000436062 216
341 3300005842 Ga0068858_100250184 Ga0068858_1002501842 216
342 3300005842 Ga0068858_100813936 Ga0068858_1008139361 216
343 3300005843 Ga0068860_100021753 Ga0068860_1000217539 216
344 3300005843 Ga0068860_100394869 Ga0068860_1003948692 216
345 3300005844 Ga0068862_100002024 Ga0068862_10000202413 216
346 3300006358 Ga0068871_100239846 Ga0068871_1002398462 216
347 3300006358 Ga0068871_100526082 Ga0068871_1005260822 216
348 3300006844 Ga0075428_100086622 Ga0075428_1000866222 216
349 3300006847 Ga0075431_100028000 Ga0075431_1000280002 216
350 3300006852 Ga0075433_10000481 Ga0075433_1000048121 216
351 3300006852 Ga0075433_10163807 Ga0075433_101638073 216
352 3300006871 Ga0075434_100003939 Ga0075434_10000393914 216
353 3300006880 Ga0075429_100151566 Ga0075429_1001515662 216
354 3300006881 Ga0068865_100006527 Ga0068865_1000065272 216
355 3300006881 Ga0068865_100036383 Ga0068865_1000363832 216
356 3300006931 Ga0097620_100024991 Ga0097620_1000249914 216
357 3300006931 Ga0097620_100044246 Ga0097620_1000442464 216
358 3300006931 Ga0097620_100143099 Ga0097620_1001430993 216
359 3300007076 Ga0075435_100036163 Ga0075435_1000361632 216
360 3300009094 Ga0111539_10001618 Ga0111539_100016184 216
361 3300009094 Ga0111539_10010349 Ga0111539_100103492 216
362 3300009094 Ga0111539_10015487 Ga0111539_100154872 216
363 3300009094 Ga0111539_10018366 Ga0111539_100183662 216
364 3300009094 Ga0111539_10166497 Ga0111539_101664972 216
365 3300009094 Ga0111539_10512224 Ga0111539_105122242 216
366 3300009098 Ga0105245_10477248 Ga0105245_104772481 216
367 3300009098 Ga0105245_10656295 Ga0105245_106562951 216
368 3300009101 Ga0105247_10225770 Ga0105247_102257702 216
369 3300009147 Ga0114129_10003254 Ga0114129_1000325410 216
370 3300009147 Ga0114129_10009517 Ga0114129_1000951710 216
371 3300009177 Ga0105248_10031430 Ga0105248_100314302 216
372 3300009177 Ga0105248_10158636 Ga0105248_101586363 216
373 3300009177 Ga0105248_10231299 Ga0105248_102312993 216
374 3300009551 Ga0105238_10006933 Ga0105238_100069332 216
375 3300009553 Ga0105249_10003075 Ga0105249_100030752 216
376 3300009553 Ga0105249_10129266 Ga0105249_101292662 216
377 3300009553 Ga0105249_10436605 Ga0105249_104366052 216
378 3300011119 Ga0105246_10005224 Ga0105246_100052241 216
379 3300013102 Ga0157371_10378177 Ga0157371_103781772 216
380 3300013306 Ga0163162_10092151 Ga0163162_100921512 216
381 3300013306 Ga0163162_11085619 Ga0163162_110856191 216
382 3300013308 Ga0157375_10766785 Ga0157375_107667852 216
383 3300014325 Ga0163163_10000036 Ga0163163_100000364 216
384 3300014325 Ga0163163_10033269 Ga0163163_100332697 216
385 3300014326 Ga0157380_10031216 Ga0157380_100312162 216
386 3300014326 Ga0157380_10054507 Ga0157380_100545073 216
387 3300014326 Ga0157380_10122012 Ga0157380_101220121 216
388 3300014745 Ga0157377_10377545 Ga0157377_103775451 216
389 3300014968 Ga0157379_10635560 Ga0157379_106355601 216
390 3300014969 Ga0157376_10579745 Ga0157376_105797451 216
391 3300025315 Ga0207697_10008801 Ga0207697_100088011 216
392 3300025893 Ga0207682_10000719 Ga0207682_100007192 216
393 3300025893 Ga0207682_10042166 Ga0207682_100421662 216
394 3300025893 Ga0207682_10150837 Ga0207682_101508372 216
395 3300025901 Ga0207688_10007346 Ga0207688_100073464 216
396 3300025903 Ga0207680_10028203 Ga0207680_100282031 216
397 3300025903 Ga0207680_10309423 Ga0207680_103094231 216
398 3300025907 Ga0207645_10015529 Ga0207645_100155293 216
399 3300025907 Ga0207645_10029155 Ga0207645_100291556 216
400 3300025908 Ga0207643_10000507 Ga0207643_1000050721 216
401 3300025908 Ga0207643_10213109 Ga0207643_102131092 216
402 3300025918 Ga0207662_10032012 Ga0207662_100320122 216
403 3300025918 Ga0207662_10063488 Ga0207662_100634881 216
404 3300025919 Ga0207657_10776527 Ga0207657_107765271 216
405 3300025923 Ga0207681_10002712 Ga0207681_100027121 216
406 3300025923 Ga0207681_10370114 Ga0207681_103701141 216
407 3300025924 Ga0207694_10460187 Ga0207694_104601872 216
408 3300025925 Ga0207650_10184095 Ga0207650_101840952 216
409 3300025926 Ga0207659_10005272 Ga0207659_100052726 216
410 3300025926 Ga0207659_10005315 Ga0207659_100053159 216
411 3300025926 Ga0207659_10341435 Ga0207659_103414352 216
412 3300025931 Ga0207644_10037133 Ga0207644_100371332 216
413 3300025933 Ga0207706_10005693 Ga0207706_1000569310 216
414 3300025933 Ga0207706_10124291 Ga0207706_101242912 216
415 3300025934 Ga0207686_10013548 Ga0207686_100135483 216
416 3300025935 Ga0207709_10050331 Ga0207709_100503312 216
417 3300025936 Ga0207670_10162242 Ga0207670_101622422 216
418 3300025936 Ga0207670_10204070 Ga0207670_102040702 216
419 3300025936 Ga0207670_10297795 Ga0207670_102977952 216
420 3300025937 Ga0207669_10060168 Ga0207669_100601681 216
421 3300025938 Ga0207704_10002954 Ga0207704_100029542 216
422 3300025938 Ga0207704_10022859 Ga0207704_100228592 216
423 3300025940 Ga0207691_10017673 Ga0207691_100176735 216
424 3300025940 Ga0207691_10083337 Ga0207691_100833372 216
425 3300025940 Ga0207691_10189898 Ga0207691_101898983 216
426 3300025940 Ga0207691_10192204 Ga0207691_101922042 216
427 3300025941 Ga0207711_10019915 Ga0207711_100199153 216
428 3300025942 Ga0207689_10002833 Ga0207689_1000283313 216
429 3300025942 Ga0207689_10023937 Ga0207689_100239377 216
430 3300025942 Ga0207689_10275166 Ga0207689_102751661 216
431 3300025945 Ga0207679_10305103 Ga0207679_103051032 216
432 3300025960 Ga0207651_10114761 Ga0207651_101147612 216
433 3300025961 Ga0207712_10008085 Ga0207712_100080852 216
434 3300025961 Ga0207712_10368034 Ga0207712_103680342 216
435 3300025961 Ga0207712_10480682 Ga0207712_104806822 216
436 3300025981 Ga0207640_10181153 Ga0207640_101811532 216
437 3300026023 Ga0207677_10071022 Ga0207677_100710222 216
438 3300026035 Ga0207703_10011194 Ga0207703_100111946 216
439 3300026067 Ga0207678_10030476 Ga0207678_100304762 216
440 3300026088 Ga0207641_10215348 Ga0207641_102153483 216
441 3300026088 Ga0207641_10410419 Ga0207641_104104192 216
442 3300026089 Ga0207648_10000493 Ga0207648_1000049312 216
443 3300026095 Ga0207676_10087149 Ga0207676_100871492 216
444 3300026095 Ga0207676_10155631 Ga0207676_101556313 216
445 3300026118 Ga0207675_100086303 Ga0207675_1000863036 216
446 3300026121 Ga0207683_10059425 Ga0207683_100594252 216
447 3300027665 Ga0209983_1035992 Ga0209983_10359921 216
448 3300027907 Ga0207428_10000568 Ga0207428_1000056828 216
449 3300027907 Ga0207428_10004803 Ga0207428_100048034 216
450 3300027907 Ga0207428_10039098 Ga0207428_100390982 216
451 3300027907 Ga0207428_10232609 Ga0207428_102326092 216
452 3300028380 Ga0268265_10006037 Ga0268265_100060372 216
453 3300028381 Ga0268264_10021243 Ga0268264_100212432 216
454 3300028381 Ga0268264_10217561 Ga0268264_102175612 216
455 3300028381 Ga0268264_10840106 Ga0268264_108401061 216
456 3300028381 Ga0268264_10875544 Ga0268264_108755441 216
457 3300031548 Ga0307408_100146533 Ga0307408_1001465332 216
458 3300031824 Ga0307413_10125893 Ga0307413_101258932 216
459 3300031903 Ga0307407_10016839 Ga0307407_100168392 216
460 3300031995 Ga0307409_100096252 Ga0307409_1000962522 216
461 3300032002 Ga0307416_100333149 Ga0307416_1003331492 216
462 3300034957 Ga0373938_0013981 Ga0373938_0013981_585_1235 216
463 3300035086 Ga0373934_0009716 Ga0373934_0009716_1219_1917 216
464 3300035090 Ga0373949_0007515 Ga0373949_0007515_1724_2374 216
465 3300035112 Ga0373932_0158944 Ga0373932_0158944_52_702 216
466 3300035114 Ga0373939_0013080 Ga0373939_0013080_1020_1670 216
467 3300035119 Ga0373956_0009437 Ga0373956_0009437_1265_1963 216
468 3300035121 Ga0373960_0067439 Ga0373960_0067439_233_883 216
469 3300035172 Ga0373955_0005371 Ga0373955_0005371_3455_4153 216
470 3300036401 Ga0373937_0000120 Ga0373937_0000120_10538_11236 216
471 3300042436 Ga0439435_0011963 Ga0439435_0011963_665_1315 216
472 3300045051 Ga0451576_0009423 Ga0451576_0009423_5293_5943 216
473 3300045051 Ga0451576_0086600 Ga0451576_0086600_2256_2954 216
474 3300046454 Ga0495592_0222647 Ga0495592_0222647_243_944 216
475 3300046514 Ga0495618_0347217 Ga0495618_0347217_182_886 216
476 3300046517 Ga0495630_0498199 Ga0495630_0498199_26_730 216
477 3300046536 Ga0495587_0212517 Ga0495587_0212517_169_834 216
478 3300046678 Ga0495599_0090282 Ga0495599_0090282_720_1385 216
479 3300046691 Ga0495670_0146209 Ga0495670_0146209_207_857 216
480 3300050507 nmdc:mga05p37_1932_c1 nmdc:mga05p37_1932_c1_13767_14417 216
481 3300050507 nmdc:mga05p37_1_c1 nmdc:mga05p37_1_c1_24334_25032 216
482 3300050508 nmdc:mga09592_12830_c1 nmdc:mga09592_12830_c1_2577_3227 216
483 3300050509 nmdc:mga0qj67_294562_c1 nmdc:mga0qj67_294562_c1_417_1115 216
484 3300050510 nmdc:mga06r32_85895_c1 nmdc:mga06r32_85895_c1_1927_2625 216
485 3300050511 nmdc:mga08y16_31914_c1 nmdc:mga08y16_31914_c1_2300_2965 216
486 3300050511 nmdc:mga08y16_3928_c1 nmdc:mga08y16_3928_c1_10577_11287 216
487 3300050511 nmdc:mga08y16_43009_c1 nmdc:mga08y16_43009_c1_3577_4227 216
488 3300050511 nmdc:mga08y16_52679_c1 nmdc:mga08y16_52679_c1_1729_2394 216
489 3300050511 nmdc:mga08y16_63864_c1 nmdc:mga08y16_63864_c1_2688_3386 216
490 3300050512 nmdc:mga0n895_6378_c1 nmdc:mga0n895_6378_c1_909_1559 216
491 3300050513 nmdc:mga0rr50_81029_c1 nmdc:mga0rr50_81029_c1_1086_1736 216
492 3300050515 nmdc:mga0a205_1555_c1 nmdc:mga0a205_1555_c1_12363_13013 216
493 3300050515 nmdc:mga0a205_26824_c1 nmdc:mga0a205_26824_c1_3925_4623 216
494 3300053077 Ga0495601_0131855 Ga0495601_0131855_395_1093 216
495 3300053085 Ga0495619_0162780 Ga0495619_0162780_567_1265 216
496 3300059421 Ga0590071_002507 Ga0590071_002507_2280_2942 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14522

Cytochrome_C7

Cytochrome c7 and related cytochrome c

121

214

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.6882 3 216
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.6809 3 216
6f0k-assembly1.cif.gz_A alternative complex iii 0.6495 5 216
6f0k-assembly1.cif.gz_A alternative complex iii 0.6468 5 216
6btm-assembly1.cif.gz_A structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.4746 15 216
ID Description Score Start End Superfamily
5kjpA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.372 69 116 1.10.12.10
4olqF02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.3534 69 118 1.10.12.10
3qxzB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.3533 67 116 1.10.12.10
5kjpA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.3148 69 116 1.10.12.10
4olqF02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.3124 69 118 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A1I2GTL6-F1-model_v4 deleted 0.886 135 216
AF-A0A435XU15-F1-model_v4 Cytochrome C 0.8858 122 216
AF-A0A2V5XVR8-F1-model_v4 Cytochrome C 0.8828 125 216
AF-A0A2V9XUF7-F1-model_v4 Cytochrome C 0.8785 137 216
AF-A0A846FGH2-F1-model_v4 deleted 0.8723 136 216

Feature Viewer

pLDDT pTM Quality
67.7 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map