F454950

General Info

Members Datasets Scaffolds Average Seq Length
496 300 992 399

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0135122|Ga0496117_0135122_35_1381
Length 448
Sequence MANILPKGFAHVFEHGAPFPLRPEGRSIQSEIPMTESQLAPAAGATYDVAAVRRGFPALAAGAAHFDGPGGSQTPEAVARAVYDTLVGPLANRGMATLAERNAERAVVTCRAALADLLGVEPDGVIFGRSMTQNTMELARAMAKRWGPGDEVVVTRLDHDANVRPWVLAAQAVGATVRFADFDIKTGELGVDDVERVLSPATRLVAVTAASNLIGTMPDLRAISELVHAVGAWLHVDGVHYSAHVAVDVPALGADFYACSPYKFFGPHCGVTYGRPELLEALHPDKLLPATDAVPERFELGTLPYELMAGTAAAVDCLAGLAPDTAGPGATRRDRLLASMATLQAHEDRLRDRIEAGLRELPGVTLWSRAARRAPTLLATFDGQDPQELRTFLGERGINAPAGAFYAHETSRRLGLGDTGGLRIGLAPYNDDNDVDRLLAGLRAYFDR

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
103 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
120 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
121 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
225 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
227 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
228 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2508501039 Frankia saprophytica CN3 Isolate Nodule
237 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
238 2582580736 Prauserella sp. Am3 Isolate Unclassified
239 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
240 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
241 2643221615 Nocardioides sp. Root224 Isolate Unclassified
242 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
243 2643221641 Nocardioides sp. Root122 Isolate Unclassified
244 2643221647 Streptomyces sp. Root369 Isolate Unclassified
245 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
246 2643221679 Angustibacter sp. Root456 Isolate Unclassified
247 2643221711 Terrabacter sp. Root85 Isolate Unclassified
248 2687453737 Frankia sp. BMG5.36 Isolate Nodule
249 2739367898 Nocardioides sp. CF479 Isolate Unclassified
250 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
251 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
252 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
253 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
254 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
255 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
256 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
257 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
258 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
259 2808606448 Streptomyces sp. 193411 Isolate Unclassified
260 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
261 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
262 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
263 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
264 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
265 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
266 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
267 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
268 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
269 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
270 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
271 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
272 2867428634 Streptomyces sp. RP5T Isolate Unclassified
273 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
274 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
275 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
276 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
277 2919069694 Microbacterium sp. 1154 Isolate Unclassified
278 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
279 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
280 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
281 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
282 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
283 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
284 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
285 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
286 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
287 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
288 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
289 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
290 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
291 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
292 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
293 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
294 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
295 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
296 8002784119 Frankia sp. AgB1.9 Isolate Nodule
297 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
298 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
299 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
300 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.9
Metatranscriptomes 0
Isolates 13.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 7.26
Nodule 0.6
Rhizoplane 12.7
Rhizosphere 66.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0135122 3300048920 Bacteria 1487
2 rootH1_10020751 3300003323 Bacteria 7064
3 Ga0065714_10079550 3300005288 Bacteria 2507
4 Ga0070658_10004307 3300005327 Bacteria 11633
5 Ga0070683_100079583 3300005329 Bacteria 3067
6 Ga0070683_100181745 3300005329 Bacteria 1996
7 Ga0070680_100035288 3300005336 Bacteria 4037
8 Ga0070682_100012800 3300005337 Bacteria 4816
9 Ga0070682_100077048 3300005337 Bacteria 2148
10 Ga0070682_100083593 3300005337 Bacteria 2072
11 Ga0068868_100269230 3300005338 Bacteria 1439
12 Ga0070692_10036530 3300005345 Bacteria 2493
13 Ga0070688_100081488 3300005365 Bacteria 2096
14 Ga0070659_100110386 3300005366 Bacteria 2220
15 Ga0070701_10003925 3300005438 Bacteria 5945
16 Ga0070678_100030917 3300005456 Bacteria 3687
17 Ga0070678_100132139 3300005456 Bacteria 1985
18 Ga0070681_10000052 3300005458 Bacteria 81490
19 Ga0068867_100003761 3300005459 Bacteria 10680
20 Ga0068867_100045447 3300005459 Bacteria 3221
21 Ga0070685_10026623 3300005466 Bacteria 3188
22 Ga0070679_100000018 3300005530 Bacteria 127592
23 Ga0070684_100095029 3300005535 Bacteria 2655
24 Ga0070684_100134014 3300005535 Bacteria 2236
25 Ga0070672_100028305 3300005543 Bacteria 4190
26 Ga0070696_100006846 3300005546 Bacteria 7609
27 Ga0070665_100114199 3300005548 Bacteria 2703
28 Ga0070665_100214833 3300005548 Bacteria 1924
29 Ga0068857_100018636 3300005577 Bacteria 6091
30 Ga0068857_100278262 3300005577 Bacteria 1539
31 Ga0070702_100179488 3300005615 Bacteria 1384
32 Ga0068863_100000217 3300005841 Bacteria 61785
33 Ga0068863_100387590 3300005841 Bacteria 1365
34 Ga0068860_100000555 3300005843 Bacteria 45431
35 Ga0081455_10001714 3300005937 Bacteria 26533
36 Ga0081455_10009745 3300005937 Bacteria 9841
37 Ga0081539_10000356 3300005985 Bacteria 100748
38 Ga0081539_10009723 3300005985 Bacteria 7961
39 Ga0075365_10014190 3300006038 Bacteria 4788
40 Ga0075365_10024671 3300006038 Bacteria 3798
41 Ga0075365_10024872 3300006038 Bacteria 3785
42 Ga0075365_10098017 3300006038 Bacteria 2005
43 Ga0075368_10028461 3300006042 Bacteria 2159
44 Ga0075363_100000053 3300006048 Bacteria 22667
45 Ga0075363_100001099 3300006048 Bacteria 9817
46 Ga0075364_10032888 3300006051 Bacteria 3335
47 Ga0075364_10082149 3300006051 Bacteria 2131
48 Ga0075364_10141595 3300006051 Bacteria 1618
49 Ga0075367_10000880 3300006178 Bacteria 12050
50 Ga0075369_10007812 3300006186 Bacteria 4091
51 Ga0075428_100084246 3300006844 Bacteria 3469
52 Ga0075430_100084377 3300006846 Bacteria 2660
53 Ga0105245_10019929 3300009098 Bacteria 5880
54 Ga0105245_10155101 3300009098 Bacteria 2168
55 Ga0105245_10180198 3300009098 Bacteria 2018
56 Ga0105245_10206695 3300009098 Bacteria 1888
57 Ga0114129_10046054 3300009147 Bacteria 6130
58 Ga0105243_10022640 3300009148 Bacteria 4777
59 Ga0105243_10030506 3300009148 Bacteria 4151
60 Ga0105243_10151688 3300009148 Bacteria 1989
61 Ga0105249_10101535 3300009553 Bacteria 2705
62 Ga0105246_10169005 3300011119 Bacteria 1673
63 Ga0157373_10045462 3300013100 Bacteria 3134
64 Ga0157371_10136886 3300013102 Bacteria 1744
65 Ga0157369_10004538 3300013105 Bacteria 16338
66 Ga0157369_10219258 3300013105 Bacteria 1992
67 Ga0157372_10008455 3300013307 Bacteria 10926
68 Ga0157372_10148830 3300013307 Bacteria 2701
69 Ga0157372_10228628 3300013307 Bacteria 2156
70 Ga0157375_10050509 3300013308 Bacteria 4079
71 Ga0157375_10102108 3300013308 Bacteria 2952
72 Ga0157375_10195561 3300013308 Bacteria 2177
73 Ga0157375_10309328 3300013308 Bacteria 1744
74 Ga0163163_10026127 3300014325 Bacteria 5576
75 Ga0163163_10134606 3300014325 Bacteria 2512
76 Ga0163163_10356345 3300014325 Bacteria 1519
77 Ga0157380_10006310 3300014326 Bacteria 8331
78 Ga0182008_10100182 3300014497 Bacteria 1431
79 Ga0157377_10001324 3300014745 Bacteria 10608
80 Ga0157377_10085313 3300014745 Bacteria 1854
81 Ga0157379_10172857 3300014968 Bacteria 1950
82 Ga0183367_1003 3300015688 Bacteria 814276
83 Ga0163161_10006389 3300017792 Bacteria 8159
84 Ga0213876_10085180 3300021384 Bacteria 1672
85 Ga0209758_1003868 3300025297 Bacteria 13115
86 Ga0207426_1011827 3300025302 Bacteria 3303
87 Ga0207688_10001057 3300025901 Bacteria 14079
88 Ga0207647_10089399 3300025904 Bacteria 1838
89 Ga0207643_10003678 3300025908 Bacteria 8258
90 Ga0207643_10036364 3300025908 Bacteria 2761
91 Ga0207707_10000384 3300025912 Bacteria 46040
92 Ga0207660_10000616 3300025917 Bacteria 24016
93 Ga0207660_10071057 3300025917 Bacteria 2532
94 Ga0207652_10000293 3300025921 Bacteria 51659
95 Ga0207650_10139415 3300025925 Bacteria 1905
96 Ga0207687_10051618 3300025927 Bacteria 2867
97 Ga0207709_10162016 3300025935 Bacteria 1561
98 Ga0207670_10111828 3300025936 Bacteria 1970
99 Ga0207669_10093397 3300025937 Bacteria 1966
100 Ga0207661_10041793 3300025944 Bacteria 3611
101 Ga0207712_10063661 3300025961 Bacteria 2626
102 Ga0207712_10115825 3300025961 Bacteria 2018
103 Ga0207677_10104649 3300026023 Bacteria 2092
104 Ga0207678_10045506 3300026067 Bacteria 3795
105 Ga0207702_10076103 3300026078 Bacteria 2900
106 Ga0207641_10051721 3300026088 Bacteria 3479
107 Ga0207641_10053141 3300026088 Bacteria 3432
108 Ga0207648_10120886 3300026089 Bacteria 2303
109 Ga0207676_10026682 3300026095 Bacteria 4297
110 Ga0207674_10034381 3300026116 Bacteria 5299
111 Ga0207675_100065557 3300026118 Bacteria 3394
112 Ga0207675_100087892 3300026118 Bacteria 2919
113 Ga0207683_10114406 3300026121 Bacteria 2418
114 Ga0207683_10166907 3300026121 Bacteria 1992
115 Ga0207683_10177326 3300026121 Bacteria 1932
116 Ga0207698_10057928 3300026142 Bacteria 3000
117 Ga0209813_10031542 3300027866 Bacteria 1565
118 Ga0268264_10000264 3300028381 Bacteria 93499
119 Ga0307517_10005349 3300028786 Bacteria 19390
120 Ga0307511_10005998 3300030521 Bacteria 12268
121 Ga0307512_10001730 3300030522 Bacteria 29786
122 Ga0307513_10001347 3300031456 Bacteria 35489
123 Ga0307513_10024604 3300031456 Bacteria 7001
124 Ga0307509_10007456 3300031507 Bacteria 14284
125 Ga0307509_10159714 3300031507 Bacteria 2154
126 Ga0307408_100308187 3300031548 Bacteria 1329
127 Ga0307508_10010934 3300031616 Bacteria 8301
128 Ga0307508_10028249 3300031616 Bacteria 5073
129 Ga0307508_10067644 3300031616 Bacteria 3142
130 Ga0307508_10203274 3300031616 Bacteria 1581
131 Ga0316579_10002931 3300031691 Bacteria 6552
132 Ga0316579_10016079 3300031691 Bacteria 3261
133 Ga0316576_10021795 3300031727 Bacteria 4438
134 Ga0316576_10113137 3300031727 Bacteria 2035
135 Ga0316576_10150635 3300031727 Bacteria 1752
136 Ga0316578_10003143 3300031728 Bacteria 7464
137 Ga0307516_10037527 3300031730 Bacteria 4842
138 Ga0307413_10001057 3300031824 Bacteria 10006
139 Ga0307413_10054720 3300031824 Bacteria 2423
140 Ga0307518_10110713 3300031838 Bacteria 1956
141 Ga0307518_10111017 3300031838 Bacteria 1953
142 Ga0307410_10045845 3300031852 Bacteria 2914
143 Ga0307410_10048064 3300031852 Bacteria 2855
144 Ga0307410_10111087 3300031852 Bacteria 1983
145 Ga0307406_10040265 3300031901 Bacteria 2905
146 Ga0307407_10008102 3300031903 Bacteria 4800
147 Ga0307409_100004442 3300031995 Bacteria 7878
148 Ga0307409_100011366 3300031995 Bacteria 5607
149 Ga0307409_100308780 3300031995 Bacteria 1475
150 Ga0307409_100392331 3300031995 Bacteria 1323
151 Ga0307416_100029654 3300032002 Bacteria 4091
152 Ga0307414_10012924 3300032004 Bacteria 4957
153 Ga0307411_10024830 3300032005 Bacteria 3580
154 Ga0307411_10242558 3300032005 Bacteria 1412
155 Ga0307415_100003500 3300032126 Bacteria 8001
156 Ga0307415_100008777 3300032126 Bacteria 5626
157 Ga0307415_100024880 3300032126 Bacteria 3748
158 Ga0307415_100127598 3300032126 Bacteria 1920
159 Ga0307415_100221190 3300032126 Bacteria 1518
160 Ga0316580_10032496 3300032139 Bacteria 1616
161 Ga0307507_10015555 3300033179 Bacteria 8937
162 Ga0307507_10040426 3300033179 Bacteria 4684
163 Ga0307510_10036733 3300033180 Bacteria 5449
164 Ga0307510_10108823 3300033180 Bacteria 2523
165 Ga0316574_0036526 3300035398 Bacteria 3008
166 Ga0316574_0115192 3300035398 Bacteria 1724
167 Ga0316584_0022624 3300036712 Bacteria 4586
168 Ga0316584_0041308 3300036712 Bacteria 3437
169 Ga0395899_0016540 3300037312 Bacteria 5627
170 Ga0395900_0028433 3300037418 Bacteria 5726
171 Ga0395900_0041499 3300037418 Bacteria 4743
172 Ga0395898_0025907 3300037466 Bacteria 5905
173 Ga0395898_0027393 3300037466 Bacteria 5722
174 Ga0395898_0145761 3300037466 Bacteria 2266
175 Ga0395901_0018988 3300038443 Bacteria 7028
176 Ga0395901_0110698 3300038443 Bacteria 2883
177 Ga0395901_0136284 3300038443 Bacteria 2580
178 Ga0436365_0278397 3300039437 Bacteria 3667
179 Ga0436365_1577007 3300039437 Bacteria 1551
180 Ga0451789_1318126 3300041443 Bacteria 6221
181 Ga0451791_1022508 3300041451 Bacteria 1354
182 Ga0451791_1329236 3300041451 Bacteria 3807
183 Ga0451791_1644035 3300041451 Bacteria 4469
184 Ga0451793_0998999 3300041452 Bacteria 4487
185 Ga0451843_0958715 3300041509 Bacteria 8331
186 Ga0451853_1869767 3300041512 Bacteria 1354
187 Ga0439442_007313 3300042002 Bacteria 2220
188 Ga0439449_0016540 3300042007 Bacteria 2772
189 Ga0439455_0000882 3300042012 Bacteria 4622
190 Ga0450903_000048 3300042138 Bacteria 23819
191 Ga0439458_0002970 3300042157 Bacteria 4066
192 Ga0466969_0013495 3300044656 Bacteria 4303
193 Ga0466966_0050159 3300044684 Bacteria 2656
194 Ga0466966_0085376 3300044684 Bacteria 1962
195 Ga0466966_0163691 3300044684 Bacteria 1354
196 Ga0466961_0054171 3300044693 Bacteria 2559
197 Ga0466963_0065712 3300044694 Bacteria 2432
198 Ga0466963_0113594 3300044694 Bacteria 1860
199 Ga0466963_0236384 3300044694 Bacteria 1281
200 Ga0466971_0001281 3300044719 Bacteria 10486
201 Ga0466970_0030344 3300044765 Bacteria 2851
202 Ga0466970_0048133 3300044765 Bacteria 2273
203 Ga0466957_0109508 3300044842 Bacteria 1750
204 Ga0466960_0000767 3300044901 Bacteria 11278
205 Ga0466960_0022986 3300044901 Bacteria 2794
206 Ga0466960_0033620 3300044901 Bacteria 2384
207 Ga0466960_0043148 3300044901 Bacteria 2144
208 Ga0466960_0056915 3300044901 Bacteria 1905
209 Ga0466959_0000859 3300045049 Bacteria 17898
210 Ga0466967_0016498 3300045976 Bacteria 5828
211 Ga0466967_0037300 3300045976 Bacteria 4158
212 Ga0466967_0067217 3300045976 Bacteria 3196
213 Ga0466967_0145690 3300045976 Bacteria 2209
214 Ga0466967_0164118 3300045976 Bacteria 2087
215 Ga0466967_0168189 3300045976 Bacteria 2061
216 Ga0466967_0191068 3300045976 Bacteria 1935
217 Ga0466967_0219069 3300045976 Bacteria 1808
218 Ga0466967_0267801 3300045976 Bacteria 1636
219 Ga0495603_0000478 3300046455 Bacteria 22090
220 Ga0495603_0004442 3300046455 Bacteria 8362
221 Ga0495603_0028728 3300046455 Bacteria 3355
222 Ga0495629_0002283 3300046459 Bacteria 14771
223 Ga0495629_0010404 3300046459 Bacteria 6770
224 Ga0495629_0176334 3300046459 Bacteria 1482
225 Ga0495629_0301217 3300046459 Bacteria 1098
226 Ga0495641_0077373 3300046461 Bacteria 1491
227 Ga0495651_0036904 3300046462 Bacteria 3805
228 Ga0495653_0032071 3300046463 Bacteria 4175
229 Ga0495650_0048419 3300046471 Bacteria 1771
230 Ga0495582_0042173 3300046473 Bacteria 2514
231 Ga0495582_0076814 3300046473 Bacteria 1852
232 Ga0495662_0001340 3300046476 Bacteria 12164
233 Ga0495662_0006306 3300046476 Bacteria 5929
234 Ga0495662_0033092 3300046476 Bacteria 2498
235 Ga0495664_0006625 3300046477 Bacteria 6407
236 Ga0495608_0135701 3300046511 Bacteria 1573
237 Ga0495628_0017553 3300046516 Bacteria 5953
238 Ga0495630_0043083 3300046517 Bacteria 3371
239 Ga0495643_0002790 3300046522 Bacteria 13351
240 Ga0495587_0002488 3300046536 Bacteria 12298
241 Ga0495656_0017841 3300046615 Bacteria 2715
242 Ga0495634_0007854 3300046642 Bacteria 7969
243 Ga0495625_0063561 3300046660 Bacteria 2606
244 Ga0495635_0003290 3300046663 Bacteria 11164
245 Ga0495635_0035367 3300046663 Bacteria 3463
246 Ga0495588_0083429 3300046674 Bacteria 1669
247 Ga0495657_0002330 3300046675 Bacteria 15990
248 Ga0495657_0137645 3300046675 Bacteria 1524
249 Ga0495599_0079626 3300046678 Bacteria 2046
250 Ga0495646_0034318 3300046680 Bacteria 3151
251 Ga0495658_0058147 3300046683 Bacteria 2211
252 Ga0495658_0214102 3300046683 Bacteria 1205
253 Ga0495613_0005917 3300046689 Bacteria 9154
254 Ga0495600_0001348 3300046809 Bacteria 13537
255 Ga0495600_0132722 3300046809 Bacteria 1619
256 Ga0495660_0007157 3300046810 Bacteria 6572
257 Ga0495581_0005893 3300047315 Bacteria 7107
258 Ga0495581_0095527 3300047315 Bacteria 1726
259 Ga0495604_0001496 3300047317 Bacteria 19267
260 Ga0495636_0056232 3300047318 Bacteria 1656
261 Ga0495676_0013007 3300047321 Bacteria 7490
262 Ga0495680_0207206 3300047322 Bacteria 1405
263 Ga0495675_0076315 3300047444 Bacteria 2112
264 Ga0495685_002863 3300047447 Bacteria 5447
265 Ga0495685_016956 3300047447 Bacteria 2491
266 Ga0495681_0001291 3300047470 Bacteria 18959
267 Ga0495593_0004637 3300047673 Bacteria 8170
268 Ga0495602_0084423 3300048088 Bacteria 2657
269 Ga0495614_0000443 3300048089 Bacteria 17052
270 Ga0496100_0007935 3300048903 Bacteria 5897
271 Ga0496100_0060388 3300048903 Bacteria 2495
272 Ga0496102_0006881 3300048905 Bacteria 9704
273 Ga0496102_0049138 3300048905 Bacteria 3837
274 Ga0496102_0203315 3300048905 Bacteria 1867
275 Ga0496103_0012263 3300048906 Bacteria 5086
276 Ga0496104_0019885 3300048907 Bacteria 6149
277 Ga0496104_0033141 3300048907 Bacteria 4810
278 Ga0496104_0051677 3300048907 Bacteria 3879
279 Ga0496105_0008229 3300048908 Bacteria 8106
280 Ga0496105_0033287 3300048908 Bacteria 4231
281 Ga0496105_0064765 3300048908 Bacteria 3016
282 Ga0496105_0096187 3300048908 Bacteria 2446
283 Ga0496106_0017584 3300048909 Bacteria 5289
284 Ga0496106_0067644 3300048909 Bacteria 2724
285 Ga0496106_0142331 3300048909 Bacteria 1887
286 Ga0496107_0033379 3300048910 Bacteria 3682
287 Ga0496107_0053554 3300048910 Bacteria 2911
288 Ga0496107_0065739 3300048910 Bacteria 2629
289 Ga0496107_0074303 3300048910 Bacteria 2473
290 Ga0496107_0078395 3300048910 Bacteria 2407
291 Ga0496107_0084392 3300048910 Bacteria 2317
292 Ga0496108_0000856 3300048911 Bacteria 23751
293 Ga0496108_0005787 3300048911 Bacteria 10017
294 Ga0496108_0024069 3300048911 Bacteria 5012
295 Ga0496108_0049476 3300048911 Bacteria 3516
296 Ga0496108_0051122 3300048911 Bacteria 3462
297 Ga0496109_0006360 3300048912 Bacteria 9947
298 Ga0496109_0012143 3300048912 Bacteria 7429
299 Ga0496109_0053405 3300048912 Bacteria 3685
300 Ga0496109_0106700 3300048912 Bacteria 2602
301 Ga0496109_0106977 3300048912 Bacteria 2598
302 Ga0496109_0199131 3300048912 Bacteria 1883
303 Ga0496109_0208795 3300048912 Bacteria 1836
304 Ga0496110_0006310 3300048913 Bacteria 9362
305 Ga0496110_0034366 3300048913 Bacteria 4391
306 Ga0496110_0041438 3300048913 Bacteria 4018
307 Ga0496110_0080666 3300048913 Bacteria 2900
308 Ga0496111_0002234 3300048914 Bacteria 11621
309 Ga0496111_0006666 3300048914 Bacteria 7511
310 Ga0496111_0102088 3300048914 Bacteria 2108
311 Ga0496112_0088593 3300048915 Bacteria 3063
312 Ga0496112_0169359 3300048915 Bacteria 2150
313 Ga0496112_0192325 3300048915 Bacteria 2002
314 Ga0496112_0364375 3300048915 Bacteria 1387
315 Ga0496113_0089756 3300048916 Bacteria 2366
316 Ga0496113_0142671 3300048916 Bacteria 1885
317 Ga0496113_0315730 3300048916 Bacteria 1252
318 Ga0496114_0002509 3300048917 Bacteria 14018
319 Ga0496114_0012598 3300048917 Bacteria 6774
320 Ga0496114_0014311 3300048917 Bacteria 6364
321 Ga0496114_0023757 3300048917 Bacteria 5002
322 Ga0496114_0044137 3300048917 Bacteria 3698
323 Ga0496114_0051824 3300048917 Bacteria 3417
324 Ga0496114_0097631 3300048917 Bacteria 2503
325 Ga0496114_0138221 3300048917 Bacteria 2107
326 Ga0496114_0227474 3300048917 Bacteria 1638
327 Ga0496115_0007181 3300048918 Bacteria 8182
328 Ga0501031_0001351 3300049568 Bacteria 15124
329 Ga0501031_0002710 3300049568 Bacteria 11275
330 Ga0501032_0010848 3300049569 Bacteria 6555
331 Ga0501032_0047139 3300049569 Bacteria 2911
332 Ga0501033_0001492 3300049570 Bacteria 20722
333 Ga0501034_0011855 3300049571 Bacteria 9024
334 Ga0501034_0016488 3300049571 Bacteria 7580
335 Ga0501034_0110447 3300049571 Bacteria 2740
336 Ga0501034_0203472 3300049571 Bacteria 1937
337 Ga0501036_0000277 3300049572 Bacteria 35238
338 Ga0501036_0003604 3300049572 Bacteria 12385
339 Ga0501036_0015094 3300049572 Bacteria 6447
340 Ga0501037_0049841 3300049573 Bacteria 3066
341 Ga0501037_0066416 3300049573 Bacteria 2628
342 Ga0501037_0080335 3300049573 Bacteria 2366
343 Ga0501038_0000246 3300049574 Bacteria 45848
344 Ga0501038_0003139 3300049574 Bacteria 15415
345 Ga0501038_0022527 3300049574 Bacteria 5643
346 Ga0501038_0039435 3300049574 Bacteria 4131
347 Ga0501038_0183922 3300049574 Bacteria 1685
348 Ga0501039_0002346 3300049575 Bacteria 14084
349 Ga0501039_0009846 3300049575 Bacteria 7288
350 Ga0501039_0026769 3300049575 Bacteria 4432
351 Ga0501039_0145251 3300049575 Bacteria 1864
352 Ga0501040_0001036 3300049576 Bacteria 17613
353 Ga0501040_0002710 3300049576 Bacteria 11413
354 Ga0501041_0002201 3300049577 Bacteria 11007
355 Ga0501041_0006516 3300049577 Bacteria 6835
356 Ga0501042_0007764 3300049578 Bacteria 7049
357 Ga0501043_0009047 3300049579 Bacteria 7836
358 Ga0501043_0023391 3300049579 Bacteria 4847
359 Ga0501043_0036634 3300049579 Bacteria 3860
360 Ga0501043_0163714 3300049579 Bacteria 1737
361 Ga0501046_0006504 3300049580 Bacteria 10334
362 Ga0501046_0101075 3300049580 Bacteria 2212
363 Ga0501047_0008296 3300049581 Bacteria 9805
364 Ga0501048_0005847 3300049582 Bacteria 9359
365 Ga0501067_0018976 3300049583 Bacteria 3805
366 Ga0501067_0035326 3300049583 Bacteria 2775
367 Ga0501067_0057477 3300049583 Bacteria 2154
368 Ga0501068_0046168 3300049584 Bacteria 2626
369 Ga0501068_0059816 3300049584 Bacteria 2313
370 Ga0501069_0064291 3300049585 Bacteria 2051
371 Ga0501070_0004731 3300049586 Bacteria 11655
372 Ga0501070_0006784 3300049586 Bacteria 9742
373 Ga0501070_0046854 3300049586 Bacteria 3595
374 Ga0501071_0000525 3300049587 Bacteria 19591
375 Ga0501071_0001992 3300049587 Bacteria 12204
376 Ga0501071_0065809 3300049587 Bacteria 2632
377 Ga0501071_0137477 3300049587 Bacteria 1819
378 Ga0501072_0007538 3300049588 Bacteria 8259
379 Ga0501072_0008316 3300049588 Bacteria 7882
380 Ga0501074_0000276 3300049590 Bacteria 29509
381 Ga0501074_0017772 3300049590 Bacteria 5166
382 Ga0501074_0023312 3300049590 Bacteria 4501
383 Ga0501075_0008295 3300049591 Bacteria 7243
384 Ga0501075_0008970 3300049591 Bacteria 6977
385 Ga0501076_0014280 3300049592 Bacteria 5978
386 Ga0501076_0065119 3300049592 Bacteria 2905
387 Ga0501077_0003477 3300049593 Bacteria 9460
388 Ga0501077_0067350 3300049593 Bacteria 2270
389 Ga0501079_0003637 3300049741 Bacteria 11354
390 Ga0501079_0022347 3300049741 Bacteria 4849
391 Ga0501080_0015917 3300049742 Bacteria 6937
392 Ga0501080_0065768 3300049742 Bacteria 3372
393 Ga0501080_0186023 3300049742 Bacteria 1910
394 Ga0501081_0012745 3300049743 Bacteria 5530
395 Ga0501035_0002082 3300049822 Bacteria 19908
396 Ga0501035_0014296 3300049822 Bacteria 7327
397 Ga0501035_0047871 3300049822 Bacteria 3836
398 Ga0501044_0008533 3300049823 Bacteria 11226
399 Ga0501044_0188236 3300049823 Bacteria 2028
400 Ga0501044_0359015 3300049823 Bacteria 1375
401 Ga0501045_0005469 3300049824 Bacteria 8793
402 nmdc:mga03n38_5773_c1 3300050490 Bacteria 4247
403 nmdc:mga03n38_75234_c1 3300050490 Bacteria 1572
404 nmdc:mga0yw44_1176_c2 3300050492 Bacteria 7483
405 nmdc:mga0yw44_179915_c1 3300050492 Bacteria 1391
406 nmdc:mga0yw44_19938_c1 3300050492 Bacteria 3710
407 nmdc:mga0yw44_3036_c1 3300050492 Bacteria 7339
408 nmdc:mga0yw44_4793_c1 3300050492 Bacteria 6271
409 nmdc:mga0yw44_82775_c1 3300050492 Bacteria 2014
410 nmdc:mga06z11_742_c1 3300050494 Bacteria 11909
411 nmdc:mga04h51_16239_c1 3300050495 Bacteria 2158
412 nmdc:mga07m45_17089_c1 3300050496 Bacteria 3890
413 nmdc:mga05p37_46525_c1 3300050507 Bacteria 5335
414 nmdc:mga0qj67_77566_c1 3300050509 Bacteria 2658
415 nmdc:mga08y16_139155_c1 3300050511 Bacteria 2524
416 nmdc:mga0sz30_5139_c1 3300050516 Bacteria 4788
417 Ga0500578_0008161 3300053086 Bacteria 6858
418 Ga0500654_020162 3300053099 Bacteria 4279
419 Ga0500556_0000481 3300053104 Bacteria 27853
420 Ga0500569_001846 3300053109 Bacteria 4077
421 Ga0500593_000103 3300053117 Bacteria 32439
422 Ga0500652_000374 3300053131 Bacteria 16082
423 Ga0500658_0007350 3300053134 Bacteria 4067
424 Ga0500616_0000060 3300053153 Bacteria 252252
425 Ga0500616_0055102 3300053153 Bacteria 2080
426 Ga0501084_0007037 3300054114 Bacteria 9274
427 Ga0501084_0029919 3300054114 Bacteria 4555
428 Ga0501082_0005370 3300060353 Bacteria 11118
429 Ga0501082_0032576 3300060353 Bacteria 4495
430 Ga0466962_0001158 3300061719 Bacteria 12164
431 Ga0530510_0010669 3300061734 Bacteria 6444
432 2508675690 2508501039 Bacteria 9978592
433 2558913149 2558860112 Bacteria 9931328
434 2583150680 2582580736 Bacteria 5325865
435 2585306568 2582581313 Bacteria 10042643
436 2643852055 2643221567 Bacteria 4163945
437 2644091448 2643221615 Bacteria 5487866
438 2644136512 2643221624 Bacteria 4384879
439 2644228007 2643221641 Bacteria 4490190
440 2644263419 2643221647 Bacteria 10741251
441 2644321251 2643221657 Bacteria 5490246
442 2644446551 2643221679 Bacteria 3839507
443 2644608503 2643221711 Bacteria 4865335
444 2689962461 2687453737 Bacteria 11203906
445 2740165514 2739367898 Bacteria 4367674
446 2774381268 2773857758 Bacteria 3592392
447 2784586307 2784132148 Bacteria 8627943
448 2785366662 2784746768 Bacteria 10036182
449 2786667736 2786546132 Bacteria 10419719
450 2791912000 2791354901 Bacteria 8322202
451 2793976787 2791355406 Bacteria 11364898
452 2808871954 2808606365 Bacteria 4301966
453 2808918006 2808606375 Bacteria 9466072
454 2809226125 2808606447 Bacteria 3572005
455 2809229806 2808606448 Bacteria 8656184
456 2812332816 2811994874 Bacteria 5367947
457 2812372515 2811994882 Bacteria 4688362
458 2812483205 2811994917 Bacteria 7761064
459 2816511122 2816332139 Bacteria 9138787
460 2819425796 2818991318 Bacteria 5266538
461 2819664249 2818991458 Bacteria 4794049
462 2819689976 2818991462 Bacteria 4320267
463 2819726460 2818991469 Bacteria 4644110
464 2821271477 2821268502 Bacteria 3750023
465 2855389375 2855386786 Bacteria 4752232
466 2857483950 2857481737 Bacteria 4761446
467 2862290115 2862281513 Bacteria 9621493
468 2867430332 2867428634 Bacteria 9590268
469 2877683887 2877676314 Bacteria 9512378
470 2895661911 2895660088 Bacteria 3782833
471 2904510814 2904509784 Bacteria 3520416
472 2915361770 2915358134 Bacteria 6050864
473 2919072637 2919069694 Bacteria 3622919
474 2919448549 2919446982 Bacteria 3994487
475 2954389169 2954380949 Bacteria 10050426
476 2954673876 2954673503 Bacteria 9685905
477 2954690115 2954682443 Bacteria 9862841
478 2954699927 2954691527 Bacteria 10720516
479 2954702271 2954701450 Bacteria 10834262
480 2954718797 2954711539 Bacteria 10867210
481 2954728766 2954721474 Bacteria 10456478
482 2954733044 2954731030 Bacteria 10243860
483 2954747665 2954740390 Bacteria 10229294
484 2954751924 2954749733 Bacteria 10366972
485 2954766788 2954759201 Bacteria 9358192
486 2977229205 2977228692 Bacteria 3450105
487 2977238757 2977236895 Bacteria 3569373
488 2984543458 2984542743 Bacteria 3569378
489 2997602467 2997600082 Bacteria 9896405
490 3001889818 3001889506 Bacteria 2975194
491 3006494638 3006493962 Bacteria 8825450
492 8002789993 8002784119 Bacteria 9788632
493 8023630669 8023623736 Bacteria 8593882
494 8048388027 8048379754 Bacteria 11877923
495 8054474184 8054472261 Bacteria 7464355
496 8055178378 8055172936 Bacteria 9305943
497 Ga0496117_0135122
498 rootH1_10020751
499 Ga0065714_10079550
500 Ga0070658_10004307
501 Ga0070683_100079583
502 Ga0070683_100181745
503 Ga0070680_100035288
504 Ga0070682_100012800
505 Ga0070682_100077048
506 Ga0070682_100083593
507 Ga0068868_100269230
508 Ga0070692_10036530
509 Ga0070688_100081488
510 Ga0070659_100110386
511 Ga0070701_10003925
512 Ga0070678_100030917
513 Ga0070678_100132139
514 Ga0070681_10000052
515 Ga0068867_100003761
516 Ga0068867_100045447
517 Ga0070685_10026623
518 Ga0070679_100000018
519 Ga0070684_100095029
520 Ga0070684_100134014
521 Ga0070672_100028305
522 Ga0070696_100006846
523 Ga0070665_100114199
524 Ga0070665_100214833
525 Ga0068857_100018636
526 Ga0068857_100278262
527 Ga0070702_100179488
528 Ga0068863_100000217
529 Ga0068863_100387590
530 Ga0068860_100000555
531 Ga0081455_10001714
532 Ga0081455_10009745
533 Ga0081539_10000356
534 Ga0081539_10009723
535 Ga0075365_10014190
536 Ga0075365_10024671
537 Ga0075365_10024872
538 Ga0075365_10098017
539 Ga0075368_10028461
540 Ga0075363_100000053
541 Ga0075363_100001099
542 Ga0075364_10032888
543 Ga0075364_10082149
544 Ga0075364_10141595
545 Ga0075367_10000880
546 Ga0075369_10007812
547 Ga0075428_100084246
548 Ga0075430_100084377
549 Ga0105245_10019929
550 Ga0105245_10155101
551 Ga0105245_10180198
552 Ga0105245_10206695
553 Ga0114129_10046054
554 Ga0105243_10022640
555 Ga0105243_10030506
556 Ga0105243_10151688
557 Ga0105249_10101535
558 Ga0105246_10169005
559 Ga0157373_10045462
560 Ga0157371_10136886
561 Ga0157369_10004538
562 Ga0157369_10219258
563 Ga0157372_10008455
564 Ga0157372_10148830
565 Ga0157372_10228628
566 Ga0157375_10050509
567 Ga0157375_10102108
568 Ga0157375_10195561
569 Ga0157375_10309328
570 Ga0163163_10026127
571 Ga0163163_10134606
572 Ga0163163_10356345
573 Ga0157380_10006310
574 Ga0182008_10100182
575 Ga0157377_10001324
576 Ga0157377_10085313
577 Ga0157379_10172857
578 Ga0183367_1003
579 Ga0163161_10006389
580 Ga0213876_10085180
581 Ga0209758_1003868
582 Ga0207426_1011827
583 Ga0207688_10001057
584 Ga0207647_10089399
585 Ga0207643_10003678
586 Ga0207643_10036364
587 Ga0207707_10000384
588 Ga0207660_10000616
589 Ga0207660_10071057
590 Ga0207652_10000293
591 Ga0207650_10139415
592 Ga0207687_10051618
593 Ga0207709_10162016
594 Ga0207670_10111828
595 Ga0207669_10093397
596 Ga0207661_10041793
597 Ga0207712_10063661
598 Ga0207712_10115825
599 Ga0207677_10104649
600 Ga0207678_10045506
601 Ga0207702_10076103
602 Ga0207641_10051721
603 Ga0207641_10053141
604 Ga0207648_10120886
605 Ga0207676_10026682
606 Ga0207674_10034381
607 Ga0207675_100065557
608 Ga0207675_100087892
609 Ga0207683_10114406
610 Ga0207683_10166907
611 Ga0207683_10177326
612 Ga0207698_10057928
613 Ga0209813_10031542
614 Ga0268264_10000264
615 Ga0307517_10005349
616 Ga0307511_10005998
617 Ga0307512_10001730
618 Ga0307513_10001347
619 Ga0307513_10024604
620 Ga0307509_10007456
621 Ga0307509_10159714
622 Ga0307408_100308187
623 Ga0307508_10010934
624 Ga0307508_10028249
625 Ga0307508_10067644
626 Ga0307508_10203274
627 Ga0316579_10002931
628 Ga0316579_10016079
629 Ga0316576_10021795
630 Ga0316576_10113137
631 Ga0316576_10150635
632 Ga0316578_10003143
633 Ga0307516_10037527
634 Ga0307413_10001057
635 Ga0307413_10054720
636 Ga0307518_10110713
637 Ga0307518_10111017
638 Ga0307410_10045845
639 Ga0307410_10048064
640 Ga0307410_10111087
641 Ga0307406_10040265
642 Ga0307407_10008102
643 Ga0307409_100004442
644 Ga0307409_100011366
645 Ga0307409_100308780
646 Ga0307409_100392331
647 Ga0307416_100029654
648 Ga0307414_10012924
649 Ga0307411_10024830
650 Ga0307411_10242558
651 Ga0307415_100003500
652 Ga0307415_100008777
653 Ga0307415_100024880
654 Ga0307415_100127598
655 Ga0307415_100221190
656 Ga0316580_10032496
657 Ga0307507_10015555
658 Ga0307507_10040426
659 Ga0307510_10036733
660 Ga0307510_10108823
661 Ga0316574_0036526
662 Ga0316574_0115192
663 Ga0316584_0022624
664 Ga0316584_0041308
665 Ga0395899_0016540
666 Ga0395900_0028433
667 Ga0395900_0041499
668 Ga0395898_0025907
669 Ga0395898_0027393
670 Ga0395898_0145761
671 Ga0395901_0018988
672 Ga0395901_0110698
673 Ga0395901_0136284
674 Ga0436365_0278397
675 Ga0436365_1577007
676 Ga0451789_1318126
677 Ga0451791_1022508
678 Ga0451791_1329236
679 Ga0451791_1644035
680 Ga0451793_0998999
681 Ga0451843_0958715
682 Ga0451853_1869767
683 Ga0439442_007313
684 Ga0439449_0016540
685 Ga0439455_0000882
686 Ga0450903_000048
687 Ga0439458_0002970
688 Ga0466969_0013495
689 Ga0466966_0050159
690 Ga0466966_0085376
691 Ga0466966_0163691
692 Ga0466961_0054171
693 Ga0466963_0065712
694 Ga0466963_0113594
695 Ga0466963_0236384
696 Ga0466971_0001281
697 Ga0466970_0030344
698 Ga0466970_0048133
699 Ga0466957_0109508
700 Ga0466960_0000767
701 Ga0466960_0022986
702 Ga0466960_0033620
703 Ga0466960_0043148
704 Ga0466960_0056915
705 Ga0466959_0000859
706 Ga0466967_0016498
707 Ga0466967_0037300
708 Ga0466967_0067217
709 Ga0466967_0145690
710 Ga0466967_0164118
711 Ga0466967_0168189
712 Ga0466967_0191068
713 Ga0466967_0219069
714 Ga0466967_0267801
715 Ga0495603_0000478
716 Ga0495603_0004442
717 Ga0495603_0028728
718 Ga0495629_0002283
719 Ga0495629_0010404
720 Ga0495629_0176334
721 Ga0495629_0301217
722 Ga0495641_0077373
723 Ga0495651_0036904
724 Ga0495653_0032071
725 Ga0495650_0048419
726 Ga0495582_0042173
727 Ga0495582_0076814
728 Ga0495662_0001340
729 Ga0495662_0006306
730 Ga0495662_0033092
731 Ga0495664_0006625
732 Ga0495608_0135701
733 Ga0495628_0017553
734 Ga0495630_0043083
735 Ga0495643_0002790
736 Ga0495587_0002488
737 Ga0495656_0017841
738 Ga0495634_0007854
739 Ga0495625_0063561
740 Ga0495635_0003290
741 Ga0495635_0035367
742 Ga0495588_0083429
743 Ga0495657_0002330
744 Ga0495657_0137645
745 Ga0495599_0079626
746 Ga0495646_0034318
747 Ga0495658_0058147
748 Ga0495658_0214102
749 Ga0495613_0005917
750 Ga0495600_0001348
751 Ga0495600_0132722
752 Ga0495660_0007157
753 Ga0495581_0005893
754 Ga0495581_0095527
755 Ga0495604_0001496
756 Ga0495636_0056232
757 Ga0495676_0013007
758 Ga0495680_0207206
759 Ga0495675_0076315
760 Ga0495685_002863
761 Ga0495685_016956
762 Ga0495681_0001291
763 Ga0495593_0004637
764 Ga0495602_0084423
765 Ga0495614_0000443
766 Ga0496100_0007935
767 Ga0496100_0060388
768 Ga0496102_0006881
769 Ga0496102_0049138
770 Ga0496102_0203315
771 Ga0496103_0012263
772 Ga0496104_0019885
773 Ga0496104_0033141
774 Ga0496104_0051677
775 Ga0496105_0008229
776 Ga0496105_0033287
777 Ga0496105_0064765
778 Ga0496105_0096187
779 Ga0496106_0017584
780 Ga0496106_0067644
781 Ga0496106_0142331
782 Ga0496107_0033379
783 Ga0496107_0053554
784 Ga0496107_0065739
785 Ga0496107_0074303
786 Ga0496107_0078395
787 Ga0496107_0084392
788 Ga0496108_0000856
789 Ga0496108_0005787
790 Ga0496108_0024069
791 Ga0496108_0049476
792 Ga0496108_0051122
793 Ga0496109_0006360
794 Ga0496109_0012143
795 Ga0496109_0053405
796 Ga0496109_0106700
797 Ga0496109_0106977
798 Ga0496109_0199131
799 Ga0496109_0208795
800 Ga0496110_0006310
801 Ga0496110_0034366
802 Ga0496110_0041438
803 Ga0496110_0080666
804 Ga0496111_0002234
805 Ga0496111_0006666
806 Ga0496111_0102088
807 Ga0496112_0088593
808 Ga0496112_0169359
809 Ga0496112_0192325
810 Ga0496112_0364375
811 Ga0496113_0089756
812 Ga0496113_0142671
813 Ga0496113_0315730
814 Ga0496114_0002509
815 Ga0496114_0012598
816 Ga0496114_0014311
817 Ga0496114_0023757
818 Ga0496114_0044137
819 Ga0496114_0051824
820 Ga0496114_0097631
821 Ga0496114_0138221
822 Ga0496114_0227474
823 Ga0496115_0007181
824 Ga0501031_0001351
825 Ga0501031_0002710
826 Ga0501032_0010848
827 Ga0501032_0047139
828 Ga0501033_0001492
829 Ga0501034_0011855
830 Ga0501034_0016488
831 Ga0501034_0110447
832 Ga0501034_0203472
833 Ga0501036_0000277
834 Ga0501036_0003604
835 Ga0501036_0015094
836 Ga0501037_0049841
837 Ga0501037_0066416
838 Ga0501037_0080335
839 Ga0501038_0000246
840 Ga0501038_0003139
841 Ga0501038_0022527
842 Ga0501038_0039435
843 Ga0501038_0183922
844 Ga0501039_0002346
845 Ga0501039_0009846
846 Ga0501039_0026769
847 Ga0501039_0145251
848 Ga0501040_0001036
849 Ga0501040_0002710
850 Ga0501041_0002201
851 Ga0501041_0006516
852 Ga0501042_0007764
853 Ga0501043_0009047
854 Ga0501043_0023391
855 Ga0501043_0036634
856 Ga0501043_0163714
857 Ga0501046_0006504
858 Ga0501046_0101075
859 Ga0501047_0008296
860 Ga0501048_0005847
861 Ga0501067_0018976
862 Ga0501067_0035326
863 Ga0501067_0057477
864 Ga0501068_0046168
865 Ga0501068_0059816
866 Ga0501069_0064291
867 Ga0501070_0004731
868 Ga0501070_0006784
869 Ga0501070_0046854
870 Ga0501071_0000525
871 Ga0501071_0001992
872 Ga0501071_0065809
873 Ga0501071_0137477
874 Ga0501072_0007538
875 Ga0501072_0008316
876 Ga0501074_0000276
877 Ga0501074_0017772
878 Ga0501074_0023312
879 Ga0501075_0008295
880 Ga0501075_0008970
881 Ga0501076_0014280
882 Ga0501076_0065119
883 Ga0501077_0003477
884 Ga0501077_0067350
885 Ga0501079_0003637
886 Ga0501079_0022347
887 Ga0501080_0015917
888 Ga0501080_0065768
889 Ga0501080_0186023
890 Ga0501081_0012745
891 Ga0501035_0002082
892 Ga0501035_0014296
893 Ga0501035_0047871
894 Ga0501044_0008533
895 Ga0501044_0188236
896 Ga0501044_0359015
897 Ga0501045_0005469
898 nmdc:mga03n38_5773_c1
899 nmdc:mga03n38_75234_c1
900 nmdc:mga0yw44_1176_c2
901 nmdc:mga0yw44_179915_c1
902 nmdc:mga0yw44_19938_c1
903 nmdc:mga0yw44_3036_c1
904 nmdc:mga0yw44_4793_c1
905 nmdc:mga0yw44_82775_c1
906 nmdc:mga06z11_742_c1
907 nmdc:mga04h51_16239_c1
908 nmdc:mga07m45_17089_c1
909 nmdc:mga05p37_46525_c1
910 nmdc:mga0qj67_77566_c1
911 nmdc:mga08y16_139155_c1
912 nmdc:mga0sz30_5139_c1
913 Ga0500578_0008161
914 Ga0500654_020162
915 Ga0500556_0000481
916 Ga0500569_001846
917 Ga0500593_000103
918 Ga0500652_000374
919 Ga0500658_0007350
920 Ga0500616_0000060
921 Ga0500616_0055102
922 Ga0501084_0007037
923 Ga0501084_0029919
924 Ga0501082_0005370
925 Ga0501082_0032576
926 Ga0466962_0001158
927 Ga0530510_0010669
928 2508675690
929 2558913149
930 2583150680
931 2585306568
932 2643852055
933 2644091448
934 2644136512
935 2644228007
936 2644263419
937 2644321251
938 2644446551
939 2644608503
940 2689962461
941 2740165514
942 2774381268
943 2784586307
944 2785366662
945 2786667736
946 2791912000
947 2793976787
948 2808871954
949 2808918006
950 2809226125
951 2809229806
952 2812332816
953 2812372515
954 2812483205
955 2816511122
956 2819425796
957 2819664249
958 2819689976
959 2819726460
960 2821271477
961 2855389375
962 2857483950
963 2862290115
964 2867430332
965 2877683887
966 2895661911
967 2904510814
968 2915361770
969 2919072637
970 2919448549
971 2954389169
972 2954673876
973 2954690115
974 2954699927
975 2954702271
976 2954718797
977 2954728766
978 2954733044
979 2954747665
980 2954751924
981 2954766788
982 2977229205
983 2977238757
984 2984543458
985 2997602467
986 3001889818
987 3006494638
988 8002789993
989 8023630669
990 8048388027
991 8054474184
992 8055178378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

64

438

0.9

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

110

275

0.86

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

113

247

0.84

PF00155

Aminotran_1_2

Aminotransferase class I and II

59

250

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cai-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis rv3778c protein 0.9514 3 392
3cai-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis rv3778c protein 0.935 3 392
5vpr-assembly1.cif.gz_A crystal structure of cysteine desulfurase from elizabethkingia anophelis with covalently bound pyridoxal phosphate 0.9145 2 397
6c9e-assembly1.cif.gz_A crystal structure of cysteine desulfurase from legionella pneumophila philadelphia 1 0.9128 2 397
6c9e-assembly1.cif.gz_A crystal structure of cysteine desulfurase from legionella pneumophila philadelphia 1 0.9061 2 397
ID Description Score Start End Superfamily
af_P9WQ67_32_395_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9509 33 392 3.40.640.10
3caiA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9504 30 281 3.40.640.10
4w91I01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.947 295 397 3.90.1150.10
af_A0A368UH16_90_350_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9426 31 269 3.40.640.10
af_P9WQ67_32_395_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9381 33 392 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2W6V6Y6-F1-model_v4 deleted 0.9829 157 398
AF-A0A2W6V6Y6-F1-model_v4 deleted 0.9789 157 398
AF-A0A7J9Z5M6-F1-model_v4 Cysteine desulfurase-like protein 0.9734 5 398
AF-A0A526Z835-F1-model_v4 Cysteine desulfurase-like protein 0.9734 35 397
AF-A0A530LNQ7-F1-model_v4 Cysteine desulfurase-like protein 0.9728 1 273

Map