F454879

General Info

Members Datasets Scaffolds Average Seq Length
496 208 992 257

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10153931|Ga0105240_101539312
Length 281
Sequence MVVDSRVKRASVDSREAGKYKPANVPTISELFDLTGRAAIVTGGSRGLGEEMAEGLAEAGASLMLCARREEWLTPTVDRLRGCGFAVDGIVCDVARQTDVDRVVQATVARFGKVDILVNNAGVTWASEPEAMPLDKWQKVVDINLTGAFLFAQAAARDMLKRERGRIINVASIAGLQGSVNGPHFAGYAATKAGLLGLTRELAASWGRSGIRVNAIAPGFFHSRLADAAIALTESSIKASSPIPRVGEPGELKGVCVFLAADASNYITGQTIIVDGGRTIA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
208 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 3.43
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10153931 3300009093 Bacteria 2736
2 SwRhRL2b_contig_2880178 2162886007 Bacteria 4516
3 Ga0065704_10003795 3300005289 Bacteria 5706
4 Ga0065712_10012272 3300005290 Bacteria 2633
5 Ga0065712_10072470 3300005290 Bacteria 4743
6 Ga0065712_10117119 3300005290 Bacteria 1725
7 Ga0065715_10007341 3300005293 Bacteria 4272
8 Ga0065715_10092171 3300005293 Bacteria 5283
9 Ga0065715_10101048 3300005293 Bacteria 3242
10 Ga0065707_10001818 3300005295 Bacteria 6819
11 Ga0065707_10092896 3300005295 Bacteria 3702
12 Ga0070683_100001766 3300005329 Bacteria 16828
13 Ga0070690_100021716 3300005330 Bacteria 3922
14 Ga0070690_100140652 3300005330 Unclassified 1638
15 Ga0070670_100013733 3300005331 Bacteria 6940
16 Ga0070670_100026255 3300005331 Bacteria 5014
17 Ga0070677_10049100 3300005333 Bacteria 1698
18 Ga0070666_10159501 3300005335 Bacteria 1576
19 Ga0070682_100408982 3300005337 Bacteria 1028
20 Ga0070689_100002744 3300005340 Bacteria 11548
21 Ga0070689_100025763 3300005340 Unclassified 4420
22 Ga0070687_100010167 3300005343 Bacteria 4057
23 Ga0070687_100051846 3300005343 Bacteria 2127
24 Ga0070687_100347197 3300005343 Bacteria 956
25 Ga0070661_100021039 3300005344 Bacteria 4657
26 Ga0070661_100208780 3300005344 Bacteria 1494
27 Ga0070692_10167483 3300005345 Bacteria 1264
28 Ga0070668_100041928 3300005347 Bacteria 3507
29 Ga0070668_100095609 3300005347 Bacteria 2347
30 Ga0070669_100000822 3300005353 Bacteria 22595
31 Ga0070669_100025666 3300005353 Bacteria 4233
32 Ga0070669_100457880 3300005353 Bacteria 1052
33 Ga0070675_100000142 3300005354 Bacteria 42794
34 Ga0070675_100072237 3300005354 Bacteria 2864
35 Ga0070675_100094306 3300005354 Bacteria 2511
36 Ga0070675_100490081 3300005354 Bacteria 1106
37 Ga0070671_100018611 3300005355 Bacteria 5644
38 Ga0070674_100046822 3300005356 Bacteria 2961
39 Ga0070674_100421542 3300005356 Bacteria 1095
40 Ga0070673_100059491 3300005364 Bacteria 3025
41 Ga0070688_100013994 3300005365 Bacteria 4538
42 Ga0070688_100034160 3300005365 Bacteria 3078
43 Ga0070688_100068504 3300005365 Bacteria 2263
44 Ga0070659_100122778 3300005366 Bacteria 2105
45 Ga0070667_100033594 3300005367 Bacteria 4289
46 Ga0070667_100409447 3300005367 Bacteria 1235
47 Ga0070703_10135002 3300005406 Bacteria 911
48 Ga0070711_100115707 3300005439 Bacteria 1975
49 Ga0070705_100001154 3300005440 Bacteria 14538
50 Ga0070705_100019602 3300005440 Bacteria 3562
51 Ga0070700_100086294 3300005441 Bacteria 2037
52 Ga0070694_100008486 3300005444 Bacteria 6287
53 Ga0070694_100065095 3300005444 Bacteria 2496
54 Ga0070694_100339832 3300005444 Bacteria 1160
55 Ga0070708_100230858 3300005445 Bacteria 1736
56 Ga0070708_100263687 3300005445 Bacteria 1620
57 Ga0070662_100018673 3300005457 Bacteria 4695
58 Ga0070681_10085304 3300005458 Bacteria 3111
59 Ga0068867_100019273 3300005459 Bacteria 4863
60 Ga0070706_100150114 3300005467 Bacteria 2175
61 Ga0070707_100020603 3300005468 Bacteria 6222
62 Ga0070707_100034363 3300005468 Bacteria 4835
63 Ga0070707_100094492 3300005468 Bacteria 2895
64 Ga0070707_100109366 3300005468 Bacteria 2681
65 Ga0070707_100523140 3300005468 Bacteria 1148
66 Ga0070698_100002070 3300005471 Bacteria 22289
67 Ga0070698_100047545 3300005471 Bacteria 4385
68 Ga0070698_100049033 3300005471 Bacteria 4313
69 Ga0070698_100067042 3300005471 Bacteria 3610
70 Ga0070698_100445716 3300005471 Bacteria 1230
71 Ga0070699_100000525 3300005518 Bacteria 36238
72 Ga0070699_100000678 3300005518 Bacteria 31777
73 Ga0070699_100001984 3300005518 Bacteria 18453
74 Ga0070699_100003314 3300005518 Bacteria 14237
75 Ga0070699_100029711 3300005518 Bacteria 4713
76 Ga0070699_100030130 3300005518 Bacteria 4682
77 Ga0070679_100323719 3300005530 Bacteria 1490
78 Ga0070684_100069728 3300005535 Bacteria 3092
79 Ga0070684_100093799 3300005535 Bacteria 2672
80 Ga0070697_100013882 3300005536 Bacteria 6323
81 Ga0068853_100240727 3300005539 Bacteria 1658
82 Ga0070672_100035377 3300005543 Bacteria 3797
83 Ga0070672_100079657 3300005543 Bacteria 2622
84 Ga0070672_100088611 3300005543 Bacteria 2492
85 Ga0070686_100041409 3300005544 Bacteria 2879
86 Ga0070695_100000127 3300005545 Bacteria 34359
87 Ga0070695_100000737 3300005545 Bacteria 17463
88 Ga0070695_100310245 3300005545 Bacteria 1169
89 Ga0070696_100006791 3300005546 Bacteria 7642
90 Ga0070696_100009547 3300005546 Bacteria 6496
91 Ga0070696_100036568 3300005546 Bacteria 3385
92 Ga0070696_100037162 3300005546 Bacteria 3358
93 Ga0070693_100002801 3300005547 Bacteria 8021
94 Ga0070665_100125787 3300005548 Bacteria 2566
95 Ga0070704_100001350 3300005549 Bacteria 13007
96 Ga0070704_100020130 3300005549 Bacteria 4297
97 Ga0070704_100242313 3300005549 Bacteria 1476
98 Ga0070704_100276415 3300005549 Bacteria 1389
99 Ga0068855_100357560 3300005563 Bacteria 1607
100 Ga0070664_100000222 3300005564 Bacteria 40764
101 Ga0070664_100044118 3300005564 Bacteria 3765
102 Ga0070664_100118165 3300005564 Bacteria 2319
103 Ga0070664_100437686 3300005564 Bacteria 1199
104 Ga0068857_100012737 3300005577 Bacteria 7329
105 Ga0068857_100029853 3300005577 Bacteria 4811
106 Ga0068857_100209947 3300005577 Bacteria 1776
107 Ga0068856_100192949 3300005614 Bacteria 2051
108 Ga0070702_100015404 3300005615 Bacteria 3904
109 Ga0070702_100054990 3300005615 Bacteria 2293
110 Ga0070702_100387070 3300005615 Bacteria 996
111 Ga0068859_100000875 3300005617 Bacteria 30715
112 Ga0068859_100013050 3300005617 Bacteria 8348
113 Ga0068859_100014983 3300005617 Bacteria 7784
114 Ga0068859_100107450 3300005617 Bacteria 2851
115 Ga0068859_100151055 3300005617 Bacteria 2398
116 Ga0068859_101050049 3300005617 Bacteria 895
117 Ga0068864_100007011 3300005618 Bacteria 9247
118 Ga0068864_100271497 3300005618 Bacteria 1580
119 Ga0068864_100382298 3300005618 Bacteria 1334
120 Ga0068861_100004101 3300005719 Bacteria 9769
121 Ga0068861_100055707 3300005719 Bacteria 3016
122 Ga0068870_10001393 3300005840 Bacteria 9764
123 Ga0068870_10081886 3300005840 Unclassified 1786
124 Ga0068860_100000300 3300005843 Bacteria 68717
125 Ga0068860_100003543 3300005843 Bacteria 16050
126 Ga0068860_100057823 3300005843 Bacteria 3687
127 Ga0068860_100176334 3300005843 Bacteria 2066
128 Ga0068862_100000478 3300005844 Bacteria 42908
129 Ga0068862_100014697 3300005844 Bacteria 6503
130 Ga0081455_10064369 3300005937 Bacteria 3070
131 Ga0070717_10342061 3300006028 Bacteria 1336
132 Ga0075365_10270724 3300006038 Bacteria 1194
133 Ga0075365_10283216 3300006038 Bacteria 1166
134 Ga0075368_10075404 3300006042 Bacteria 1367
135 Ga0075363_100274599 3300006048 Bacteria 974
136 Ga0097621_100090376 3300006237 Bacteria 2562
137 Ga0097621_100291344 3300006237 Bacteria 1439
138 Ga0068871_100212704 3300006358 Bacteria 1673
139 Ga0075428_100002788 3300006844 Bacteria 19013
140 Ga0075428_100011309 3300006844 Bacteria 9930
141 Ga0075428_100024598 3300006844 Bacteria 6664
142 Ga0075428_100070823 3300006844 Bacteria 3811
143 Ga0075428_100146848 3300006844 Bacteria 2563
144 Ga0075428_100342237 3300006844 Bacteria 1606
145 Ga0075430_100032364 3300006846 Bacteria 4439
146 Ga0075431_100001331 3300006847 Bacteria 22561
147 Ga0075431_100007090 3300006847 Bacteria 11134
148 Ga0075433_10007488 3300006852 Bacteria 8667
149 Ga0075433_10025695 3300006852 Bacteria 4980
150 Ga0075433_10037731 3300006852 Bacteria 4169
151 Ga0075433_10047266 3300006852 Bacteria 3743
152 Ga0075433_10050531 3300006852 Bacteria 3620
153 Ga0075433_10062303 3300006852 Bacteria 3266
154 Ga0075433_10068917 3300006852 Bacteria 3106
155 Ga0075433_10130330 3300006852 Bacteria 2234
156 Ga0075433_10142639 3300006852 Bacteria 2129
157 Ga0075433_10647536 3300006852 Bacteria 926
158 Ga0075434_100001923 3300006871 Bacteria 18014
159 Ga0075434_100003446 3300006871 Bacteria 14139
160 Ga0075434_100010415 3300006871 Bacteria 8714
161 Ga0075434_100039389 3300006871 Bacteria 4683
162 Ga0075434_100097069 3300006871 Bacteria 2952
163 Ga0075434_100211486 3300006871 Bacteria 1959
164 Ga0075434_100245617 3300006871 Bacteria 1810
165 Ga0075434_100383163 3300006871 Bacteria 1427
166 Ga0075434_100482612 3300006871 Bacteria 1260
167 Ga0075429_100027898 3300006880 Bacteria 4901
168 Ga0075429_100050569 3300006880 Bacteria 3616
169 Ga0075429_100054170 3300006880 Bacteria 3489
170 Ga0075429_100219933 3300006880 Bacteria 1664
171 Ga0075429_100350080 3300006880 Bacteria 1293
172 Ga0068865_100583787 3300006881 Bacteria 942
173 Ga0075436_100049019 3300006914 Bacteria 2914
174 Ga0075436_100078288 3300006914 Bacteria 2290
175 Ga0097620_100000875 3300006931 Bacteria 30715
176 Ga0097620_100013050 3300006931 Bacteria 8348
177 Ga0097620_100014983 3300006931 Bacteria 7784
178 Ga0097620_100107450 3300006931 Bacteria 2851
179 Ga0097620_100151064 3300006931 Bacteria 2398
180 Ga0097620_101050038 3300006931 Bacteria 895
181 Ga0075435_100000383 3300007076 Bacteria 27116
182 Ga0075435_100021436 3300007076 Bacteria 4970
183 Ga0075435_100037026 3300007076 Bacteria 3882
184 Ga0075435_100040963 3300007076 Bacteria 3700
185 Ga0075435_100073722 3300007076 Bacteria 2791
186 Ga0075435_100102661 3300007076 Bacteria 2370
187 Ga0075435_100148065 3300007076 Bacteria 1973
188 Ga0075435_100210357 3300007076 Bacteria 1650
189 Ga0105240_10071196 3300009093 Bacteria 4301
190 Ga0105240_10240567 3300009093 Bacteria 2098
191 Ga0111539_10007447 3300009094 Bacteria 14023
192 Ga0111539_10013822 3300009094 Bacteria 10089
193 Ga0111539_10017186 3300009094 Bacteria 8954
194 Ga0111539_10032138 3300009094 Bacteria 6376
195 Ga0111539_10085130 3300009094 Bacteria 3716
196 Ga0111539_10100530 3300009094 Bacteria 3395
197 Ga0111539_10277349 3300009094 Bacteria 1951
198 Ga0111539_10532364 3300009094 Bacteria 1369
199 Ga0111539_10823554 3300009094 Bacteria 1080
200 Ga0111539_11040277 3300009094 Bacteria 952
201 Ga0105245_10622362 3300009098 Bacteria 1108
202 Ga0114129_10002900 3300009147 Bacteria 23999
203 Ga0114129_10007870 3300009147 Bacteria 15163
204 Ga0114129_10011175 3300009147 Bacteria 12799
205 Ga0114129_10013599 3300009147 Bacteria 11597
206 Ga0114129_10013937 3300009147 Bacteria 11452
207 Ga0114129_10021497 3300009147 Bacteria 9158
208 Ga0114129_10022081 3300009147 Bacteria 9031
209 Ga0114129_10041370 3300009147 Bacteria 6494
210 Ga0114129_10054828 3300009147 Bacteria 5588
211 Ga0114129_10082562 3300009147 Bacteria 4464
212 Ga0114129_10093045 3300009147 Bacteria 4177
213 Ga0114129_10095054 3300009147 Bacteria 4128
214 Ga0114129_10096645 3300009147 Bacteria 4089
215 Ga0114129_10105394 3300009147 Bacteria 3897
216 Ga0114129_10218159 3300009147 Bacteria 2575
217 Ga0114129_10275248 3300009147 Bacteria 2251
218 Ga0114129_10282061 3300009147 Bacteria 2219
219 Ga0114129_10353290 3300009147 Bacteria 1946
220 Ga0114129_10579871 3300009147 Bacteria 1455
221 Ga0105243_10121641 3300009148 Bacteria 2202
222 Ga0105243_10125668 3300009148 Bacteria 2169
223 Ga0105243_10772603 3300009148 Bacteria 944
224 Ga0105248_10075418 3300009177 Unclassified 3791
225 Ga0105248_10113197 3300009177 Bacteria 3060
226 Ga0105248_10128803 3300009177 Bacteria 2855
227 Ga0105248_10165166 3300009177 Bacteria 2496
228 Ga0105248_10990528 3300009177 Bacteria 949
229 Ga0105238_10000045 3300009551 Bacteria 148069
230 Ga0105238_10169619 3300009551 Bacteria 2158
231 Ga0105249_10017000 3300009553 Bacteria 6453
232 Ga0105239_10849250 3300010375 Bacteria 1047
233 Ga0105246_10596509 3300011119 Bacteria 954
234 Ga0157378_10056515 3300013297 Bacteria 3497
235 Ga0157378_10129155 3300013297 Bacteria 2337
236 Ga0163162_11074833 3300013306 Bacteria 911
237 Ga0157375_10003605 3300013308 Bacteria 13436
238 Ga0157375_10447550 3300013308 Archaea 1457
239 Ga0157375_11145311 3300013308 Bacteria 911
240 Ga0163163_10123359 3300014325 Bacteria 2626
241 Ga0157380_10018563 3300014326 Bacteria 5163
242 Ga0157380_10041094 3300014326 Bacteria 3607
243 Ga0157380_10567689 3300014326 Bacteria 1116
244 Ga0157377_10038323 3300014745 Bacteria 2645
245 Ga0157377_10069149 3300014745 Bacteria 2037
246 Ga0157376_10105247 3300014969 Archaea 2474
247 Ga0157376_10142816 3300014969 Bacteria 2150
248 Ga0207645_10174988 3300025907 Bacteria 1407
249 Ga0207643_10003644 3300025908 Bacteria 8301
250 Ga0207684_10093594 3300025910 Bacteria 2563
251 Ga0207684_10414095 3300025910 Bacteria 1158
252 Ga0207695_10007636 3300025913 Bacteria 13704
253 Ga0207695_10097724 3300025913 Bacteria 2937
254 Ga0207663_10341107 3300025916 Bacteria 1132
255 Ga0207660_10101080 3300025917 Bacteria 2154
256 Ga0207662_10014360 3300025918 Bacteria 4442
257 Ga0207662_10122693 3300025918 Bacteria 1631
258 Ga0207649_10133146 3300025920 Bacteria 1691
259 Ga0207646_10097593 3300025922 Bacteria 2633
260 Ga0207646_10150462 3300025922 Bacteria 2099
261 Ga0207646_10256510 3300025922 Bacteria 1580
262 Ga0207646_10415978 3300025922 Bacteria 1214
263 Ga0207681_10003887 3300025923 Bacteria 9275
264 Ga0207681_10005306 3300025923 Bacteria 7918
265 Ga0207681_10292300 3300025923 Bacteria 1286
266 Ga0207650_10016331 3300025925 Bacteria 5188
267 Ga0207650_10054806 3300025925 Bacteria 2959
268 Ga0207659_10002146 3300025926 Bacteria 11709
269 Ga0207659_10075764 3300025926 Bacteria 2470
270 Ga0207659_10102275 3300025926 Bacteria 2163
271 Ga0207706_10019561 3300025933 Bacteria 6091
272 Ga0207686_10002259 3300025934 Bacteria 10570
273 Ga0207709_10139274 3300025935 Bacteria 1666
274 Ga0207670_10002278 3300025936 Bacteria 10051
275 Ga0207670_10008619 3300025936 Bacteria 5767
276 Ga0207669_10377799 3300025937 Bacteria 1103
277 Ga0207704_10101786 3300025938 Bacteria 1917
278 Ga0207691_10014863 3300025940 Bacteria 7419
279 Ga0207691_10020593 3300025940 Bacteria 6236
280 Ga0207691_10045989 3300025940 Bacteria 4012
281 Ga0207711_10030183 3300025941 Unclassified 4572
282 Ga0207711_10112447 3300025941 Bacteria 2423
283 Ga0207661_10209208 3300025944 Bacteria 1718
284 Ga0207661_10221118 3300025944 Bacteria 1674
285 Ga0207679_10020392 3300025945 Bacteria 4473
286 Ga0207679_10099398 3300025945 Bacteria 2272
287 Ga0207679_10581216 3300025945 Bacteria 1008
288 Ga0207667_10245916 3300025949 Bacteria 1830
289 Ga0207651_10027279 3300025960 Bacteria 3585
290 Ga0207651_10042479 3300025960 Bacteria 3026
291 Ga0207712_10027340 3300025961 Bacteria 3808
292 Ga0207712_10109753 3300025961 Bacteria 2067
293 Ga0207712_10257262 3300025961 Bacteria 1414
294 Ga0207668_10011747 3300025972 Bacteria 5335
295 Ga0207668_10146818 3300025972 Bacteria 1821
296 Ga0207658_10014374 3300025986 Bacteria 5421
297 Ga0207658_10178669 3300025986 Bacteria 1755
298 Ga0207658_10198086 3300025986 Bacteria 1675
299 Ga0207703_10129290 3300026035 Bacteria 2179
300 Ga0207708_10048387 3300026075 Bacteria 3237
301 Ga0207708_10328087 3300026075 Bacteria 1250
302 Ga0207702_10158528 3300026078 Bacteria 2065
303 Ga0207641_10034774 3300026088 Bacteria 4194
304 Ga0207641_10772480 3300026088 Bacteria 949
305 Ga0207648_10001533 3300026089 Bacteria 25441
306 Ga0207648_10301702 3300026089 Bacteria 1436
307 Ga0207676_10003707 3300026095 Bacteria 10805
308 Ga0207676_10403850 3300026095 Bacteria 1277
309 Ga0207676_10743146 3300026095 Bacteria 953
310 Ga0207674_10023255 3300026116 Bacteria 6639
311 Ga0207674_10040548 3300026116 Bacteria 4822
312 Ga0207674_10217199 3300026116 Bacteria 1860
313 Ga0207674_10588853 3300026116 Bacteria 1074
314 Ga0207675_100000642 3300026118 Bacteria 34349
315 Ga0207675_100467363 3300026118 Bacteria 1252
316 Ga0207683_10101439 3300026121 Bacteria 2569
317 Ga0207428_10001989 3300027907 Bacteria 20731
318 Ga0207428_10002604 3300027907 Bacteria 18021
319 Ga0207428_10002691 3300027907 Bacteria 17705
320 Ga0207428_10008135 3300027907 Bacteria 9499
321 Ga0207428_10034376 3300027907 Bacteria 4154
322 Ga0207428_10059276 3300027907 Bacteria 3035
323 Ga0207428_10144341 3300027907 Bacteria 1815
324 Ga0268266_10123263 3300028379 Bacteria 2309
325 Ga0268265_10000511 3300028380 Bacteria 39803
326 Ga0268265_10084856 3300028380 Bacteria 2511
327 Ga0268264_10000586 3300028381 Bacteria 44247
328 Ga0268264_10008165 3300028381 Bacteria 8697
329 Ga0268264_10043904 3300028381 Bacteria 3706
330 Ga0265316_10057986 3300031344 Bacteria 3018
331 Ga0307508_10010991 3300031616 Bacteria 8274
332 Ga0307410_10693030 3300031852 Bacteria 858
333 Ga0307416_100374578 3300032002 Bacteria 1451
334 Ga0307411_10074478 3300032005 Bacteria 2314
335 Ga0373944_0186758 3300035089 Bacteria 745
336 Ga0373949_0037348 3300035090 Bacteria 1181
337 Ga0373952_0021822 3300035092 Bacteria 1355
338 Ga0373941_0008827 3300035115 Bacteria 2520
339 Ga0373943_0006884 3300035170 Bacteria 5099
340 Ga0373942_0039149 3300035207 Bacteria 1288
341 Ga0373935_0043524 3300035692 Unclassified 2826
342 Ga0373927_0145893 3300035695 Bacteria 1549
343 Ga0373947_0159247 3300035725 Bacteria 1459
344 Ga0373937_0321551 3300036401 Bacteria 1464
345 Ga0373925_0269494 3300037068 Unclassified 1369
346 Ga0373925_0632558 3300037068 Bacteria 882
347 Ga0395898_0431506 3300037466 Bacteria 1256
348 Ga0395901_0614199 3300038443 Bacteria 1095
349 Ga0395901_0748105 3300038443 Bacteria 971
350 Ga0439453_0028821 3300041408 Bacteria 1042
351 Ga0439441_048313 3300042001 Bacteria 870
352 Ga0450890_013241 3300042127 Bacteria 1076
353 Ga0439446_0037541 3300042156 Bacteria 1418
354 Ga0439435_0003104 3300042436 Bacteria 3409
355 Ga0439435_0005590 3300042436 Bacteria 2773
356 Ga0439435_0046923 3300042436 Bacteria 1225
357 Ga0439460_0083351 3300042461 Bacteria 1006
358 Ga0451576_0003310 3300045051 Bacteria 22351
359 Ga0451576_0015231 3300045051 Bacteria 8526
360 Ga0451576_0018701 3300045051 Bacteria 7581
361 Ga0451576_0082864 3300045051 Bacteria 3336
362 Ga0451576_0153231 3300045051 Bacteria 2404
363 Ga0451576_0161735 3300045051 Bacteria 2337
364 Ga0451576_0276422 3300045051 Bacteria 1756
365 Ga0466967_0132166 3300045976 Bacteria 2318
366 Ga0495603_0047270 3300046455 Bacteria 2563
367 Ga0495603_0065719 3300046455 Bacteria 2137
368 Ga0495603_0455534 3300046455 Bacteria 733
369 Ga0495620_0000290 3300046515 Bacteria 35877
370 Ga0495637_0100742 3300046520 Bacteria 1129
371 Ga0495642_0057735 3300046528 Bacteria 1605
372 Ga0495586_0346624 3300046535 Bacteria 853
373 Ga0495598_0028788 3300046537 Bacteria 1543
374 Ga0495621_0001805 3300046539 Bacteria 5627
375 Ga0495621_0013445 3300046539 Bacteria 2572
376 Ga0495621_0015197 3300046539 Bacteria 2451
377 Ga0495659_0007986 3300046664 Bacteria 3358
378 Ga0495659_0016637 3300046664 Bacteria 2429
379 Ga0495659_0025589 3300046664 Bacteria 2021
380 Ga0495659_0170703 3300046664 Bacteria 882
381 Ga0495647_0034836 3300046681 Bacteria 1888
382 Ga0495669_0010390 3300046684 Bacteria 3933
383 Ga0495669_0249735 3300046684 Bacteria 852
384 Ga0495670_0022621 3300046691 Bacteria 3105
385 Ga0495604_0268286 3300047317 Bacteria 1157
386 Ga0495636_0010077 3300047318 Bacteria 3728
387 Ga0495684_0248157 3300047471 Bacteria 1296
388 Ga0496104_0092096 3300048907 Bacteria 2898
389 Ga0496104_0225590 3300048907 Bacteria 1786
390 Ga0496104_0378991 3300048907 Bacteria 1327
391 Ga0496105_0030664 3300048908 Bacteria 4406
392 Ga0496106_0655861 3300048909 Bacteria 838
393 Ga0496108_0016078 3300048911 Bacteria 6100
394 Ga0496108_0261453 3300048911 Unclassified 1506
395 Ga0496109_0006048 3300048912 Bacteria 10170
396 Ga0496109_1097590 3300048912 Bacteria 733
397 Ga0496110_0009987 3300048913 Bacteria 7700
398 Ga0496110_0038483 3300048913 Bacteria 4163
399 Ga0496111_0059281 3300048914 Bacteria 2773
400 Ga0496111_0138828 3300048914 Bacteria 1801
401 Ga0496112_0035801 3300048915 Bacteria 4838
402 Ga0496112_0227895 3300048915 Bacteria 1818
403 Ga0496114_0132043 3300048917 Bacteria 2157
404 Ga0496114_0353908 3300048917 Bacteria 1299
405 Ga0501041_0198099 3300049577 Bacteria 1259
406 Ga0501069_0058154 3300049585 Bacteria 2156
407 Ga0501072_0303285 3300049588 Bacteria 1270
408 Ga0501073_0019564 3300049589 Bacteria 4886
409 Ga0501073_0123222 3300049589 Bacteria 1796
410 Ga0501080_0143197 3300049742 Bacteria 2210
411 Ga0501081_0198447 3300049743 Bacteria 1455
412 Ga0501081_0260893 3300049743 Bacteria 1266
413 nmdc:mga03n38_17747_c1 3300050490 Bacteria 2793
414 nmdc:mga00v17_10468_c1 3300050491 Bacteria 5065
415 nmdc:mga00v17_98435_c1 3300050491 Bacteria 1844
416 nmdc:mga0yw44_150908_c1 3300050492 Bacteria 1516
417 nmdc:mga0yw44_32978_c1 3300050492 Bacteria 3022
418 nmdc:mga05p37_1033539_c1 3300050507 Bacteria 869
419 nmdc:mga05p37_103641_c1 3300050507 Bacteria 3501
420 nmdc:mga05p37_117531_c1 3300050507 Bacteria 3268
421 nmdc:mga05p37_182017_c1 3300050507 Bacteria 2556
422 nmdc:mga05p37_23313_c1 3300050507 Bacteria 7510
423 nmdc:mga05p37_257952_c1 3300050507 Bacteria 2088
424 nmdc:mga05p37_2736_c1 3300050507 Bacteria 20503
425 nmdc:mga05p37_418150_c1 3300050507 Bacteria 1561
426 nmdc:mga05p37_480053_c1 3300050507 Bacteria 1432
427 nmdc:mga05p37_508740_c1 3300050507 Bacteria 1380
428 nmdc:mga05p37_561_c1 3300050507 Bacteria 40854
429 nmdc:mga05p37_63717_c1 3300050507 Bacteria 4536
430 nmdc:mga05p37_704593_c1 3300050507 Bacteria 1121
431 nmdc:mga05p37_85437_c1 3300050507 Bacteria 3888
432 nmdc:mga05p37_95439_c1 3300050507 Bacteria 3664
433 nmdc:mga09592_138472_c1 3300050508 Bacteria 2097
434 nmdc:mga09592_170232_c1 3300050508 Bacteria 1883
435 nmdc:mga09592_188052_c1 3300050508 Bacteria 1787
436 nmdc:mga09592_226821_c1 3300050508 Bacteria 1618
437 nmdc:mga09592_361224_c1 3300050508 Bacteria 1257
438 nmdc:mga09592_91313_c1 3300050508 Bacteria 2602
439 nmdc:mga06r32_186997_c1 3300050510 Bacteria 2058
440 nmdc:mga06r32_20679_c1 3300050510 Bacteria 6062
441 nmdc:mga06r32_347473_c1 3300050510 Bacteria 1468
442 nmdc:mga06r32_709_c1 3300050510 Bacteria 29152
443 nmdc:mga08y16_11898_c1 3300050511 Bacteria 9139
444 nmdc:mga08y16_23314_c1 3300050511 Bacteria 6537
445 nmdc:mga08y16_324443_c1 3300050511 Bacteria 1585
446 nmdc:mga08y16_34585_c1 3300050511 Bacteria 5309
447 nmdc:mga08y16_5019_c1 3300050511 Bacteria 13835
448 nmdc:mga08y16_5731_c1 3300050511 Bacteria 3946
449 nmdc:mga08y16_6091_c1 3300050511 Bacteria 12648
450 nmdc:mga08y16_65606_c1 3300050511 Bacteria 3365
451 nmdc:mga08y16_83221_c1 3300050511 Bacteria 3335
452 nmdc:mga0n895_136181_c1 3300050512 Bacteria 2482
453 nmdc:mga0n895_14108_c1 3300050512 Bacteria 7243
454 nmdc:mga0n895_285160_c1 3300050512 Bacteria 1674
455 nmdc:mga0n895_429779_c1 3300050512 Bacteria 1335
456 nmdc:mga0n895_43124_c1 3300050512 Bacteria 4394
457 nmdc:mga0n895_512572_c1 3300050512 Bacteria 1207
458 nmdc:mga0n895_619052_c1 3300050512 Bacteria 1084
459 nmdc:mga0n895_65048_c1 3300050512 Bacteria 3609
460 nmdc:mga0n895_75005_c1 3300050512 Bacteria 3361
461 nmdc:mga0n895_81503_c1 3300050512 Bacteria 3224
462 nmdc:mga0n895_88131_c1 3300050512 Bacteria 3103
463 nmdc:mga0n895_912598_c1 3300050512 Bacteria 863
464 nmdc:mga0rr50_108837_c1 3300050513 Bacteria 2190
465 nmdc:mga0rr50_147597_c1 3300050513 Bacteria 1897
466 nmdc:mga0rr50_182978_c1 3300050513 Bacteria 1714
467 nmdc:mga0rr50_188483_c1 3300050513 Bacteria 1689
468 nmdc:mga0rr50_207038_c1 3300050513 Bacteria 1615
469 nmdc:mga0rr50_32452_c1 3300050513 Bacteria 3721
470 nmdc:mga0rr50_5920_c1 3300050513 Bacteria 7359
471 nmdc:mga0rr50_85140_c1 3300050513 Bacteria 2449
472 nmdc:mga0rr50_9188_c1 3300050513 Bacteria 6199
473 nmdc:mga08x19_102250_c1 3300050514 Bacteria 1903
474 nmdc:mga08x19_229605_c1 3300050514 Bacteria 1277
475 nmdc:mga0a205_115332_c1 3300050515 Bacteria 2585
476 nmdc:mga0a205_127536_c1 3300050515 Bacteria 2444
477 nmdc:mga0a205_136581_c1 3300050515 Bacteria 2352
478 nmdc:mga0a205_27064_c1 3300050515 Bacteria 5474
479 nmdc:mga0a205_277408_c1 3300050515 Bacteria 1552
480 nmdc:mga0a205_33538_c1 3300050515 Bacteria 4922
481 nmdc:mga0a205_6003_c1 3300050515 Bacteria 10950
482 nmdc:mga0a205_69219_c1 3300050515 Bacteria 3409
483 nmdc:mga0a205_7183_c1 3300050515 Bacteria 10067
484 nmdc:mga0a205_75321_c1 3300050515 Bacteria 3261
485 nmdc:mga0a205_8832_c1 3300050515 Bacteria 9178
486 Ga0495601_0044333 3300053077 Bacteria 2796
487 Ga0495612_0144610 3300053078 Bacteria 1033
488 Ga0495619_0161837 3300053085 Bacteria 1546
489 Ga0495619_0194940 3300053085 Bacteria 1402
490 Ga0590071_004539 3300059421 Bacteria 3367
491 Ga0590075_000109 3300059424 Bacteria 21268
492 Ga0590075_009022 3300059424 Bacteria 2387
493 Ga0501082_0144240 3300060353 Bacteria 2067
494 Ga0530510_0015716 3300061734 Bacteria 5350
495 2812351706 2811994878 Bacteria 5992952
496 2891970664 2891968417 Bacteria 5821697
497 Ga0105240_10153931
498 SwRhRL2b_contig_2880178
499 Ga0065704_10003795
500 Ga0065712_10012272
501 Ga0065712_10072470
502 Ga0065712_10117119
503 Ga0065715_10007341
504 Ga0065715_10092171
505 Ga0065715_10101048
506 Ga0065707_10001818
507 Ga0065707_10092896
508 Ga0070683_100001766
509 Ga0070690_100021716
510 Ga0070690_100140652
511 Ga0070670_100013733
512 Ga0070670_100026255
513 Ga0070677_10049100
514 Ga0070666_10159501
515 Ga0070682_100408982
516 Ga0070689_100002744
517 Ga0070689_100025763
518 Ga0070687_100010167
519 Ga0070687_100051846
520 Ga0070687_100347197
521 Ga0070661_100021039
522 Ga0070661_100208780
523 Ga0070692_10167483
524 Ga0070668_100041928
525 Ga0070668_100095609
526 Ga0070669_100000822
527 Ga0070669_100025666
528 Ga0070669_100457880
529 Ga0070675_100000142
530 Ga0070675_100072237
531 Ga0070675_100094306
532 Ga0070675_100490081
533 Ga0070671_100018611
534 Ga0070674_100046822
535 Ga0070674_100421542
536 Ga0070673_100059491
537 Ga0070688_100013994
538 Ga0070688_100034160
539 Ga0070688_100068504
540 Ga0070659_100122778
541 Ga0070667_100033594
542 Ga0070667_100409447
543 Ga0070703_10135002
544 Ga0070711_100115707
545 Ga0070705_100001154
546 Ga0070705_100019602
547 Ga0070700_100086294
548 Ga0070694_100008486
549 Ga0070694_100065095
550 Ga0070694_100339832
551 Ga0070708_100230858
552 Ga0070708_100263687
553 Ga0070662_100018673
554 Ga0070681_10085304
555 Ga0068867_100019273
556 Ga0070706_100150114
557 Ga0070707_100020603
558 Ga0070707_100034363
559 Ga0070707_100094492
560 Ga0070707_100109366
561 Ga0070707_100523140
562 Ga0070698_100002070
563 Ga0070698_100047545
564 Ga0070698_100049033
565 Ga0070698_100067042
566 Ga0070698_100445716
567 Ga0070699_100000525
568 Ga0070699_100000678
569 Ga0070699_100001984
570 Ga0070699_100003314
571 Ga0070699_100029711
572 Ga0070699_100030130
573 Ga0070679_100323719
574 Ga0070684_100069728
575 Ga0070684_100093799
576 Ga0070697_100013882
577 Ga0068853_100240727
578 Ga0070672_100035377
579 Ga0070672_100079657
580 Ga0070672_100088611
581 Ga0070686_100041409
582 Ga0070695_100000127
583 Ga0070695_100000737
584 Ga0070695_100310245
585 Ga0070696_100006791
586 Ga0070696_100009547
587 Ga0070696_100036568
588 Ga0070696_100037162
589 Ga0070693_100002801
590 Ga0070665_100125787
591 Ga0070704_100001350
592 Ga0070704_100020130
593 Ga0070704_100242313
594 Ga0070704_100276415
595 Ga0068855_100357560
596 Ga0070664_100000222
597 Ga0070664_100044118
598 Ga0070664_100118165
599 Ga0070664_100437686
600 Ga0068857_100012737
601 Ga0068857_100029853
602 Ga0068857_100209947
603 Ga0068856_100192949
604 Ga0070702_100015404
605 Ga0070702_100054990
606 Ga0070702_100387070
607 Ga0068859_100000875
608 Ga0068859_100013050
609 Ga0068859_100014983
610 Ga0068859_100107450
611 Ga0068859_100151055
612 Ga0068859_101050049
613 Ga0068864_100007011
614 Ga0068864_100271497
615 Ga0068864_100382298
616 Ga0068861_100004101
617 Ga0068861_100055707
618 Ga0068870_10001393
619 Ga0068870_10081886
620 Ga0068860_100000300
621 Ga0068860_100003543
622 Ga0068860_100057823
623 Ga0068860_100176334
624 Ga0068862_100000478
625 Ga0068862_100014697
626 Ga0081455_10064369
627 Ga0070717_10342061
628 Ga0075365_10270724
629 Ga0075365_10283216
630 Ga0075368_10075404
631 Ga0075363_100274599
632 Ga0097621_100090376
633 Ga0097621_100291344
634 Ga0068871_100212704
635 Ga0075428_100002788
636 Ga0075428_100011309
637 Ga0075428_100024598
638 Ga0075428_100070823
639 Ga0075428_100146848
640 Ga0075428_100342237
641 Ga0075430_100032364
642 Ga0075431_100001331
643 Ga0075431_100007090
644 Ga0075433_10007488
645 Ga0075433_10025695
646 Ga0075433_10037731
647 Ga0075433_10047266
648 Ga0075433_10050531
649 Ga0075433_10062303
650 Ga0075433_10068917
651 Ga0075433_10130330
652 Ga0075433_10142639
653 Ga0075433_10647536
654 Ga0075434_100001923
655 Ga0075434_100003446
656 Ga0075434_100010415
657 Ga0075434_100039389
658 Ga0075434_100097069
659 Ga0075434_100211486
660 Ga0075434_100245617
661 Ga0075434_100383163
662 Ga0075434_100482612
663 Ga0075429_100027898
664 Ga0075429_100050569
665 Ga0075429_100054170
666 Ga0075429_100219933
667 Ga0075429_100350080
668 Ga0068865_100583787
669 Ga0075436_100049019
670 Ga0075436_100078288
671 Ga0097620_100000875
672 Ga0097620_100013050
673 Ga0097620_100014983
674 Ga0097620_100107450
675 Ga0097620_100151064
676 Ga0097620_101050038
677 Ga0075435_100000383
678 Ga0075435_100021436
679 Ga0075435_100037026
680 Ga0075435_100040963
681 Ga0075435_100073722
682 Ga0075435_100102661
683 Ga0075435_100148065
684 Ga0075435_100210357
685 Ga0105240_10071196
686 Ga0105240_10240567
687 Ga0111539_10007447
688 Ga0111539_10013822
689 Ga0111539_10017186
690 Ga0111539_10032138
691 Ga0111539_10085130
692 Ga0111539_10100530
693 Ga0111539_10277349
694 Ga0111539_10532364
695 Ga0111539_10823554
696 Ga0111539_11040277
697 Ga0105245_10622362
698 Ga0114129_10002900
699 Ga0114129_10007870
700 Ga0114129_10011175
701 Ga0114129_10013599
702 Ga0114129_10013937
703 Ga0114129_10021497
704 Ga0114129_10022081
705 Ga0114129_10041370
706 Ga0114129_10054828
707 Ga0114129_10082562
708 Ga0114129_10093045
709 Ga0114129_10095054
710 Ga0114129_10096645
711 Ga0114129_10105394
712 Ga0114129_10218159
713 Ga0114129_10275248
714 Ga0114129_10282061
715 Ga0114129_10353290
716 Ga0114129_10579871
717 Ga0105243_10121641
718 Ga0105243_10125668
719 Ga0105243_10772603
720 Ga0105248_10075418
721 Ga0105248_10113197
722 Ga0105248_10128803
723 Ga0105248_10165166
724 Ga0105248_10990528
725 Ga0105238_10000045
726 Ga0105238_10169619
727 Ga0105249_10017000
728 Ga0105239_10849250
729 Ga0105246_10596509
730 Ga0157378_10056515
731 Ga0157378_10129155
732 Ga0163162_11074833
733 Ga0157375_10003605
734 Ga0157375_10447550
735 Ga0157375_11145311
736 Ga0163163_10123359
737 Ga0157380_10018563
738 Ga0157380_10041094
739 Ga0157380_10567689
740 Ga0157377_10038323
741 Ga0157377_10069149
742 Ga0157376_10105247
743 Ga0157376_10142816
744 Ga0207645_10174988
745 Ga0207643_10003644
746 Ga0207684_10093594
747 Ga0207684_10414095
748 Ga0207695_10007636
749 Ga0207695_10097724
750 Ga0207663_10341107
751 Ga0207660_10101080
752 Ga0207662_10014360
753 Ga0207662_10122693
754 Ga0207649_10133146
755 Ga0207646_10097593
756 Ga0207646_10150462
757 Ga0207646_10256510
758 Ga0207646_10415978
759 Ga0207681_10003887
760 Ga0207681_10005306
761 Ga0207681_10292300
762 Ga0207650_10016331
763 Ga0207650_10054806
764 Ga0207659_10002146
765 Ga0207659_10075764
766 Ga0207659_10102275
767 Ga0207706_10019561
768 Ga0207686_10002259
769 Ga0207709_10139274
770 Ga0207670_10002278
771 Ga0207670_10008619
772 Ga0207669_10377799
773 Ga0207704_10101786
774 Ga0207691_10014863
775 Ga0207691_10020593
776 Ga0207691_10045989
777 Ga0207711_10030183
778 Ga0207711_10112447
779 Ga0207661_10209208
780 Ga0207661_10221118
781 Ga0207679_10020392
782 Ga0207679_10099398
783 Ga0207679_10581216
784 Ga0207667_10245916
785 Ga0207651_10027279
786 Ga0207651_10042479
787 Ga0207712_10027340
788 Ga0207712_10109753
789 Ga0207712_10257262
790 Ga0207668_10011747
791 Ga0207668_10146818
792 Ga0207658_10014374
793 Ga0207658_10178669
794 Ga0207658_10198086
795 Ga0207703_10129290
796 Ga0207708_10048387
797 Ga0207708_10328087
798 Ga0207702_10158528
799 Ga0207641_10034774
800 Ga0207641_10772480
801 Ga0207648_10001533
802 Ga0207648_10301702
803 Ga0207676_10003707
804 Ga0207676_10403850
805 Ga0207676_10743146
806 Ga0207674_10023255
807 Ga0207674_10040548
808 Ga0207674_10217199
809 Ga0207674_10588853
810 Ga0207675_100000642
811 Ga0207675_100467363
812 Ga0207683_10101439
813 Ga0207428_10001989
814 Ga0207428_10002604
815 Ga0207428_10002691
816 Ga0207428_10008135
817 Ga0207428_10034376
818 Ga0207428_10059276
819 Ga0207428_10144341
820 Ga0268266_10123263
821 Ga0268265_10000511
822 Ga0268265_10084856
823 Ga0268264_10000586
824 Ga0268264_10008165
825 Ga0268264_10043904
826 Ga0265316_10057986
827 Ga0307508_10010991
828 Ga0307410_10693030
829 Ga0307416_100374578
830 Ga0307411_10074478
831 Ga0373944_0186758
832 Ga0373949_0037348
833 Ga0373952_0021822
834 Ga0373941_0008827
835 Ga0373943_0006884
836 Ga0373942_0039149
837 Ga0373935_0043524
838 Ga0373927_0145893
839 Ga0373947_0159247
840 Ga0373937_0321551
841 Ga0373925_0269494
842 Ga0373925_0632558
843 Ga0395898_0431506
844 Ga0395901_0614199
845 Ga0395901_0748105
846 Ga0439453_0028821
847 Ga0439441_048313
848 Ga0450890_013241
849 Ga0439446_0037541
850 Ga0439435_0003104
851 Ga0439435_0005590
852 Ga0439435_0046923
853 Ga0439460_0083351
854 Ga0451576_0003310
855 Ga0451576_0015231
856 Ga0451576_0018701
857 Ga0451576_0082864
858 Ga0451576_0153231
859 Ga0451576_0161735
860 Ga0451576_0276422
861 Ga0466967_0132166
862 Ga0495603_0047270
863 Ga0495603_0065719
864 Ga0495603_0455534
865 Ga0495620_0000290
866 Ga0495637_0100742
867 Ga0495642_0057735
868 Ga0495586_0346624
869 Ga0495598_0028788
870 Ga0495621_0001805
871 Ga0495621_0013445
872 Ga0495621_0015197
873 Ga0495659_0007986
874 Ga0495659_0016637
875 Ga0495659_0025589
876 Ga0495659_0170703
877 Ga0495647_0034836
878 Ga0495669_0010390
879 Ga0495669_0249735
880 Ga0495670_0022621
881 Ga0495604_0268286
882 Ga0495636_0010077
883 Ga0495684_0248157
884 Ga0496104_0092096
885 Ga0496104_0225590
886 Ga0496104_0378991
887 Ga0496105_0030664
888 Ga0496106_0655861
889 Ga0496108_0016078
890 Ga0496108_0261453
891 Ga0496109_0006048
892 Ga0496109_1097590
893 Ga0496110_0009987
894 Ga0496110_0038483
895 Ga0496111_0059281
896 Ga0496111_0138828
897 Ga0496112_0035801
898 Ga0496112_0227895
899 Ga0496114_0132043
900 Ga0496114_0353908
901 Ga0501041_0198099
902 Ga0501069_0058154
903 Ga0501072_0303285
904 Ga0501073_0019564
905 Ga0501073_0123222
906 Ga0501080_0143197
907 Ga0501081_0198447
908 Ga0501081_0260893
909 nmdc:mga03n38_17747_c1
910 nmdc:mga00v17_10468_c1
911 nmdc:mga00v17_98435_c1
912 nmdc:mga0yw44_150908_c1
913 nmdc:mga0yw44_32978_c1
914 nmdc:mga05p37_1033539_c1
915 nmdc:mga05p37_103641_c1
916 nmdc:mga05p37_117531_c1
917 nmdc:mga05p37_182017_c1
918 nmdc:mga05p37_23313_c1
919 nmdc:mga05p37_257952_c1
920 nmdc:mga05p37_2736_c1
921 nmdc:mga05p37_418150_c1
922 nmdc:mga05p37_480053_c1
923 nmdc:mga05p37_508740_c1
924 nmdc:mga05p37_561_c1
925 nmdc:mga05p37_63717_c1
926 nmdc:mga05p37_704593_c1
927 nmdc:mga05p37_85437_c1
928 nmdc:mga05p37_95439_c1
929 nmdc:mga09592_138472_c1
930 nmdc:mga09592_170232_c1
931 nmdc:mga09592_188052_c1
932 nmdc:mga09592_226821_c1
933 nmdc:mga09592_361224_c1
934 nmdc:mga09592_91313_c1
935 nmdc:mga06r32_186997_c1
936 nmdc:mga06r32_20679_c1
937 nmdc:mga06r32_347473_c1
938 nmdc:mga06r32_709_c1
939 nmdc:mga08y16_11898_c1
940 nmdc:mga08y16_23314_c1
941 nmdc:mga08y16_324443_c1
942 nmdc:mga08y16_34585_c1
943 nmdc:mga08y16_5019_c1
944 nmdc:mga08y16_5731_c1
945 nmdc:mga08y16_6091_c1
946 nmdc:mga08y16_65606_c1
947 nmdc:mga08y16_83221_c1
948 nmdc:mga0n895_136181_c1
949 nmdc:mga0n895_14108_c1
950 nmdc:mga0n895_285160_c1
951 nmdc:mga0n895_429779_c1
952 nmdc:mga0n895_43124_c1
953 nmdc:mga0n895_512572_c1
954 nmdc:mga0n895_619052_c1
955 nmdc:mga0n895_65048_c1
956 nmdc:mga0n895_75005_c1
957 nmdc:mga0n895_81503_c1
958 nmdc:mga0n895_88131_c1
959 nmdc:mga0n895_912598_c1
960 nmdc:mga0rr50_108837_c1
961 nmdc:mga0rr50_147597_c1
962 nmdc:mga0rr50_182978_c1
963 nmdc:mga0rr50_188483_c1
964 nmdc:mga0rr50_207038_c1
965 nmdc:mga0rr50_32452_c1
966 nmdc:mga0rr50_5920_c1
967 nmdc:mga0rr50_85140_c1
968 nmdc:mga0rr50_9188_c1
969 nmdc:mga08x19_102250_c1
970 nmdc:mga08x19_229605_c1
971 nmdc:mga0a205_115332_c1
972 nmdc:mga0a205_127536_c1
973 nmdc:mga0a205_136581_c1
974 nmdc:mga0a205_27064_c1
975 nmdc:mga0a205_277408_c1
976 nmdc:mga0a205_33538_c1
977 nmdc:mga0a205_6003_c1
978 nmdc:mga0a205_69219_c1
979 nmdc:mga0a205_7183_c1
980 nmdc:mga0a205_75321_c1
981 nmdc:mga0a205_8832_c1
982 Ga0495601_0044333
983 Ga0495612_0144610
984 Ga0495619_0161837
985 Ga0495619_0194940
986 Ga0590071_004539
987 Ga0590075_000109
988 Ga0590075_009022
989 Ga0501082_0144240
990 Ga0530510_0015716
991 2812351706
992 2891970664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

37

231

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

43

279

0.93

PF08659

KR

KR domain

38

222

0.84

PF23441

32

280

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9694 8 251
4cqm-assembly3.cif.gz_N crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9676 11 254
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9675 7 251
4cqm-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9648 11 254
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9646 8 254
ID Description Score Start End Superfamily
af_Q5BLE6_285_550_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.963 6 253 3.40.50.720
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 1 254 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9607 8 251 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9605 8 255 3.40.50.720
3r1iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9587 1 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W1CFX5-F1-model_v4 SDR family oxidoreductase 0.9928 39 251 GO:0016616
AF-A0A1Q7QD38-F1-model_v4 Gluconate 5-dehydrogenase 0.986 1 177 GO:0016616
GO:0030497
AF-A0A0P7TI44-F1-model_v4 Uncharacterized protein 0.9849 2 192 GO:0006633
GO:0008171
GO:0016616
GO:0032259
AF-A0A815Z9M7-F1-model_v4 Uncharacterized protein 0.984 1 205 GO:0016616
AF-A0A2M8G1Z2-F1-model_v4 Short-chain dehydrogenase 0.9835 8 196 GO:0016491

Map