F454920

General Info

Members Datasets Scaffolds Average Seq Length
496 247 992 161

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0340800|Ga0436364_0340800_36794_37276
Length 160
Sequence MTSDSFTIRSLGYSDLPQVIAIERRAFSTPWSLAMFVLELSKPSGICLAAADVDTGRLVGYLVCSRYDTVWHLMNVAVEPLRRRRGIGQALLQAMIERAGTEQQYTLEVRVSNAPAIALYERLHFRCAGTRPRYYRDNGEDALIMWRTVETISDAAVPDV

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
163 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 7.46
Rhizosphere 89.52
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0340800 3300037853 Bacteria 64191
2 LJNas_1021762 3300000546 Bacteria 684
3 JGI25407J50210_10000453 3300003373 Bacteria 8090
4 JGI25407J50210_10002649 3300003373 Bacteria 4244
5 JGI25407J50210_10024005 3300003373 Bacteria 1583
6 JGI25407J50210_10028605 3300003373 Bacteria 1446
7 JGI25407J50210_10056523 3300003373 Bacteria 989
8 Ga0070658_10039906 3300005327 Bacteria 3788
9 Ga0070658_10398712 3300005327 Bacteria 1182
10 Ga0070658_10456835 3300005327 Bacteria 1101
11 Ga0070683_100065875 3300005329 Bacteria 3374
12 Ga0070683_100293335 3300005329 Bacteria 1547
13 Ga0070670_101164602 3300005331 Bacteria 704
14 Ga0068869_100175532 3300005334 Bacteria 1677
15 Ga0070682_100031798 3300005337 Bacteria 3194
16 Ga0070682_100321742 3300005337 Bacteria 1143
17 Ga0068868_100109947 3300005338 Bacteria 2239
18 Ga0070691_10024706 3300005341 Bacteria 2794
19 Ga0070691_10074508 3300005341 Bacteria 1652
20 Ga0070691_10294857 3300005341 Bacteria 884
21 Ga0070668_100019159 3300005347 Bacteria 5146
22 Ga0070668_100949726 3300005347 Bacteria 771
23 Ga0070669_100317597 3300005353 Bacteria 1257
24 Ga0070675_100160079 3300005354 Bacteria 1935
25 Ga0070675_100457201 3300005354 Bacteria 1146
26 Ga0070674_100552705 3300005356 Bacteria 966
27 Ga0070673_100297476 3300005364 Bacteria 1420
28 Ga0070688_100536054 3300005365 Bacteria 888
29 Ga0070659_100708699 3300005366 Bacteria 871
30 Ga0070667_100751563 3300005367 Bacteria 904
31 Ga0070703_10075760 3300005406 Bacteria 1134
32 Ga0070703_10075799 3300005406 Bacteria 1134
33 Ga0070714_100016917 3300005435 Bacteria 5899
34 Ga0070714_100069204 3300005435 Bacteria 3047
35 Ga0070714_100280031 3300005435 Bacteria 1549
36 Ga0070714_100456073 3300005435 Bacteria 1215
37 Ga0070714_100580983 3300005435 Bacteria 1075
38 Ga0070713_100079217 3300005436 Bacteria 2798
39 Ga0070713_100274188 3300005436 Bacteria 1546
40 Ga0070701_10458349 3300005438 Bacteria 820
41 Ga0070711_100029495 3300005439 Bacteria 3621
42 Ga0070700_100088725 3300005441 Bacteria 2013
43 Ga0070700_100460564 3300005441 Bacteria 970
44 Ga0070700_100532117 3300005441 Bacteria 910
45 Ga0070700_100620533 3300005441 Bacteria 850
46 Ga0070694_100504638 3300005444 Bacteria 963
47 Ga0070663_100045561 3300005455 Bacteria 3099
48 Ga0070678_100291685 3300005456 Bacteria 1383
49 Ga0070662_100005715 3300005457 Bacteria 7966
50 Ga0068867_100135125 3300005459 Bacteria 1921
51 Ga0068867_100430531 3300005459 Bacteria 1120
52 Ga0070685_10330080 3300005466 Bacteria 1037
53 Ga0070707_100629968 3300005468 Bacteria 1035
54 Ga0070679_100039791 3300005530 Bacteria 4674
55 Ga0070679_100895601 3300005530 Bacteria 831
56 Ga0070684_100031818 3300005535 Bacteria 4493
57 Ga0070684_100915753 3300005535 Bacteria 822
58 Ga0070672_100123427 3300005543 Bacteria 2122
59 Ga0070672_100542953 3300005543 Bacteria 1009
60 Ga0070686_100157593 3300005544 Bacteria 1596
61 Ga0070704_100046350 3300005549 Bacteria 3031
62 Ga0070704_100491247 3300005549 Bacteria 1064
63 Ga0068855_100748822 3300005563 Bacteria 1042
64 Ga0070664_100356056 3300005564 Bacteria 1332
65 Ga0068854_101245532 3300005578 Bacteria 668
66 Ga0068854_101262118 3300005578 Bacteria 664
67 Ga0068856_100004619 3300005614 Bacteria 13674
68 Ga0068856_100721874 3300005614 Bacteria 1017
69 Ga0068856_101660506 3300005614 Bacteria 652
70 Ga0070702_100003160 3300005615 Bacteria 7301
71 Ga0070702_101308912 3300005615 Bacteria 589
72 Ga0068859_100666693 3300005617 Bacteria 1132
73 Ga0068864_100100019 3300005618 Bacteria 2570
74 Ga0068864_100226661 3300005618 Bacteria 1727
75 Ga0068866_10100145 3300005718 Bacteria 1597
76 Ga0068861_100025907 3300005719 Bacteria 4258
77 Ga0068861_101002847 3300005719 Bacteria 797
78 Ga0068870_10789223 3300005840 Bacteria 663
79 Ga0068860_100288209 3300005843 Bacteria 1606
80 Ga0068860_100989027 3300005843 Bacteria 859
81 Ga0068862_100827717 3300005844 Bacteria 906
82 Ga0068862_101612784 3300005844 Bacteria 656
83 Ga0081455_10090033 3300005937 Bacteria 2489
84 Ga0081538_10000124 3300005981 Bacteria 78084
85 Ga0081538_10000132 3300005981 Bacteria 77110
86 Ga0081538_10000182 3300005981 Bacteria 68831
87 Ga0081538_10000280 3300005981 Bacteria 58428
88 Ga0081538_10000682 3300005981 Bacteria 37272
89 Ga0081538_10000760 3300005981 Bacteria 35214
90 Ga0081538_10001936 3300005981 Bacteria 20713
91 Ga0081538_10015017 3300005981 Bacteria 6023
92 Ga0081538_10017909 3300005981 Bacteria 5351
93 Ga0081538_10020620 3300005981 Bacteria 4842
94 Ga0081538_10027007 3300005981 Bacteria 3993
95 Ga0081538_10033176 3300005981 Bacteria 3442
96 Ga0081538_10080174 3300005981 Bacteria 1743
97 Ga0081538_10207878 3300005981 Bacteria 794
98 Ga0081539_10110063 3300005985 Bacteria 1388
99 Ga0070717_10003068 3300006028 Bacteria 11906
100 Ga0070717_10072046 3300006028 Bacteria 2884
101 Ga0070717_10233027 3300006028 Bacteria 1622
102 Ga0075365_10079704 3300006038 Bacteria 2216
103 Ga0075365_10503483 3300006038 Bacteria 856
104 Ga0075363_100269282 3300006048 Bacteria 984
105 Ga0075364_10686489 3300006051 Bacteria 699
106 Ga0075432_10019233 3300006058 Bacteria 2332
107 Ga0075432_10026922 3300006058 Bacteria 1977
108 Ga0075432_10081205 3300006058 Bacteria 1176
109 Ga0075432_10185155 3300006058 Bacteria 817
110 Ga0070716_100257004 3300006173 Bacteria 1193
111 Ga0070716_100729664 3300006173 Bacteria 760
112 Ga0070712_100010577 3300006175 Bacteria 5826
113 Ga0070712_100332654 3300006175 Bacteria 1238
114 Ga0075428_100088756 3300006844 Bacteria 3372
115 Ga0075428_100112834 3300006844 Bacteria 2961
116 Ga0075428_100185973 3300006844 Bacteria 2248
117 Ga0075428_100231339 3300006844 Bacteria 1995
118 Ga0075428_100617111 3300006844 Bacteria 1158
119 Ga0075428_100751456 3300006844 Bacteria 1038
120 Ga0075430_100003121 3300006846 Bacteria 13859
121 Ga0075430_100202538 3300006846 Bacteria 1648
122 Ga0075430_100292685 3300006846 Bacteria 1347
123 Ga0075430_100438179 3300006846 Bacteria 1078
124 Ga0075431_100028408 3300006847 Bacteria 5747
125 Ga0075431_100045452 3300006847 Bacteria 4527
126 Ga0075433_10044934 3300006852 Bacteria 3838
127 Ga0075433_10432210 3300006852 Bacteria 1161
128 Ga0075434_100016436 3300006871 Bacteria 7113
129 Ga0075434_100294482 3300006871 Bacteria 1643
130 Ga0075434_100989961 3300006871 Bacteria 855
131 Ga0075429_100040897 3300006880 Bacteria 4036
132 Ga0075429_100061715 3300006880 Bacteria 3266
133 Ga0075429_100356512 3300006880 Bacteria 1281
134 Ga0075429_100713067 3300006880 Bacteria 879
135 Ga0075429_100947975 3300006880 Bacteria 753
136 Ga0068865_100109676 3300006881 Bacteria 2034
137 Ga0068865_100633822 3300006881 Bacteria 907
138 Ga0068865_100948234 3300006881 Bacteria 751
139 Ga0075436_100071162 3300006914 Bacteria 2405
140 Ga0075436_100934174 3300006914 Bacteria 649
141 Ga0097620_100666672 3300006931 Bacteria 1132
142 Ga0075435_100025162 3300007076 Bacteria 4631
143 Ga0111539_10063139 3300009094 Bacteria 4383
144 Ga0111539_10697089 3300009094 Bacteria 1182
145 Ga0111539_12072694 3300009094 Bacteria 660
146 Ga0111539_12720102 3300009094 Bacteria 573
147 Ga0105245_10003103 3300009098 Bacteria 14866
148 Ga0105245_10058632 3300009098 Bacteria 3466
149 Ga0105245_10113853 3300009098 Bacteria 2519
150 Ga0105245_11432318 3300009098 Bacteria 741
151 Ga0105247_10097051 3300009101 Bacteria 1879
152 Ga0114129_10013338 3300009147 Bacteria 11707
153 Ga0114129_10026591 3300009147 Bacteria 8195
154 Ga0114129_10874987 3300009147 Bacteria 1140
155 Ga0114129_11171520 3300009147 Bacteria 959
156 Ga0114129_12797107 3300009147 Bacteria 580
157 Ga0114129_13424485 3300009147 Bacteria 509
158 Ga0105243_10172388 3300009148 Bacteria 1875
159 Ga0105243_10401045 3300009148 Bacteria 1274
160 Ga0105243_10477490 3300009148 Bacteria 1176
161 Ga0105243_11223942 3300009148 Bacteria 765
162 Ga0105243_12273185 3300009148 Bacteria 580
163 Ga0105241_10407505 3300009174 Bacteria 1194
164 Ga0105248_10442300 3300009177 Bacteria 1464
165 Ga0105248_11802826 3300009177 Bacteria 694
166 Ga0105237_10291977 3300009545 Bacteria 1633
167 Ga0105237_10884888 3300009545 Bacteria 900
168 Ga0105238_10350534 3300009551 Bacteria 1465
169 Ga0105238_10879195 3300009551 Bacteria 914
170 Ga0105249_10022114 3300009553 Bacteria 5696
171 Ga0105249_12508086 3300009553 Bacteria 588
172 Ga0105239_10045602 3300010375 Bacteria 4805
173 Ga0105239_10070211 3300010375 Bacteria 3847
174 Ga0105239_10706368 3300010375 Bacteria 1153
175 Ga0105239_11108459 3300010375 Bacteria 911
176 Ga0105246_11858901 3300011119 Bacteria 577
177 Ga0157369_10475074 3300013105 Bacteria 1294
178 Ga0157369_11206091 3300013105 Bacteria 772
179 Ga0157374_10175121 3300013296 Bacteria 2094
180 Ga0157374_11258992 3300013296 Bacteria 761
181 Ga0157378_10437250 3300013297 Bacteria 1296
182 Ga0157378_10776950 3300013297 Bacteria 982
183 Ga0163162_10183048 3300013306 Bacteria 2221
184 Ga0163162_11313452 3300013306 Bacteria 822
185 Ga0157372_10982126 3300013307 Bacteria 978
186 Ga0157372_11119827 3300013307 Bacteria 910
187 Ga0157372_11523133 3300013307 Bacteria 770
188 Ga0157372_11686254 3300013307 Bacteria 729
189 Ga0157375_10144087 3300013308 Bacteria 2512
190 Ga0157375_10643352 3300013308 Bacteria 1217
191 Ga0157375_11356760 3300013308 Bacteria 837
192 Ga0163163_10042235 3300014325 Bacteria 4465
193 Ga0163163_10134347 3300014325 Bacteria 2514
194 Ga0163163_11501739 3300014325 Bacteria 735
195 Ga0157380_10067398 3300014326 Bacteria 2882
196 Ga0157380_10551459 3300014326 Bacteria 1131
197 Ga0157380_10747532 3300014326 Bacteria 989
198 Ga0157377_10128724 3300014745 Bacteria 1543
199 Ga0157377_10308588 3300014745 Bacteria 1047
200 Ga0157377_10877029 3300014745 Bacteria 669
201 Ga0157377_11179242 3300014745 Bacteria 592
202 Ga0157376_11107800 3300014969 Bacteria 818
203 Ga0163161_10211702 3300017792 Bacteria 1498
204 Ga0213875_10000617 3300021388 Bacteria 28636
205 Ga0207692_10042374 3300025898 Bacteria 2259
206 Ga0207692_10411582 3300025898 Bacteria 845
207 Ga0207642_10350843 3300025899 Bacteria 870
208 Ga0207688_10095711 3300025901 Bacteria 1709
209 Ga0207688_10120985 3300025901 Bacteria 1528
210 Ga0207688_10257320 3300025901 Bacteria 1059
211 Ga0207699_10887131 3300025906 Bacteria 658
212 Ga0207705_10038337 3300025909 Bacteria 3431
213 Ga0207693_10028813 3300025915 Bacteria 4389
214 Ga0207693_10059940 3300025915 Bacteria 2981
215 Ga0207693_10320385 3300025915 Bacteria 1214
216 Ga0207663_10040026 3300025916 Bacteria 2845
217 Ga0207660_10215567 3300025917 Bacteria 1505
218 Ga0207660_10760594 3300025917 Bacteria 791
219 Ga0207657_10109659 3300025919 Bacteria 2281
220 Ga0207652_10020680 3300025921 Bacteria 5424
221 Ga0207681_10140186 3300025923 Bacteria 1800
222 Ga0207681_10643022 3300025923 Bacteria 879
223 Ga0207694_10175557 3300025924 Bacteria 1736
224 Ga0207650_10615455 3300025925 Bacteria 914
225 Ga0207659_10253279 3300025926 Bacteria 1429
226 Ga0207687_10086170 3300025927 Bacteria 2280
227 Ga0207687_10112947 3300025927 Bacteria 2020
228 Ga0207687_10886414 3300025927 Bacteria 763
229 Ga0207700_10076392 3300025928 Bacteria 2599
230 Ga0207700_10084372 3300025928 Bacteria 2490
231 Ga0207700_10183723 3300025928 Bacteria 1753
232 Ga0207664_10001591 3300025929 Bacteria 14921
233 Ga0207664_10032825 3300025929 Bacteria 3982
234 Ga0207664_10184486 3300025929 Bacteria 1793
235 Ga0207664_10296646 3300025929 Bacteria 1421
236 Ga0207706_10005511 3300025933 Bacteria 11800
237 Ga0207706_10156904 3300025933 Bacteria 2001
238 Ga0207686_10235189 3300025934 Bacteria 1331
239 Ga0207686_11025947 3300025934 Bacteria 670
240 Ga0207709_10383765 3300025935 Bacteria 1070
241 Ga0207709_10771646 3300025935 Bacteria 774
242 Ga0207709_11000898 3300025935 Bacteria 683
243 Ga0207669_10473508 3300025937 Bacteria 997
244 Ga0207665_10224690 3300025939 Bacteria 1378
245 Ga0207691_10505021 3300025940 Bacteria 1027
246 Ga0207691_10569455 3300025940 Bacteria 960
247 Ga0207689_10060592 3300025942 Bacteria 3112
248 Ga0207661_10054780 3300025944 Bacteria 3196
249 Ga0207661_10480844 3300025944 Bacteria 1134
250 Ga0207679_10014941 3300025945 Bacteria 5116
251 Ga0207667_10708257 3300025949 Bacteria 1009
252 Ga0207651_10376569 3300025960 Bacteria 1202
253 Ga0207712_10032133 3300025961 Bacteria 3541
254 Ga0207712_10261941 3300025961 Bacteria 1403
255 Ga0207668_10015590 3300025972 Bacteria 4724
256 Ga0207668_10311566 3300025972 Bacteria 1303
257 Ga0207668_11018916 3300025972 Bacteria 740
258 Ga0207658_10212979 3300025986 Bacteria 1621
259 Ga0207658_10690387 3300025986 Bacteria 922
260 Ga0207677_10068466 3300026023 Bacteria 2491
261 Ga0207708_10000458 3300026075 Bacteria 31689
262 Ga0207708_10074679 3300026075 Bacteria 2599
263 Ga0207708_10118260 3300026075 Bacteria 2063
264 Ga0207708_10274122 3300026075 Bacteria 1365
265 Ga0207708_10481345 3300026075 Bacteria 1038
266 Ga0207702_10391567 3300026078 Bacteria 1338
267 Ga0207702_11061822 3300026078 Bacteria 804
268 Ga0207641_10556873 3300026088 Bacteria 1119
269 Ga0207641_11374749 3300026088 Bacteria 707
270 Ga0207648_10058280 3300026089 Bacteria 3368
271 Ga0207676_10413409 3300026095 Bacteria 1263
272 Ga0207676_10833523 3300026095 Bacteria 901
273 Ga0207675_100007967 3300026118 Bacteria 9990
274 Ga0207675_100104323 3300026118 Bacteria 2672
275 Ga0207675_100159746 3300026118 Bacteria 2149
276 Ga0207675_100361460 3300026118 Bacteria 1424
277 Ga0207683_10073394 3300026121 Bacteria 3027
278 Ga0207683_10180332 3300026121 Bacteria 1915
279 Ga0207683_10633285 3300026121 Bacteria 990
280 Ga0207698_10815706 3300026142 Bacteria 936
281 Ga0207428_10011016 3300027907 Bacteria 8037
282 Ga0207428_10198777 3300027907 Bacteria 1509
283 Ga0207428_10345356 3300027907 Bacteria 1096
284 Ga0207428_10445476 3300027907 Bacteria 945
285 Ga0268265_10350425 3300028380 Bacteria 1348
286 Ga0268265_10514070 3300028380 Bacteria 1131
287 Ga0268265_10635468 3300028380 Bacteria 1024
288 Ga0268264_10201783 3300028381 Bacteria 1820
289 Ga0307408_100208450 3300031548 Bacteria 1587
290 Ga0307408_100717088 3300031548 Bacteria 900
291 Ga0307408_101353971 3300031548 Bacteria 669
292 Ga0307408_101779039 3300031548 Bacteria 589
293 Ga0307405_10057939 3300031731 Bacteria 2436
294 Ga0307405_10060466 3300031731 Bacteria 2391
295 Ga0307405_10113100 3300031731 Bacteria 1843
296 Ga0307405_10309357 3300031731 Bacteria 1202
297 Ga0307413_10118419 3300031824 Bacteria 1788
298 Ga0307413_10194851 3300031824 Bacteria 1458
299 Ga0307413_10744535 3300031824 Bacteria 818
300 Ga0307410_10152273 3300031852 Bacteria 1723
301 Ga0307410_10451835 3300031852 Bacteria 1048
302 Ga0307406_10169090 3300031901 Bacteria 1580
303 Ga0307406_10586140 3300031901 Bacteria 917
304 Ga0307406_10613266 3300031901 Bacteria 899
305 Ga0307406_10848308 3300031901 Bacteria 774
306 Ga0307407_10282103 3300031903 Bacteria 1151
307 Ga0307409_100230666 3300031995 Bacteria 1678
308 Ga0307409_100300753 3300031995 Bacteria 1492
309 Ga0307409_100302371 3300031995 Bacteria 1489
310 Ga0307409_100356417 3300031995 Bacteria 1382
311 Ga0307409_101705450 3300031995 Bacteria 659
312 Ga0307416_100022144 3300032002 Bacteria 4580
313 Ga0307416_100032619 3300032002 Bacteria 3938
314 Ga0307416_100121837 3300032002 Bacteria 2326
315 Ga0307416_100170465 3300032002 Bacteria 2025
316 Ga0307416_100248631 3300032002 Bacteria 1729
317 Ga0307414_10879818 3300032004 Bacteria 820
318 Ga0307414_11264215 3300032004 Bacteria 684
319 Ga0307411_10723404 3300032005 Bacteria 869
320 Ga0307415_100005825 3300032126 Bacteria 6587
321 Ga0307415_100048295 3300032126 Bacteria 2871
322 Ga0307415_100142214 3300032126 Bacteria 1834
323 Ga0307415_100915940 3300032126 Bacteria 809
324 Ga0373941_0073772 3300035115 Bacteria 1139
325 Ga0373943_0047789 3300035170 Bacteria 2094
326 Ga0373961_0030151 3300035241 Bacteria 1507
327 Ga0373931_0336491 3300035691 Bacteria 941
328 Ga0373935_0120880 3300035692 Bacteria 1750
329 Ga0373947_0063442 3300035725 Bacteria 2251
330 Ga0395900_0106746 3300037418 Bacteria 2877
331 Ga0395898_0118412 3300037466 Bacteria 2537
332 Ga0395898_0331611 3300037466 Bacteria 1451
333 Ga0395898_1105269 3300037466 Bacteria 726
334 Ga0395905_1094699 3300037471 Bacteria 700
335 Ga0436364_0066094 3300037853 Bacteria 974
336 Ga0395901_0063486 3300038443 Bacteria 3844
337 Ga0395901_0089055 3300038443 Bacteria 3229
338 Ga0395901_0092686 3300038443 Bacteria 3162
339 Ga0395901_0219062 3300038443 Bacteria 1990
340 Ga0395901_0523092 3300038443 Bacteria 1205
341 Ga0395901_1152982 3300038443 Bacteria 743
342 Ga0436360_1320610 3300039438 Bacteria 958
343 Ga0436363_1365017 3300039450 Bacteria 576
344 Ga0451843_0111454 3300041509 Bacteria 713
345 Ga0439463_078184 3300042016 Bacteria 850
346 Ga0439464_0036433 3300042439 Bacteria 1391
347 Ga0439464_0102972 3300042439 Bacteria 869
348 Ga0450916_017951 3300042530 Bacteria 950
349 Ga0439440_0056502 3300042993 Bacteria 993
350 Ga0466966_0171089 3300044684 Bacteria 1320
351 Ga0466961_0504145 3300044693 Bacteria 731
352 Ga0466961_0651901 3300044693 Bacteria 632
353 Ga0466963_0042622 3300044694 Bacteria 2981
354 Ga0466963_0297312 3300044694 Bacteria 1135
355 Ga0466963_0751839 3300044694 Bacteria 688
356 Ga0466964_0005813 3300044706 Bacteria 4590
357 Ga0466964_0179316 3300044706 Bacteria 1003
358 Ga0466971_0035313 3300044719 Bacteria 2241
359 Ga0466971_0098947 3300044719 Bacteria 1339
360 Ga0466968_0215296 3300044735 Bacteria 903
361 Ga0466968_0270334 3300044735 Bacteria 811
362 Ga0466970_0362714 3300044765 Bacteria 823
363 Ga0466957_0057536 3300044842 Bacteria 2380
364 Ga0466957_0638425 3300044842 Bacteria 748
365 Ga0466959_0026246 3300045049 Bacteria 4318
366 Ga0466958_0020551 3300045836 Bacteria 3852
367 Ga0466958_0033244 3300045836 Bacteria 3072
368 Ga0466967_0099781 3300045976 Bacteria 2652
369 Ga0466967_0110057 3300045976 Bacteria 2530
370 Ga0466967_0167651 3300045976 Bacteria 2064
371 Ga0466967_0468127 3300045976 Bacteria 1233
372 Ga0466967_0668688 3300045976 Bacteria 1028
373 Ga0466967_1481575 3300045976 Bacteria 676
374 Ga0495590_0257604 3300046457 Bacteria 650
375 Ga0495664_0140735 3300046477 Bacteria 1463
376 Ga0495664_0348253 3300046477 Bacteria 892
377 Ga0495584_0324283 3300046491 Bacteria 782
378 Ga0495585_0192687 3300046492 Bacteria 1042
379 Ga0495596_0064163 3300046500 Bacteria 1429
380 Ga0495596_0080778 3300046500 Bacteria 1262
381 Ga0495607_0409217 3300046501 Bacteria 616
382 Ga0495616_0205861 3300046513 Bacteria 863
383 Ga0495616_0333723 3300046513 Bacteria 634
384 Ga0495631_0122587 3300046518 Bacteria 1118
385 Ga0495637_0157474 3300046520 Bacteria 854
386 Ga0495644_0147255 3300046523 Bacteria 901
387 Ga0495663_0060868 3300046525 Bacteria 1187
388 Ga0495663_0117579 3300046525 Bacteria 888
389 Ga0495652_0030417 3300046529 Bacteria 4737
390 Ga0495667_0490784 3300046559 Bacteria 770
391 Ga0495656_0207490 3300046615 Bacteria 975
392 Ga0495661_0234451 3300046665 Bacteria 945
393 Ga0495670_0295187 3300046691 Bacteria 868
394 Ga0495589_0028505 3300046794 Bacteria 2818
395 Ga0495636_0364565 3300047318 Bacteria 684
396 Ga0495672_0082597 3300047320 Bacteria 1786
397 Ga0495676_0357904 3300047321 Bacteria 975
398 Ga0496100_0194860 3300048903 Bacteria 1473
399 Ga0496100_0780771 3300048903 Bacteria 748
400 Ga0496100_1016442 3300048903 Bacteria 652
401 Ga0496101_0011356 3300048904 Bacteria 5907
402 Ga0496102_0288491 3300048905 Bacteria 1547
403 Ga0496103_0096645 3300048906 Bacteria 1867
404 Ga0496103_0160761 3300048906 Bacteria 1441
405 Ga0496103_0507755 3300048906 Bacteria 771
406 Ga0496103_0530021 3300048906 Bacteria 753
407 Ga0496104_0022432 3300048907 Bacteria 5800
408 Ga0496104_0116701 3300048907 Bacteria 2561
409 Ga0496104_0620581 3300048907 Bacteria 991
410 Ga0496105_0013062 3300048908 Bacteria 6583
411 Ga0496105_0090358 3300048908 Bacteria 2529
412 Ga0496105_0366569 3300048908 Bacteria 1148
413 Ga0496107_0439847 3300048910 Bacteria 969
414 Ga0496108_0057188 3300048911 Bacteria 3277
415 Ga0496108_0453419 3300048911 Bacteria 1120
416 Ga0496109_0026338 3300048912 Bacteria 5185
417 Ga0496109_0170429 3300048912 Bacteria 2042
418 Ga0496109_0863427 3300048912 Bacteria 843
419 Ga0496110_0042697 3300048913 Bacteria 3958
420 Ga0496110_0050218 3300048913 Bacteria 3662
421 Ga0496110_0262812 3300048913 Bacteria 1571
422 Ga0496111_0037257 3300048914 Bacteria 3481
423 Ga0496111_0113033 3300048914 Bacteria 2001
424 Ga0496111_0400574 3300048914 Bacteria 1014
425 Ga0496112_0081740 3300048915 Bacteria 3195
426 Ga0496112_0116445 3300048915 Bacteria 2643
427 Ga0496112_0219912 3300048915 Bacteria 1855
428 Ga0496112_0770671 3300048915 Bacteria 888
429 Ga0496112_1330472 3300048915 Bacteria 634
430 Ga0496113_0056441 3300048916 Bacteria 2948
431 Ga0496113_0978212 3300048916 Bacteria 667
432 Ga0496114_0300172 3300048917 Bacteria 1418
433 Ga0496115_0200342 3300048918 Bacteria 1649
434 Ga0496115_0674501 3300048918 Bacteria 815
435 Ga0501031_0118897 3300049568 Bacteria 1727
436 Ga0501036_0295975 3300049572 Bacteria 1354
437 Ga0501037_0543610 3300049573 Bacteria 785
438 Ga0501039_0765279 3300049575 Bacteria 754
439 Ga0501040_0060491 3300049576 Bacteria 2603
440 Ga0501040_0096237 3300049576 Bacteria 2061
441 Ga0501041_0476855 3300049577 Bacteria 793
442 Ga0501043_0907335 3300049579 Bacteria 632
443 Ga0501048_0327693 3300049582 Bacteria 1091
444 Ga0501048_0487500 3300049582 Bacteria 884
445 Ga0501067_0421963 3300049583 Bacteria 744
446 Ga0501070_0390037 3300049586 Bacteria 1127
447 Ga0501071_0653318 3300049587 Bacteria 809
448 Ga0501072_0645050 3300049588 Bacteria 834
449 Ga0501075_0098397 3300049591 Bacteria 2221
450 Ga0501075_0622780 3300049591 Bacteria 823
451 Ga0501076_0458832 3300049592 Bacteria 1049
452 Ga0501076_0532682 3300049592 Bacteria 968
453 Ga0501076_0767658 3300049592 Bacteria 795
454 Ga0501079_0105128 3300049741 Bacteria 2191
455 Ga0501079_0629395 3300049741 Bacteria 845
456 Ga0501081_0135458 3300049743 Bacteria 1763
457 Ga0501081_0272360 3300049743 Bacteria 1238
458 Ga0501081_0842140 3300049743 Bacteria 691
459 Ga0501083_0989232 3300049744 Bacteria 547
460 Ga0501045_0619780 3300049824 Bacteria 801
461 nmdc:mga03n38_230433_c1 3300050490 Bacteria 971
462 nmdc:mga0yw44_92439_c1 3300050492 Bacteria 1914
463 nmdc:mga05p37_1642230_c1 3300050507 Bacteria 630
464 nmdc:mga05p37_1849201_c1 3300050507 Bacteria 580
465 nmdc:mga05p37_50983_c1 3300050507 Bacteria 5089
466 nmdc:mga05p37_85673_c1 3300050507 Bacteria 3883
467 nmdc:mga05p37_90416_c1 3300050507 Bacteria 3773
468 nmdc:mga09592_193299_c1 3300050508 Bacteria 1761
469 nmdc:mga09592_57037_c1 3300050508 Bacteria 3300
470 nmdc:mga09592_836187_c1 3300050508 Bacteria 777
471 nmdc:mga0qj67_107540_c1 3300050509 Bacteria 2250
472 nmdc:mga0qj67_334385_c1 3300050509 Bacteria 1225
473 nmdc:mga0qj67_8062_c1 3300050509 Bacteria 7795
474 nmdc:mga06r32_78480_c1 3300050510 Bacteria 3210
475 nmdc:mga06r32_9525_c1 3300050510 Bacteria 8769
476 nmdc:mga08y16_177411_c1 3300050511 Bacteria 2212
477 nmdc:mga08y16_210874_c1 3300050511 Bacteria 2012
478 nmdc:mga08y16_705687_c1 3300050511 Bacteria 1008
479 nmdc:mga08y16_95063_c1 3300050511 Bacteria 3104
480 nmdc:mga0n895_102442_c1 3300050512 Bacteria 2873
481 nmdc:mga0n895_11367_c1 3300050512 Bacteria 7938
482 nmdc:mga0rr50_87627_c1 3300050513 Bacteria 2417
483 nmdc:mga08x19_400941_c1 3300050514 Bacteria 962
484 nmdc:mga08x19_735863_c1 3300050514 Bacteria 700
485 nmdc:mga0a205_6973_c1 3300050515 Bacteria 10216
486 Ga0495655_0187402 3300053083 Bacteria 670
487 Ga0495655_0292280 3300053083 Unclassified 558
488 Ga0500641_0291060 3300053096 Bacteria 674
489 Ga0500556_0000943 3300053104 Bacteria 15733
490 Ga0500616_0069326 3300053153 Bacteria 1803
491 Ga0500599_022671 3300053736 Bacteria 898
492 Ga0501084_0259814 3300054114 Bacteria 1466
493 Ga0501084_0381200 3300054114 Bacteria 1192
494 Ga0501082_0243895 3300060353 Bacteria 1564
495 Ga0466962_0032640 3300061719 Bacteria 2492
496 Ga0530510_0009636 3300061734 Bacteria 6776
497 Ga0436364_0340800
498 LJNas_1021762
499 JGI25407J50210_10000453
500 JGI25407J50210_10002649
501 JGI25407J50210_10024005
502 JGI25407J50210_10028605
503 JGI25407J50210_10056523
504 Ga0070658_10039906
505 Ga0070658_10398712
506 Ga0070658_10456835
507 Ga0070683_100065875
508 Ga0070683_100293335
509 Ga0070670_101164602
510 Ga0068869_100175532
511 Ga0070682_100031798
512 Ga0070682_100321742
513 Ga0068868_100109947
514 Ga0070691_10024706
515 Ga0070691_10074508
516 Ga0070691_10294857
517 Ga0070668_100019159
518 Ga0070668_100949726
519 Ga0070669_100317597
520 Ga0070675_100160079
521 Ga0070675_100457201
522 Ga0070674_100552705
523 Ga0070673_100297476
524 Ga0070688_100536054
525 Ga0070659_100708699
526 Ga0070667_100751563
527 Ga0070703_10075760
528 Ga0070703_10075799
529 Ga0070714_100016917
530 Ga0070714_100069204
531 Ga0070714_100280031
532 Ga0070714_100456073
533 Ga0070714_100580983
534 Ga0070713_100079217
535 Ga0070713_100274188
536 Ga0070701_10458349
537 Ga0070711_100029495
538 Ga0070700_100088725
539 Ga0070700_100460564
540 Ga0070700_100532117
541 Ga0070700_100620533
542 Ga0070694_100504638
543 Ga0070663_100045561
544 Ga0070678_100291685
545 Ga0070662_100005715
546 Ga0068867_100135125
547 Ga0068867_100430531
548 Ga0070685_10330080
549 Ga0070707_100629968
550 Ga0070679_100039791
551 Ga0070679_100895601
552 Ga0070684_100031818
553 Ga0070684_100915753
554 Ga0070672_100123427
555 Ga0070672_100542953
556 Ga0070686_100157593
557 Ga0070704_100046350
558 Ga0070704_100491247
559 Ga0068855_100748822
560 Ga0070664_100356056
561 Ga0068854_101245532
562 Ga0068854_101262118
563 Ga0068856_100004619
564 Ga0068856_100721874
565 Ga0068856_101660506
566 Ga0070702_100003160
567 Ga0070702_101308912
568 Ga0068859_100666693
569 Ga0068864_100100019
570 Ga0068864_100226661
571 Ga0068866_10100145
572 Ga0068861_100025907
573 Ga0068861_101002847
574 Ga0068870_10789223
575 Ga0068860_100288209
576 Ga0068860_100989027
577 Ga0068862_100827717
578 Ga0068862_101612784
579 Ga0081455_10090033
580 Ga0081538_10000124
581 Ga0081538_10000132
582 Ga0081538_10000182
583 Ga0081538_10000280
584 Ga0081538_10000682
585 Ga0081538_10000760
586 Ga0081538_10001936
587 Ga0081538_10015017
588 Ga0081538_10017909
589 Ga0081538_10020620
590 Ga0081538_10027007
591 Ga0081538_10033176
592 Ga0081538_10080174
593 Ga0081538_10207878
594 Ga0081539_10110063
595 Ga0070717_10003068
596 Ga0070717_10072046
597 Ga0070717_10233027
598 Ga0075365_10079704
599 Ga0075365_10503483
600 Ga0075363_100269282
601 Ga0075364_10686489
602 Ga0075432_10019233
603 Ga0075432_10026922
604 Ga0075432_10081205
605 Ga0075432_10185155
606 Ga0070716_100257004
607 Ga0070716_100729664
608 Ga0070712_100010577
609 Ga0070712_100332654
610 Ga0075428_100088756
611 Ga0075428_100112834
612 Ga0075428_100185973
613 Ga0075428_100231339
614 Ga0075428_100617111
615 Ga0075428_100751456
616 Ga0075430_100003121
617 Ga0075430_100202538
618 Ga0075430_100292685
619 Ga0075430_100438179
620 Ga0075431_100028408
621 Ga0075431_100045452
622 Ga0075433_10044934
623 Ga0075433_10432210
624 Ga0075434_100016436
625 Ga0075434_100294482
626 Ga0075434_100989961
627 Ga0075429_100040897
628 Ga0075429_100061715
629 Ga0075429_100356512
630 Ga0075429_100713067
631 Ga0075429_100947975
632 Ga0068865_100109676
633 Ga0068865_100633822
634 Ga0068865_100948234
635 Ga0075436_100071162
636 Ga0075436_100934174
637 Ga0097620_100666672
638 Ga0075435_100025162
639 Ga0111539_10063139
640 Ga0111539_10697089
641 Ga0111539_12072694
642 Ga0111539_12720102
643 Ga0105245_10003103
644 Ga0105245_10058632
645 Ga0105245_10113853
646 Ga0105245_11432318
647 Ga0105247_10097051
648 Ga0114129_10013338
649 Ga0114129_10026591
650 Ga0114129_10874987
651 Ga0114129_11171520
652 Ga0114129_12797107
653 Ga0114129_13424485
654 Ga0105243_10172388
655 Ga0105243_10401045
656 Ga0105243_10477490
657 Ga0105243_11223942
658 Ga0105243_12273185
659 Ga0105241_10407505
660 Ga0105248_10442300
661 Ga0105248_11802826
662 Ga0105237_10291977
663 Ga0105237_10884888
664 Ga0105238_10350534
665 Ga0105238_10879195
666 Ga0105249_10022114
667 Ga0105249_12508086
668 Ga0105239_10045602
669 Ga0105239_10070211
670 Ga0105239_10706368
671 Ga0105239_11108459
672 Ga0105246_11858901
673 Ga0157369_10475074
674 Ga0157369_11206091
675 Ga0157374_10175121
676 Ga0157374_11258992
677 Ga0157378_10437250
678 Ga0157378_10776950
679 Ga0163162_10183048
680 Ga0163162_11313452
681 Ga0157372_10982126
682 Ga0157372_11119827
683 Ga0157372_11523133
684 Ga0157372_11686254
685 Ga0157375_10144087
686 Ga0157375_10643352
687 Ga0157375_11356760
688 Ga0163163_10042235
689 Ga0163163_10134347
690 Ga0163163_11501739
691 Ga0157380_10067398
692 Ga0157380_10551459
693 Ga0157380_10747532
694 Ga0157377_10128724
695 Ga0157377_10308588
696 Ga0157377_10877029
697 Ga0157377_11179242
698 Ga0157376_11107800
699 Ga0163161_10211702
700 Ga0213875_10000617
701 Ga0207692_10042374
702 Ga0207692_10411582
703 Ga0207642_10350843
704 Ga0207688_10095711
705 Ga0207688_10120985
706 Ga0207688_10257320
707 Ga0207699_10887131
708 Ga0207705_10038337
709 Ga0207693_10028813
710 Ga0207693_10059940
711 Ga0207693_10320385
712 Ga0207663_10040026
713 Ga0207660_10215567
714 Ga0207660_10760594
715 Ga0207657_10109659
716 Ga0207652_10020680
717 Ga0207681_10140186
718 Ga0207681_10643022
719 Ga0207694_10175557
720 Ga0207650_10615455
721 Ga0207659_10253279
722 Ga0207687_10086170
723 Ga0207687_10112947
724 Ga0207687_10886414
725 Ga0207700_10076392
726 Ga0207700_10084372
727 Ga0207700_10183723
728 Ga0207664_10001591
729 Ga0207664_10032825
730 Ga0207664_10184486
731 Ga0207664_10296646
732 Ga0207706_10005511
733 Ga0207706_10156904
734 Ga0207686_10235189
735 Ga0207686_11025947
736 Ga0207709_10383765
737 Ga0207709_10771646
738 Ga0207709_11000898
739 Ga0207669_10473508
740 Ga0207665_10224690
741 Ga0207691_10505021
742 Ga0207691_10569455
743 Ga0207689_10060592
744 Ga0207661_10054780
745 Ga0207661_10480844
746 Ga0207679_10014941
747 Ga0207667_10708257
748 Ga0207651_10376569
749 Ga0207712_10032133
750 Ga0207712_10261941
751 Ga0207668_10015590
752 Ga0207668_10311566
753 Ga0207668_11018916
754 Ga0207658_10212979
755 Ga0207658_10690387
756 Ga0207677_10068466
757 Ga0207708_10000458
758 Ga0207708_10074679
759 Ga0207708_10118260
760 Ga0207708_10274122
761 Ga0207708_10481345
762 Ga0207702_10391567
763 Ga0207702_11061822
764 Ga0207641_10556873
765 Ga0207641_11374749
766 Ga0207648_10058280
767 Ga0207676_10413409
768 Ga0207676_10833523
769 Ga0207675_100007967
770 Ga0207675_100104323
771 Ga0207675_100159746
772 Ga0207675_100361460
773 Ga0207683_10073394
774 Ga0207683_10180332
775 Ga0207683_10633285
776 Ga0207698_10815706
777 Ga0207428_10011016
778 Ga0207428_10198777
779 Ga0207428_10345356
780 Ga0207428_10445476
781 Ga0268265_10350425
782 Ga0268265_10514070
783 Ga0268265_10635468
784 Ga0268264_10201783
785 Ga0307408_100208450
786 Ga0307408_100717088
787 Ga0307408_101353971
788 Ga0307408_101779039
789 Ga0307405_10057939
790 Ga0307405_10060466
791 Ga0307405_10113100
792 Ga0307405_10309357
793 Ga0307413_10118419
794 Ga0307413_10194851
795 Ga0307413_10744535
796 Ga0307410_10152273
797 Ga0307410_10451835
798 Ga0307406_10169090
799 Ga0307406_10586140
800 Ga0307406_10613266
801 Ga0307406_10848308
802 Ga0307407_10282103
803 Ga0307409_100230666
804 Ga0307409_100300753
805 Ga0307409_100302371
806 Ga0307409_100356417
807 Ga0307409_101705450
808 Ga0307416_100022144
809 Ga0307416_100032619
810 Ga0307416_100121837
811 Ga0307416_100170465
812 Ga0307416_100248631
813 Ga0307414_10879818
814 Ga0307414_11264215
815 Ga0307411_10723404
816 Ga0307415_100005825
817 Ga0307415_100048295
818 Ga0307415_100142214
819 Ga0307415_100915940
820 Ga0373941_0073772
821 Ga0373943_0047789
822 Ga0373961_0030151
823 Ga0373931_0336491
824 Ga0373935_0120880
825 Ga0373947_0063442
826 Ga0395900_0106746
827 Ga0395898_0118412
828 Ga0395898_0331611
829 Ga0395898_1105269
830 Ga0395905_1094699
831 Ga0436364_0066094
832 Ga0395901_0063486
833 Ga0395901_0089055
834 Ga0395901_0092686
835 Ga0395901_0219062
836 Ga0395901_0523092
837 Ga0395901_1152982
838 Ga0436360_1320610
839 Ga0436363_1365017
840 Ga0451843_0111454
841 Ga0439463_078184
842 Ga0439464_0036433
843 Ga0439464_0102972
844 Ga0450916_017951
845 Ga0439440_0056502
846 Ga0466966_0171089
847 Ga0466961_0504145
848 Ga0466961_0651901
849 Ga0466963_0042622
850 Ga0466963_0297312
851 Ga0466963_0751839
852 Ga0466964_0005813
853 Ga0466964_0179316
854 Ga0466971_0035313
855 Ga0466971_0098947
856 Ga0466968_0215296
857 Ga0466968_0270334
858 Ga0466970_0362714
859 Ga0466957_0057536
860 Ga0466957_0638425
861 Ga0466959_0026246
862 Ga0466958_0020551
863 Ga0466958_0033244
864 Ga0466967_0099781
865 Ga0466967_0110057
866 Ga0466967_0167651
867 Ga0466967_0468127
868 Ga0466967_0668688
869 Ga0466967_1481575
870 Ga0495590_0257604
871 Ga0495664_0140735
872 Ga0495664_0348253
873 Ga0495584_0324283
874 Ga0495585_0192687
875 Ga0495596_0064163
876 Ga0495596_0080778
877 Ga0495607_0409217
878 Ga0495616_0205861
879 Ga0495616_0333723
880 Ga0495631_0122587
881 Ga0495637_0157474
882 Ga0495644_0147255
883 Ga0495663_0060868
884 Ga0495663_0117579
885 Ga0495652_0030417
886 Ga0495667_0490784
887 Ga0495656_0207490
888 Ga0495661_0234451
889 Ga0495670_0295187
890 Ga0495589_0028505
891 Ga0495636_0364565
892 Ga0495672_0082597
893 Ga0495676_0357904
894 Ga0496100_0194860
895 Ga0496100_0780771
896 Ga0496100_1016442
897 Ga0496101_0011356
898 Ga0496102_0288491
899 Ga0496103_0096645
900 Ga0496103_0160761
901 Ga0496103_0507755
902 Ga0496103_0530021
903 Ga0496104_0022432
904 Ga0496104_0116701
905 Ga0496104_0620581
906 Ga0496105_0013062
907 Ga0496105_0090358
908 Ga0496105_0366569
909 Ga0496107_0439847
910 Ga0496108_0057188
911 Ga0496108_0453419
912 Ga0496109_0026338
913 Ga0496109_0170429
914 Ga0496109_0863427
915 Ga0496110_0042697
916 Ga0496110_0050218
917 Ga0496110_0262812
918 Ga0496111_0037257
919 Ga0496111_0113033
920 Ga0496111_0400574
921 Ga0496112_0081740
922 Ga0496112_0116445
923 Ga0496112_0219912
924 Ga0496112_0770671
925 Ga0496112_1330472
926 Ga0496113_0056441
927 Ga0496113_0978212
928 Ga0496114_0300172
929 Ga0496115_0200342
930 Ga0496115_0674501
931 Ga0501031_0118897
932 Ga0501036_0295975
933 Ga0501037_0543610
934 Ga0501039_0765279
935 Ga0501040_0060491
936 Ga0501040_0096237
937 Ga0501041_0476855
938 Ga0501043_0907335
939 Ga0501048_0327693
940 Ga0501048_0487500
941 Ga0501067_0421963
942 Ga0501070_0390037
943 Ga0501071_0653318
944 Ga0501072_0645050
945 Ga0501075_0098397
946 Ga0501075_0622780
947 Ga0501076_0458832
948 Ga0501076_0532682
949 Ga0501076_0767658
950 Ga0501079_0105128
951 Ga0501079_0629395
952 Ga0501081_0135458
953 Ga0501081_0272360
954 Ga0501081_0842140
955 Ga0501083_0989232
956 Ga0501045_0619780
957 nmdc:mga03n38_230433_c1
958 nmdc:mga0yw44_92439_c1
959 nmdc:mga05p37_1642230_c1
960 nmdc:mga05p37_1849201_c1
961 nmdc:mga05p37_50983_c1
962 nmdc:mga05p37_85673_c1
963 nmdc:mga05p37_90416_c1
964 nmdc:mga09592_193299_c1
965 nmdc:mga09592_57037_c1
966 nmdc:mga09592_836187_c1
967 nmdc:mga0qj67_107540_c1
968 nmdc:mga0qj67_334385_c1
969 nmdc:mga0qj67_8062_c1
970 nmdc:mga06r32_78480_c1
971 nmdc:mga06r32_9525_c1
972 nmdc:mga08y16_177411_c1
973 nmdc:mga08y16_210874_c1
974 nmdc:mga08y16_705687_c1
975 nmdc:mga08y16_95063_c1
976 nmdc:mga0n895_102442_c1
977 nmdc:mga0n895_11367_c1
978 nmdc:mga0rr50_87627_c1
979 nmdc:mga08x19_400941_c1
980 nmdc:mga08x19_735863_c1
981 nmdc:mga0a205_6973_c1
982 Ga0495655_0187402
983 Ga0495655_0292280
984 Ga0500641_0291060
985 Ga0500556_0000943
986 Ga0500616_0069326
987 Ga0500599_022671
988 Ga0501084_0259814
989 Ga0501084_0381200
990 Ga0501082_0243895
991 Ga0466962_0032640
992 Ga0530510_0009636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

16

125

0.9

PF13480

Acetyltransf_6

Acetyltransferase (GNAT) domain

19

110

0.84

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

38

139

0.84

PF08445

FR47

FR47-like protein

45

135

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

43

127

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.9203 9 149
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.905 9 149
7l1k-assembly1.cif.gz_A cryo-em structure of s. pombe natc complex with a bisubstrate inhibitor and inositol hexaphosphate 0.8922 9 150
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.89 9 129
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.8867 6 149
ID Description Score Start End Superfamily
af_I6YG32_8_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9414 9 149 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9203 105 149 3.40.630.30
af_Q58925_1_145_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9189 9 149 3.40.630.30
af_O16486_94_277_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.916 9 149 3.40.630.30
4pv6F00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.908 7 149 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7W0JZG2-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9927 11 149 GO:0005737
GO:0005840
GO:0008080
AF-A0A6J4S7N2-F1-model_v4 Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.128) 0.978 5 161 GO:0008999
AF-A0A538J0F9-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9735 2 149 GO:0008080
AF-A0A538LRL0-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9733 9 168 GO:0008080
AF-A0A6N7YEX1-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9704 9 168 GO:0008080

Map