F454871

General Info

Members Datasets Scaffolds Average Seq Length
496 250 992 159

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100115077|Ga0075431_1001150772
Length 189
Sequence MHHPDRLGPAIRGRLGKKRPRQTDLEAVITLTGDPSRRTLLARVLDWDDAHVSLDKAVGNIPVELRGKRPPSAPHSCWELLEHIRIAQHDILDFCVNPKYEEMRWPADYWPSSPVPASSDAWNESVQQCKRDRVSLQALANDPAIDLSDKIPHGSGQTYLRELLLVADHNAYHIGQLVLVRQMLGIWPS

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
158 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
212 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
213 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
214 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
215 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
216 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
217 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
218 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
225 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
226 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
227 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
228 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
229 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 8.27
Rhizosphere 90.73
Stem 0
Stem Tuber 0
Unclassified 21.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100115077 3300006847 Bacteria 2776
2 MBSR1b_contig_2391860 2162886012 Archaea 1360
3 rootH1_10170872 3300003316 Unclassified 1325
4 Ga0065712_10100077 3300005290 Bacteria 2072
5 Ga0065712_10138571 3300005290 Bacteria 1472
6 Ga0065715_10003855 3300005293 Bacteria 5065
7 Ga0070676_10159110 3300005328 Bacteria 1452
8 Ga0070683_100250087 3300005329 Bacteria 1686
9 Ga0070670_100030707 3300005331 Bacteria 4627
10 Ga0070670_100469071 3300005331 Bacteria 1117
11 Ga0070666_10108617 3300005335 Bacteria 1917
12 Ga0070666_10244515 3300005335 Bacteria 1269
13 Ga0070666_10840591 3300005335 Unclassified 677
14 Ga0070680_100393349 3300005336 Bacteria 1181
15 Ga0070682_101088992 3300005337 Bacteria 668
16 Ga0070682_101091783 3300005337 Bacteria 667
17 Ga0068868_100944077 3300005338 Bacteria 786
18 Ga0070660_100195790 3300005339 Bacteria 1638
19 Ga0070689_100113824 3300005340 Bacteria 2154
20 Ga0070689_101211044 3300005340 Unclassified 678
21 Ga0070691_10560137 3300005341 Bacteria 669
22 Ga0070687_100190740 3300005343 Bacteria 1235
23 Ga0070668_100194506 3300005347 Bacteria 1662
24 Ga0070668_100648628 3300005347 Bacteria 927
25 Ga0070668_101615003 3300005347 Unclassified 594
26 Ga0070669_100005958 3300005353 Bacteria 8793
27 Ga0070669_100681653 3300005353 Bacteria 867
28 Ga0070669_100683892 3300005353 Bacteria 865
29 Ga0070675_100051480 3300005354 Bacteria 3384
30 Ga0070675_100108212 3300005354 Bacteria 2348
31 Ga0070671_100101494 3300005355 Bacteria 2414
32 Ga0070671_101291766 3300005355 Unclassified 643
33 Ga0070673_100297085 3300005364 Bacteria 1421
34 Ga0070673_100504391 3300005364 Bacteria 1095
35 Ga0070673_101117256 3300005364 Bacteria 737
36 Ga0070688_100013049 3300005365 Bacteria 4676
37 Ga0070688_100681455 3300005365 Bacteria 794
38 Ga0070659_100078513 3300005366 Bacteria 2633
39 Ga0070659_100677683 3300005366 Bacteria 890
40 Ga0070667_100417868 3300005367 Bacteria 1222
41 Ga0070667_100470283 3300005367 Bacteria 1150
42 Ga0070667_100942449 3300005367 Bacteria 804
43 Ga0070713_100922266 3300005436 Bacteria 841
44 Ga0070711_100408884 3300005439 Bacteria 1103
45 Ga0070705_100368904 3300005440 Bacteria 1053
46 Ga0070705_100682330 3300005440 Unclassified 805
47 Ga0070705_101661531 3300005440 Unclassified 539
48 Ga0070700_100580167 3300005441 Bacteria 875
49 Ga0070694_100079433 3300005444 Unclassified 2277
50 Ga0070694_100191942 3300005444 Bacteria 1517
51 Ga0070694_100398676 3300005444 Unclassified 1077
52 Ga0070708_100136786 3300005445 Bacteria 2270
53 Ga0070708_100801843 3300005445 Bacteria 885
54 Ga0070662_100896829 3300005457 Unclassified 756
55 Ga0070662_100974350 3300005457 Unclassified 725
56 Ga0070662_101217527 3300005457 Unclassified 647
57 Ga0070681_10019482 3300005458 Bacteria 6792
58 Ga0070681_10323498 3300005458 Bacteria 1452
59 Ga0068867_101272556 3300005459 Unclassified 678
60 Ga0070685_10000555 3300005466 Bacteria 20900
61 Ga0070685_10006305 3300005466 Bacteria 6046
62 Ga0070685_11209177 3300005466 Bacteria 575
63 Ga0070706_100006585 3300005467 Bacteria 10954
64 Ga0070706_100018653 3300005467 Bacteria 6396
65 Ga0070706_100087172 3300005467 Bacteria 2894
66 Ga0070706_100638612 3300005467 Bacteria 988
67 Ga0070706_101725322 3300005467 Bacteria 570
68 Ga0070706_101775662 3300005467 Bacteria 561
69 Ga0070707_100007920 3300005468 Bacteria 9864
70 Ga0070707_100029441 3300005468 Bacteria 5228
71 Ga0070707_100162665 3300005468 Bacteria 2175
72 Ga0070707_100219843 3300005468 Bacteria 1850
73 Ga0070707_100339469 3300005468 Bacteria 1459
74 Ga0070707_100456949 3300005468 Unclassified 1238
75 Ga0070698_100013133 3300005471 Bacteria 8763
76 Ga0070698_100055360 3300005471 Bacteria 4023
77 Ga0070698_100114724 3300005471 Bacteria 2658
78 Ga0070698_100163195 3300005471 Bacteria 2171
79 Ga0070699_100004249 3300005518 Bacteria 12665
80 Ga0070699_100070580 3300005518 Bacteria 3037
81 Ga0070699_100144515 3300005518 Bacteria 2101
82 Ga0070699_100157564 3300005518 Unclassified 2009
83 Ga0070699_100238426 3300005518 Bacteria 1623
84 Ga0070699_100314459 3300005518 Unclassified 1406
85 Ga0070699_100454628 3300005518 Bacteria 1161
86 Ga0070699_100786690 3300005518 Bacteria 870
87 Ga0070699_100949814 3300005518 Bacteria 788
88 Ga0070679_100108663 3300005530 Bacteria 2760
89 Ga0070679_100965037 3300005530 Bacteria 796
90 Ga0070679_101194631 3300005530 Unclassified 706
91 Ga0070684_100186850 3300005535 Bacteria 1885
92 Ga0070697_100002187 3300005536 Bacteria 14999
93 Ga0070697_100339685 3300005536 Unclassified 1296
94 Ga0070672_100027019 3300005543 Bacteria 4278
95 Ga0070672_100187564 3300005543 Bacteria 1725
96 Ga0070672_101106059 3300005543 Unclassified 704
97 Ga0070686_100682007 3300005544 Bacteria 818
98 Ga0070696_100000226 3300005546 Bacteria 34078
99 Ga0070696_100066222 3300005546 Bacteria 2533
100 Ga0070696_100474984 3300005546 Bacteria 990
101 Ga0070696_100716824 3300005546 Bacteria 817
102 Ga0070696_101170622 3300005546 Bacteria 649
103 Ga0070693_100081535 3300005547 Bacteria 1930
104 Ga0070693_100920954 3300005547 Unclassified 656
105 Ga0070665_100047322 3300005548 Bacteria 4317
106 Ga0070665_100421666 3300005548 Unclassified 1343
107 Ga0070665_100579466 3300005548 Unclassified 1135
108 Ga0070665_101333546 3300005548 Bacteria 727
109 Ga0070704_100022393 3300005549 Bacteria 4111
110 Ga0070664_100311620 3300005564 Bacteria 1424
111 Ga0068857_101625817 3300005577 Unclassified 631
112 Ga0068854_100246848 3300005578 Bacteria 1424
113 Ga0070702_100112728 3300005615 Bacteria 1689
114 Ga0068859_100003065 3300005617 Bacteria 16942
115 Ga0068859_100692099 3300005617 Bacteria 1110
116 Ga0068859_100787376 3300005617 Bacteria 1039
117 Ga0068859_101308490 3300005617 Bacteria 799
118 Ga0068864_100006398 3300005618 Bacteria 9651
119 Ga0068864_100384833 3300005618 Unclassified 1330
120 Ga0068864_100953868 3300005618 Bacteria 849
121 Ga0068861_100258440 3300005719 Bacteria 1490
122 Ga0068861_100566424 3300005719 Bacteria 1037
123 Ga0068861_100686237 3300005719 Unclassified 950
124 Ga0068861_101017361 3300005719 Unclassified 792
125 Ga0068870_10085210 3300005840 Unclassified 1756
126 Ga0068870_10101601 3300005840 Bacteria 1626
127 Ga0068858_100075383 3300005842 Bacteria 3133
128 Ga0068858_100455470 3300005842 Bacteria 1233
129 Ga0068862_100005846 3300005844 Bacteria 10248
130 Ga0068862_100062584 3300005844 Bacteria 3200
131 Ga0068862_100091499 3300005844 Unclassified 2650
132 Ga0068862_100092989 3300005844 Bacteria 2629
133 Ga0081455_10051144 3300005937 Unclassified 3545
134 Ga0081539_10006431 3300005985 Bacteria 11274
135 Ga0070717_10131145 3300006028 Unclassified 2155
136 Ga0075432_10512290 3300006058 Bacteria 536
137 Ga0070716_100051044 3300006173 Bacteria 2350
138 Ga0097621_100681168 3300006237 Bacteria 945
139 Ga0097621_100815384 3300006237 Unclassified 865
140 Ga0075428_100005425 3300006844 Bacteria 14166
141 Ga0075428_100016524 3300006844 Bacteria 8149
142 Ga0075428_100754759 3300006844 Bacteria 1035
143 Ga0075430_100078044 3300006846 Bacteria 2776
144 Ga0075431_100001935 3300006847 Bacteria 19729
145 Ga0075431_100310799 3300006847 Bacteria 1591
146 Ga0075431_100641343 3300006847 Unclassified 1043
147 Ga0075433_10167003 3300006852 Unclassified 1958
148 Ga0075434_100071189 3300006871 Bacteria 3468
149 Ga0075429_100070825 3300006880 Unclassified 3036
150 Ga0075436_100297833 3300006914 Unclassified 1155
151 Ga0097620_100003065 3300006931 Bacteria 16942
152 Ga0097620_100692107 3300006931 Bacteria 1110
153 Ga0097620_100787349 3300006931 Bacteria 1039
154 Ga0097620_101308318 3300006931 Bacteria 799
155 Ga0075435_100022095 3300007076 Bacteria 4905
156 Ga0099794_10080002 3300007265 Bacteria 1611
157 Ga0105240_10083670 3300009093 Bacteria 3915
158 Ga0105240_10240758 3300009093 Bacteria 2097
159 Ga0111539_10002103 3300009094 Bacteria 26609
160 Ga0111539_10013090 3300009094 Bacteria 10377
161 Ga0111539_10060469 3300009094 Bacteria 4490
162 Ga0111539_10071740 3300009094 Bacteria 4086
163 Ga0111539_10215843 3300009094 Bacteria 2235
164 Ga0111539_10758630 3300009094 Bacteria 1129
165 Ga0105245_11921490 3300009098 Unclassified 645
166 Ga0105247_10029763 3300009101 Bacteria 3310
167 Ga0105247_10334174 3300009101 Bacteria 1061
168 Ga0114129_10017554 3300009147 Bacteria 10188
169 Ga0114129_10096128 3300009147 Unclassified 4102
170 Ga0114129_10303421 3300009147 Bacteria 2127
171 Ga0114129_10575926 3300009147 Bacteria 1461
172 Ga0114129_10640235 3300009147 Bacteria 1373
173 Ga0114129_10921005 3300009147 Unclassified 1106
174 Ga0105243_11032882 3300009148 Bacteria 826
175 Ga0105242_10110154 3300009176 Bacteria 2345
176 Ga0105248_10002660 3300009177 Bacteria 19843
177 Ga0105248_10783338 3300009177 Unclassified 1076
178 Ga0105249_10002563 3300009553 Bacteria 15727
179 Ga0105249_11436160 3300009553 Unclassified 762
180 Ga0105249_11967008 3300009553 Unclassified 657
181 Ga0105246_10083932 3300011119 Bacteria 2278
182 Ga0157378_10752209 3300013297 Bacteria 998
183 Ga0157378_11767171 3300013297 Unclassified 666
184 Ga0163162_10312554 3300013306 Unclassified 1704
185 Ga0163162_10772019 3300013306 Bacteria 1079
186 Ga0157375_10303690 3300013308 Bacteria 1760
187 Ga0163163_10036469 3300014325 Bacteria 4777
188 Ga0163163_10094552 3300014325 Bacteria 3007
189 Ga0163163_10109457 3300014325 Bacteria 2790
190 Ga0163163_10179629 3300014325 Bacteria 2163
191 Ga0157380_10448492 3300014326 Unclassified 1238
192 Ga0157380_10904631 3300014326 Bacteria 909
193 Ga0157377_10244242 3300014745 Unclassified 1160
194 Ga0157379_10000945 3300014968 Bacteria 23539
195 Ga0157379_10952089 3300014968 Unclassified 817
196 Ga0163161_10994150 3300017792 Bacteria 716
197 Ga0163161_11002742 3300017792 Bacteria 713
198 Ga0206353_10582326 3300020082 Bacteria 834
199 Ga0207697_10000181 3300025315 Bacteria 32579
200 Ga0207697_10032265 3300025315 Bacteria 2144
201 Ga0207710_10253732 3300025900 Bacteria 880
202 Ga0207688_10010932 3300025901 Bacteria 4940
203 Ga0207680_10091373 3300025903 Bacteria 1937
204 Ga0207645_10256575 3300025907 Bacteria 1158
205 Ga0207645_11051667 3300025907 Bacteria 550
206 Ga0207643_10189337 3300025908 Bacteria 1248
207 Ga0207643_10725942 3300025908 Bacteria 643
208 Ga0207684_10119265 3300025910 Bacteria 2261
209 Ga0207684_10206760 3300025910 Bacteria 1693
210 Ga0207707_10105979 3300025912 Bacteria 2457
211 Ga0207707_10179668 3300025912 Bacteria 1848
212 Ga0207695_10174162 3300025913 Unclassified 2075
213 Ga0207695_10290122 3300025913 Unclassified 1528
214 Ga0207662_10302215 3300025918 Bacteria 1064
215 Ga0207662_10721360 3300025918 Bacteria 699
216 Ga0207657_10211156 3300025919 Bacteria 1558
217 Ga0207652_10069946 3300025921 Bacteria 3048
218 Ga0207652_10118449 3300025921 Bacteria 2353
219 Ga0207646_10022270 3300025922 Bacteria 5840
220 Ga0207646_10037540 3300025922 Bacteria 4367
221 Ga0207646_10126904 3300025922 Bacteria 2294
222 Ga0207646_10160336 3300025922 Bacteria 2030
223 Ga0207646_11434329 3300025922 Bacteria 600
224 Ga0207681_10004811 3300025923 Bacteria 8304
225 Ga0207694_10281568 3300025924 Unclassified 1366
226 Ga0207659_10059528 3300025926 Bacteria 2746
227 Ga0207659_10062927 3300025926 Bacteria 2680
228 Ga0207690_10075247 3300025932 Bacteria 2341
229 Ga0207706_10298201 3300025933 Bacteria 1405
230 Ga0207706_10947001 3300025933 Unclassified 726
231 Ga0207706_11137408 3300025933 Unclassified 651
232 Ga0207686_10212859 3300025934 Unclassified 1390
233 Ga0207670_10013382 3300025936 Bacteria 4836
234 Ga0207691_10070243 3300025940 Bacteria 3162
235 Ga0207691_10232788 3300025940 Bacteria 1595
236 Ga0207711_10038112 3300025941 Bacteria 4087
237 Ga0207689_10798985 3300025942 Bacteria 796
238 Ga0207661_10356380 3300025944 Bacteria 1321
239 Ga0207651_10495106 3300025960 Bacteria 1056
240 Ga0207712_10124103 3300025961 Unclassified 1958
241 Ga0207712_10198475 3300025961 Unclassified 1589
242 Ga0207712_11269246 3300025961 Unclassified 658
243 Ga0207668_10421443 3300025972 Bacteria 1133
244 Ga0207668_10868970 3300025972 Bacteria 801
245 Ga0207668_11807784 3300025972 Unclassified 551
246 Ga0207658_10451837 3300025986 Bacteria 1138
247 Ga0207703_10009885 3300026035 Bacteria 7484
248 Ga0207703_10413301 3300026035 Bacteria 1254
249 Ga0207639_11973954 3300026041 Bacteria 544
250 Ga0207678_10248381 3300026067 Bacteria 1524
251 Ga0207678_10291090 3300026067 Bacteria 1403
252 Ga0207708_10250559 3300026075 Bacteria 1427
253 Ga0207641_10128834 3300026088 Bacteria 2269
254 Ga0207641_11880364 3300026088 Unclassified 600
255 Ga0207648_10760526 3300026089 Unclassified 900
256 Ga0207676_10034671 3300026095 Bacteria 3822
257 Ga0207676_10065514 3300026095 Bacteria 2893
258 Ga0207676_10910078 3300026095 Bacteria 863
259 Ga0207675_100057676 3300026118 Unclassified 3623
260 Ga0207675_100112435 3300026118 Unclassified 2570
261 Ga0207675_100430798 3300026118 Bacteria 1304
262 Ga0207675_101542703 3300026118 Bacteria 685
263 Ga0207698_10344492 3300026142 Bacteria 1405
264 Ga0209974_10145802 3300027876 Unclassified 852
265 Ga0209974_10278065 3300027876 Bacteria 636
266 Ga0207428_10004793 3300027907 Bacteria 12778
267 Ga0207428_10005325 3300027907 Bacteria 11999
268 Ga0207428_10046449 3300027907 Bacteria 3492
269 Ga0207428_10341316 3300027907 Unclassified 1103
270 Ga0207428_10380929 3300027907 Bacteria 1035
271 Ga0268266_10031777 3300028379 Bacteria 4486
272 Ga0268266_10341358 3300028379 Unclassified 1406
273 Ga0268266_10575782 3300028379 Unclassified 1080
274 Ga0268265_10018797 3300028380 Bacteria 4794
275 Ga0268265_10055887 3300028380 Bacteria 3001
276 Ga0268265_10169942 3300028380 Bacteria 1862
277 Ga0265760_10082876 3300031090 Bacteria 995
278 Ga0307408_100134098 3300031548 Bacteria 1935
279 Ga0307408_100402036 3300031548 Bacteria 1176
280 Ga0307405_10195968 3300031731 Bacteria 1463
281 Ga0307405_10200360 3300031731 Bacteria 1449
282 Ga0307405_10924813 3300031731 Bacteria 739
283 Ga0307413_10118718 3300031824 Bacteria 1786
284 Ga0307413_10138487 3300031824 Bacteria 1678
285 Ga0307410_10154269 3300031852 Bacteria 1713
286 Ga0307410_10438837 3300031852 Bacteria 1063
287 Ga0307410_10490902 3300031852 Bacteria 1009
288 Ga0307406_10056060 3300031901 Bacteria 2522
289 Ga0307406_10131874 3300031901 Bacteria 1755
290 Ga0307406_10303929 3300031901 Bacteria 1227
291 Ga0307407_10015444 3300031903 Bacteria 3775
292 Ga0307407_10258636 3300031903 Bacteria 1196
293 Ga0307407_10325680 3300031903 Bacteria 1080
294 Ga0307412_10098284 3300031911 Bacteria 2064
295 Ga0307412_11403663 3300031911 Bacteria 632
296 Ga0307409_100081346 3300031995 Bacteria 2618
297 Ga0307409_100147031 3300031995 Bacteria 2039
298 Ga0307409_100870848 3300031995 Unclassified 913
299 Ga0307416_100006370 3300032002 Bacteria 7382
300 Ga0307416_100009008 3300032002 Bacteria 6494
301 Ga0307416_100100251 3300032002 Bacteria 2518
302 Ga0307416_100504838 3300032002 Bacteria 1274
303 Ga0307414_10044489 3300032004 Bacteria 3033
304 Ga0307411_10004706 3300032005 Bacteria 6588
305 Ga0307411_10028135 3300032005 Bacteria 3413
306 Ga0307415_100003249 3300032126 Bacteria 8252
307 Ga0307415_100606903 3300032126 Unclassified 975
308 Ga0307415_101022343 3300032126 Bacteria 769
309 Ga0373959_0009236 3300034820 Unclassified 1696
310 Ga0373959_0039401 3300034820 Bacteria 986
311 Ga0373940_0323098 3300035088 Unclassified 536
312 Ga0373939_0078106 3300035114 Bacteria 1093
313 Ga0373946_0124578 3300035171 Unclassified 1180
314 Ga0373961_0085483 3300035241 Unclassified 999
315 Ga0373961_0295308 3300035241 Unclassified 598
316 Ga0373931_0078212 3300035691 Bacteria 1819
317 Ga0373927_0939455 3300035695 Bacteria 571
318 Ga0395899_0855968 3300037312 Unclassified 558
319 Ga0395900_0795508 3300037418 Unclassified 874
320 Ga0395905_0171501 3300037471 Bacteria 2038
321 Ga0395905_0251609 3300037471 Unclassified 1650
322 Ga0395901_0679271 3300038443 Unclassified 1030
323 Ga0242420_000569 3300038996 Bacteria 4267
324 Ga0450900_032200 3300042136 Bacteria 765
325 Ga0451577_0132044 3300042876 Unclassified 2241
326 Ga0451577_0430793 3300042876 Unclassified 1198
327 Ga0451577_0924108 3300042876 Bacteria 785
328 Ga0439440_0032333 3300042993 Unclassified 1242
329 Ga0453683_0000243 3300044673 Bacteria 72784
330 Ga0453684_1358748 3300044712 Bacteria 739
331 Ga0451576_0026785 3300045051 Bacteria 6196
332 Ga0451576_0229676 3300045051 Bacteria 1938
333 Ga0451576_0396016 3300045051 Bacteria 1448
334 Ga0466958_0761909 3300045836 Unclassified 631
335 Ga0495603_0056640 3300046455 Bacteria 2320
336 Ga0495639_0203508 3300046475 Bacteria 970
337 Ga0495594_0055671 3300046499 Bacteria 2181
338 Ga0495643_0000025 3300046522 Bacteria 269043
339 Ga0495656_0126024 3300046615 Bacteria 1214
340 Ga0495588_0169225 3300046674 Bacteria 1155
341 Ga0495599_0006729 3300046678 Bacteria 6944
342 Ga0495647_0019550 3300046681 Bacteria 2423
343 Ga0495647_0447607 3300046681 Bacteria 597
344 Ga0495658_0069406 3300046683 Bacteria 2043
345 Ga0495676_0245269 3300047321 Bacteria 1225
346 Ga0495684_0088706 3300047471 Bacteria 2344
347 Ga0496100_0168806 3300048903 Bacteria 1574
348 Ga0496101_0209536 3300048904 Bacteria 1510
349 Ga0496101_0496501 3300048904 Unclassified 964
350 Ga0496102_0086686 3300048905 Unclassified 2892
351 Ga0496102_0358589 3300048905 Unclassified 1373
352 Ga0496102_0449842 3300048905 Bacteria 1208
353 Ga0496102_0503820 3300048905 Bacteria 1133
354 Ga0496103_0058723 3300048906 Unclassified 2390
355 Ga0496103_0705882 3300048906 Bacteria 639
356 Ga0496104_0004507 3300048907 Bacteria 12138
357 Ga0496104_0039654 3300048907 Bacteria 4410
358 Ga0496104_0653757 3300048907 Bacteria 960
359 Ga0496106_0059321 3300048909 Bacteria 2898
360 Ga0496106_0547581 3300048909 Bacteria 928
361 Ga0496107_1108868 3300048910 Bacteria 571
362 Ga0496108_0006399 3300048911 Bacteria 9549
363 Ga0496108_0035992 3300048911 Bacteria 4117
364 Ga0496108_0149884 3300048911 Bacteria 2012
365 Ga0496108_1207080 3300048911 Unclassified 639
366 Ga0496109_0011562 3300048912 Bacteria 7594
367 Ga0496109_0029537 3300048912 Bacteria 4910
368 Ga0496109_0193057 3300048912 Bacteria 1913
369 Ga0496109_0533206 3300048912 Unclassified 1108
370 Ga0496109_1268294 3300048912 Bacteria 673
371 Ga0496110_0009024 3300048913 Bacteria 8047
372 Ga0496110_0011215 3300048913 Bacteria 7325
373 Ga0496110_0112017 3300048913 Unclassified 2453
374 Ga0496110_0845392 3300048913 Bacteria 820
375 Ga0496111_0020064 3300048914 Bacteria 4648
376 Ga0496111_0033926 3300048914 Bacteria 3642
377 Ga0496111_0128915 3300048914 Bacteria 1871
378 Ga0496112_0000859 3300048915 Bacteria 21727
379 Ga0496112_0049515 3300048915 Bacteria 4119
380 Ga0496112_0111201 3300048915 Unclassified 2709
381 Ga0496112_0130543 3300048915 Bacteria 2484
382 Ga0496112_0210501 3300048915 Bacteria 1902
383 Ga0496112_0257797 3300048915 Bacteria 1694
384 Ga0496113_0000560 3300048916 Bacteria 18482
385 Ga0496113_0008982 3300048916 Bacteria 6542
386 Ga0496113_0084825 3300048916 Bacteria 2432
387 Ga0496114_0093713 3300048917 Bacteria 2554
388 Ga0496124_0713606 3300048927 Bacteria 634
389 Ga0501032_0338278 3300049569 Bacteria 970
390 Ga0501032_0632443 3300049569 Bacteria 680
391 Ga0501033_0024277 3300049570 Bacteria 4575
392 Ga0501033_0417823 3300049570 Bacteria 934
393 Ga0501036_0035989 3300049572 Bacteria 4189
394 Ga0501036_0297396 3300049572 Bacteria 1350
395 Ga0501037_0039245 3300049573 Bacteria 3487
396 Ga0501037_0190570 3300049573 Bacteria 1452
397 Ga0501037_0239570 3300049573 Bacteria 1272
398 Ga0501038_0048265 3300049574 Bacteria 3685
399 Ga0501038_0646634 3300049574 Unclassified 796
400 Ga0501039_0967716 3300049575 Bacteria 662
401 Ga0501040_0037269 3300049576 Bacteria 3303
402 Ga0501041_0094167 3300049577 Unclassified 1850
403 Ga0501041_0962645 3300049577 Bacteria 549
404 Ga0501042_0033925 3300049578 Bacteria 3619
405 Ga0501042_0140016 3300049578 Unclassified 1744
406 Ga0501043_0172035 3300049579 Unclassified 1690
407 Ga0501043_0364175 3300049579 Unclassified 1097
408 Ga0501046_0024343 3300049580 Bacteria 4968
409 Ga0501046_0136553 3300049580 Unclassified 1857
410 Ga0501046_0252605 3300049580 Bacteria 1297
411 Ga0501047_0003113 3300049581 Bacteria 15736
412 Ga0501048_0030925 3300049582 Bacteria 3875
413 Ga0501067_0564574 3300049583 Unclassified 637
414 Ga0501068_0137992 3300049584 Unclassified 1528
415 Ga0501070_1424819 3300049586 Bacteria 526
416 Ga0501071_0083222 3300049587 Bacteria 2344
417 Ga0501075_0024224 3300049591 Bacteria 4447
418 Ga0501075_0066600 3300049591 Bacteria 2718
419 Ga0501075_1309853 3300049591 Bacteria 549
420 Ga0501076_0056815 3300049592 Bacteria 3106
421 Ga0501076_0904357 3300049592 Unclassified 728
422 Ga0501077_0003687 3300049593 Bacteria 9215
423 Ga0501077_0028262 3300049593 Bacteria 3564
424 Ga0501202_034117 3300049652 Bacteria 1074
425 Ga0501209_015286 3300049656 Bacteria 1707
426 Ga0501209_138583 3300049656 Bacteria 728
427 Ga0501216_119333 3300049660 Bacteria 600
428 Ga0501217_008846 3300049661 Bacteria 2182
429 Ga0501228_011632 3300049666 Bacteria 894
430 Ga0501236_004283 3300049670 Bacteria 1687
431 Ga0501239_001977 3300049672 Unclassified 1823
432 Ga0501243_002314 3300049675 Bacteria 2781
433 Ga0501225_0083418 3300049705 Bacteria 920
434 Ga0501079_0013792 3300049741 Bacteria 6162
435 Ga0501079_0020210 3300049741 Bacteria 5090
436 Ga0501080_0090470 3300049742 Unclassified 2843
437 Ga0501080_0144635 3300049742 Unclassified 2198
438 Ga0501081_0001396 3300049743 Bacteria 14735
439 Ga0501081_0008210 3300049743 Bacteria 6777
440 Ga0501083_0028210 3300049744 Bacteria 3871
441 Ga0501241_028267 3300049758 Bacteria 1052
442 Ga0501263_007232 3300049760 Bacteria 1301
443 Ga0501263_027593 3300049760 Bacteria 790
444 Ga0501264_011075 3300049761 Bacteria 874
445 Ga0501268_000342 3300049765 Bacteria 4836
446 Ga0501268_004537 3300049765 Bacteria 1963
447 Ga0501273_000615 3300049770 Bacteria 2969
448 Ga0501279_038528 3300049775 Bacteria 727
449 Ga0501035_0017125 3300049822 Bacteria 6677
450 Ga0501035_0223992 3300049822 Bacteria 1605
451 Ga0501044_0024250 3300049823 Bacteria 6445
452 Ga0501045_0010271 3300049824 Bacteria 6556
453 Ga0501045_0062236 3300049824 Unclassified 2738
454 Ga0501204_000367 3300049850 Bacteria 3844
455 nmdc:mga00v17_330099_c1 3300050491 Bacteria 991
456 nmdc:mga05p37_102927_c1 3300050507 Bacteria 3516
457 nmdc:mga05p37_1464898_c1 3300050507 Unclassified 682
458 nmdc:mga05p37_1504047_c1 3300050507 Bacteria 670
459 nmdc:mga05p37_303106_c1 3300050507 Bacteria 1897
460 nmdc:mga05p37_43944_c1 3300050507 Bacteria 5496
461 nmdc:mga05p37_85_c1 3300050507 Bacteria 83588
462 nmdc:mga0qj67_1087293_c1 3300050509 Unclassified 625
463 nmdc:mga0qj67_458169_c1 3300050509 Bacteria 1027
464 nmdc:mga0qj67_51028_c1 3300050509 Unclassified 3270
465 nmdc:mga0qj67_5745_c1 3300050509 Bacteria 9080
466 nmdc:mga06r32_1448_c1 3300050510 Bacteria 21440
467 nmdc:mga06r32_1721362_c1 3300050510 Bacteria 564
468 nmdc:mga06r32_218039_c1 3300050510 Bacteria 1896
469 nmdc:mga06r32_229889_c1 3300050510 Bacteria 1842
470 nmdc:mga06r32_379111_c1 3300050510 Bacteria 1397
471 nmdc:mga06r32_427791_c1 3300050510 Bacteria 1305
472 nmdc:mga06r32_509891_c1 3300050510 Bacteria 1179
473 nmdc:mga06r32_867624_c1 3300050510 Bacteria 860
474 nmdc:mga08y16_185485_c1 3300050511 Unclassified 2159
475 nmdc:mga08y16_239874_c1 3300050511 Bacteria 1874
476 nmdc:mga08y16_2904_c1 3300050511 Bacteria 17625
477 nmdc:mga08y16_6106_c1 3300050511 Bacteria 12635
478 nmdc:mga0n895_61757_c1 3300050512 Bacteria 3701
479 nmdc:mga0n895_750115_c1 3300050512 Unclassified 969
480 nmdc:mga0rr50_12716_c1 3300050513 Bacteria 5453
481 nmdc:mga0rr50_38926_c1 3300050513 Bacteria 3445
482 nmdc:mga0rr50_643766_c1 3300050513 Unclassified 904
483 nmdc:mga08x19_61451_c1 3300050514 Bacteria 2435
484 nmdc:mga08x19_93850_c1 3300050514 Bacteria 1983
485 nmdc:mga0a205_104088_c1 3300050515 Bacteria 2737
486 nmdc:mga0a205_160708_c1 3300050515 Bacteria 2143
487 Ga0500651_0143650 3300053093 Bacteria 1437
488 Ga0500556_0001942 3300053104 Bacteria 7313
489 Ga0501084_0016291 3300054114 Bacteria 6173
490 Ga0501084_0056548 3300054114 Unclassified 3282
491 Ga0590071_001107 3300059421 Bacteria 7292
492 Ga0590075_008403 3300059424 Bacteria 2465
493 Ga0590077_079417 3300059426 Bacteria 754
494 Ga0501082_0002427 3300060353 Bacteria 16364
495 Ga0530510_0022748 3300061734 Bacteria 4466
496 Ga0530510_0427459 3300061734 Bacteria 1000
497 Ga0075431_100115077
498 MBSR1b_contig_2391860
499 rootH1_10170872
500 Ga0065712_10100077
501 Ga0065712_10138571
502 Ga0065715_10003855
503 Ga0070676_10159110
504 Ga0070683_100250087
505 Ga0070670_100030707
506 Ga0070670_100469071
507 Ga0070666_10108617
508 Ga0070666_10244515
509 Ga0070666_10840591
510 Ga0070680_100393349
511 Ga0070682_101088992
512 Ga0070682_101091783
513 Ga0068868_100944077
514 Ga0070660_100195790
515 Ga0070689_100113824
516 Ga0070689_101211044
517 Ga0070691_10560137
518 Ga0070687_100190740
519 Ga0070668_100194506
520 Ga0070668_100648628
521 Ga0070668_101615003
522 Ga0070669_100005958
523 Ga0070669_100681653
524 Ga0070669_100683892
525 Ga0070675_100051480
526 Ga0070675_100108212
527 Ga0070671_100101494
528 Ga0070671_101291766
529 Ga0070673_100297085
530 Ga0070673_100504391
531 Ga0070673_101117256
532 Ga0070688_100013049
533 Ga0070688_100681455
534 Ga0070659_100078513
535 Ga0070659_100677683
536 Ga0070667_100417868
537 Ga0070667_100470283
538 Ga0070667_100942449
539 Ga0070713_100922266
540 Ga0070711_100408884
541 Ga0070705_100368904
542 Ga0070705_100682330
543 Ga0070705_101661531
544 Ga0070700_100580167
545 Ga0070694_100079433
546 Ga0070694_100191942
547 Ga0070694_100398676
548 Ga0070708_100136786
549 Ga0070708_100801843
550 Ga0070662_100896829
551 Ga0070662_100974350
552 Ga0070662_101217527
553 Ga0070681_10019482
554 Ga0070681_10323498
555 Ga0068867_101272556
556 Ga0070685_10000555
557 Ga0070685_10006305
558 Ga0070685_11209177
559 Ga0070706_100006585
560 Ga0070706_100018653
561 Ga0070706_100087172
562 Ga0070706_100638612
563 Ga0070706_101725322
564 Ga0070706_101775662
565 Ga0070707_100007920
566 Ga0070707_100029441
567 Ga0070707_100162665
568 Ga0070707_100219843
569 Ga0070707_100339469
570 Ga0070707_100456949
571 Ga0070698_100013133
572 Ga0070698_100055360
573 Ga0070698_100114724
574 Ga0070698_100163195
575 Ga0070699_100004249
576 Ga0070699_100070580
577 Ga0070699_100144515
578 Ga0070699_100157564
579 Ga0070699_100238426
580 Ga0070699_100314459
581 Ga0070699_100454628
582 Ga0070699_100786690
583 Ga0070699_100949814
584 Ga0070679_100108663
585 Ga0070679_100965037
586 Ga0070679_101194631
587 Ga0070684_100186850
588 Ga0070697_100002187
589 Ga0070697_100339685
590 Ga0070672_100027019
591 Ga0070672_100187564
592 Ga0070672_101106059
593 Ga0070686_100682007
594 Ga0070696_100000226
595 Ga0070696_100066222
596 Ga0070696_100474984
597 Ga0070696_100716824
598 Ga0070696_101170622
599 Ga0070693_100081535
600 Ga0070693_100920954
601 Ga0070665_100047322
602 Ga0070665_100421666
603 Ga0070665_100579466
604 Ga0070665_101333546
605 Ga0070704_100022393
606 Ga0070664_100311620
607 Ga0068857_101625817
608 Ga0068854_100246848
609 Ga0070702_100112728
610 Ga0068859_100003065
611 Ga0068859_100692099
612 Ga0068859_100787376
613 Ga0068859_101308490
614 Ga0068864_100006398
615 Ga0068864_100384833
616 Ga0068864_100953868
617 Ga0068861_100258440
618 Ga0068861_100566424
619 Ga0068861_100686237
620 Ga0068861_101017361
621 Ga0068870_10085210
622 Ga0068870_10101601
623 Ga0068858_100075383
624 Ga0068858_100455470
625 Ga0068862_100005846
626 Ga0068862_100062584
627 Ga0068862_100091499
628 Ga0068862_100092989
629 Ga0081455_10051144
630 Ga0081539_10006431
631 Ga0070717_10131145
632 Ga0075432_10512290
633 Ga0070716_100051044
634 Ga0097621_100681168
635 Ga0097621_100815384
636 Ga0075428_100005425
637 Ga0075428_100016524
638 Ga0075428_100754759
639 Ga0075430_100078044
640 Ga0075431_100001935
641 Ga0075431_100310799
642 Ga0075431_100641343
643 Ga0075433_10167003
644 Ga0075434_100071189
645 Ga0075429_100070825
646 Ga0075436_100297833
647 Ga0097620_100003065
648 Ga0097620_100692107
649 Ga0097620_100787349
650 Ga0097620_101308318
651 Ga0075435_100022095
652 Ga0099794_10080002
653 Ga0105240_10083670
654 Ga0105240_10240758
655 Ga0111539_10002103
656 Ga0111539_10013090
657 Ga0111539_10060469
658 Ga0111539_10071740
659 Ga0111539_10215843
660 Ga0111539_10758630
661 Ga0105245_11921490
662 Ga0105247_10029763
663 Ga0105247_10334174
664 Ga0114129_10017554
665 Ga0114129_10096128
666 Ga0114129_10303421
667 Ga0114129_10575926
668 Ga0114129_10640235
669 Ga0114129_10921005
670 Ga0105243_11032882
671 Ga0105242_10110154
672 Ga0105248_10002660
673 Ga0105248_10783338
674 Ga0105249_10002563
675 Ga0105249_11436160
676 Ga0105249_11967008
677 Ga0105246_10083932
678 Ga0157378_10752209
679 Ga0157378_11767171
680 Ga0163162_10312554
681 Ga0163162_10772019
682 Ga0157375_10303690
683 Ga0163163_10036469
684 Ga0163163_10094552
685 Ga0163163_10109457
686 Ga0163163_10179629
687 Ga0157380_10448492
688 Ga0157380_10904631
689 Ga0157377_10244242
690 Ga0157379_10000945
691 Ga0157379_10952089
692 Ga0163161_10994150
693 Ga0163161_11002742
694 Ga0206353_10582326
695 Ga0207697_10000181
696 Ga0207697_10032265
697 Ga0207710_10253732
698 Ga0207688_10010932
699 Ga0207680_10091373
700 Ga0207645_10256575
701 Ga0207645_11051667
702 Ga0207643_10189337
703 Ga0207643_10725942
704 Ga0207684_10119265
705 Ga0207684_10206760
706 Ga0207707_10105979
707 Ga0207707_10179668
708 Ga0207695_10174162
709 Ga0207695_10290122
710 Ga0207662_10302215
711 Ga0207662_10721360
712 Ga0207657_10211156
713 Ga0207652_10069946
714 Ga0207652_10118449
715 Ga0207646_10022270
716 Ga0207646_10037540
717 Ga0207646_10126904
718 Ga0207646_10160336
719 Ga0207646_11434329
720 Ga0207681_10004811
721 Ga0207694_10281568
722 Ga0207659_10059528
723 Ga0207659_10062927
724 Ga0207690_10075247
725 Ga0207706_10298201
726 Ga0207706_10947001
727 Ga0207706_11137408
728 Ga0207686_10212859
729 Ga0207670_10013382
730 Ga0207691_10070243
731 Ga0207691_10232788
732 Ga0207711_10038112
733 Ga0207689_10798985
734 Ga0207661_10356380
735 Ga0207651_10495106
736 Ga0207712_10124103
737 Ga0207712_10198475
738 Ga0207712_11269246
739 Ga0207668_10421443
740 Ga0207668_10868970
741 Ga0207668_11807784
742 Ga0207658_10451837
743 Ga0207703_10009885
744 Ga0207703_10413301
745 Ga0207639_11973954
746 Ga0207678_10248381
747 Ga0207678_10291090
748 Ga0207708_10250559
749 Ga0207641_10128834
750 Ga0207641_11880364
751 Ga0207648_10760526
752 Ga0207676_10034671
753 Ga0207676_10065514
754 Ga0207676_10910078
755 Ga0207675_100057676
756 Ga0207675_100112435
757 Ga0207675_100430798
758 Ga0207675_101542703
759 Ga0207698_10344492
760 Ga0209974_10145802
761 Ga0209974_10278065
762 Ga0207428_10004793
763 Ga0207428_10005325
764 Ga0207428_10046449
765 Ga0207428_10341316
766 Ga0207428_10380929
767 Ga0268266_10031777
768 Ga0268266_10341358
769 Ga0268266_10575782
770 Ga0268265_10018797
771 Ga0268265_10055887
772 Ga0268265_10169942
773 Ga0265760_10082876
774 Ga0307408_100134098
775 Ga0307408_100402036
776 Ga0307405_10195968
777 Ga0307405_10200360
778 Ga0307405_10924813
779 Ga0307413_10118718
780 Ga0307413_10138487
781 Ga0307410_10154269
782 Ga0307410_10438837
783 Ga0307410_10490902
784 Ga0307406_10056060
785 Ga0307406_10131874
786 Ga0307406_10303929
787 Ga0307407_10015444
788 Ga0307407_10258636
789 Ga0307407_10325680
790 Ga0307412_10098284
791 Ga0307412_11403663
792 Ga0307409_100081346
793 Ga0307409_100147031
794 Ga0307409_100870848
795 Ga0307416_100006370
796 Ga0307416_100009008
797 Ga0307416_100100251
798 Ga0307416_100504838
799 Ga0307414_10044489
800 Ga0307411_10004706
801 Ga0307411_10028135
802 Ga0307415_100003249
803 Ga0307415_100606903
804 Ga0307415_101022343
805 Ga0373959_0009236
806 Ga0373959_0039401
807 Ga0373940_0323098
808 Ga0373939_0078106
809 Ga0373946_0124578
810 Ga0373961_0085483
811 Ga0373961_0295308
812 Ga0373931_0078212
813 Ga0373927_0939455
814 Ga0395899_0855968
815 Ga0395900_0795508
816 Ga0395905_0171501
817 Ga0395905_0251609
818 Ga0395901_0679271
819 Ga0242420_000569
820 Ga0450900_032200
821 Ga0451577_0132044
822 Ga0451577_0430793
823 Ga0451577_0924108
824 Ga0439440_0032333
825 Ga0453683_0000243
826 Ga0453684_1358748
827 Ga0451576_0026785
828 Ga0451576_0229676
829 Ga0451576_0396016
830 Ga0466958_0761909
831 Ga0495603_0056640
832 Ga0495639_0203508
833 Ga0495594_0055671
834 Ga0495643_0000025
835 Ga0495656_0126024
836 Ga0495588_0169225
837 Ga0495599_0006729
838 Ga0495647_0019550
839 Ga0495647_0447607
840 Ga0495658_0069406
841 Ga0495676_0245269
842 Ga0495684_0088706
843 Ga0496100_0168806
844 Ga0496101_0209536
845 Ga0496101_0496501
846 Ga0496102_0086686
847 Ga0496102_0358589
848 Ga0496102_0449842
849 Ga0496102_0503820
850 Ga0496103_0058723
851 Ga0496103_0705882
852 Ga0496104_0004507
853 Ga0496104_0039654
854 Ga0496104_0653757
855 Ga0496106_0059321
856 Ga0496106_0547581
857 Ga0496107_1108868
858 Ga0496108_0006399
859 Ga0496108_0035992
860 Ga0496108_0149884
861 Ga0496108_1207080
862 Ga0496109_0011562
863 Ga0496109_0029537
864 Ga0496109_0193057
865 Ga0496109_0533206
866 Ga0496109_1268294
867 Ga0496110_0009024
868 Ga0496110_0011215
869 Ga0496110_0112017
870 Ga0496110_0845392
871 Ga0496111_0020064
872 Ga0496111_0033926
873 Ga0496111_0128915
874 Ga0496112_0000859
875 Ga0496112_0049515
876 Ga0496112_0111201
877 Ga0496112_0130543
878 Ga0496112_0210501
879 Ga0496112_0257797
880 Ga0496113_0000560
881 Ga0496113_0008982
882 Ga0496113_0084825
883 Ga0496114_0093713
884 Ga0496124_0713606
885 Ga0501032_0338278
886 Ga0501032_0632443
887 Ga0501033_0024277
888 Ga0501033_0417823
889 Ga0501036_0035989
890 Ga0501036_0297396
891 Ga0501037_0039245
892 Ga0501037_0190570
893 Ga0501037_0239570
894 Ga0501038_0048265
895 Ga0501038_0646634
896 Ga0501039_0967716
897 Ga0501040_0037269
898 Ga0501041_0094167
899 Ga0501041_0962645
900 Ga0501042_0033925
901 Ga0501042_0140016
902 Ga0501043_0172035
903 Ga0501043_0364175
904 Ga0501046_0024343
905 Ga0501046_0136553
906 Ga0501046_0252605
907 Ga0501047_0003113
908 Ga0501048_0030925
909 Ga0501067_0564574
910 Ga0501068_0137992
911 Ga0501070_1424819
912 Ga0501071_0083222
913 Ga0501075_0024224
914 Ga0501075_0066600
915 Ga0501075_1309853
916 Ga0501076_0056815
917 Ga0501076_0904357
918 Ga0501077_0003687
919 Ga0501077_0028262
920 Ga0501202_034117
921 Ga0501209_015286
922 Ga0501209_138583
923 Ga0501216_119333
924 Ga0501217_008846
925 Ga0501228_011632
926 Ga0501236_004283
927 Ga0501239_001977
928 Ga0501243_002314
929 Ga0501225_0083418
930 Ga0501079_0013792
931 Ga0501079_0020210
932 Ga0501080_0090470
933 Ga0501080_0144635
934 Ga0501081_0001396
935 Ga0501081_0008210
936 Ga0501083_0028210
937 Ga0501241_028267
938 Ga0501263_007232
939 Ga0501263_027593
940 Ga0501264_011075
941 Ga0501268_000342
942 Ga0501268_004537
943 Ga0501273_000615
944 Ga0501279_038528
945 Ga0501035_0017125
946 Ga0501035_0223992
947 Ga0501044_0024250
948 Ga0501045_0010271
949 Ga0501045_0062236
950 Ga0501204_000367
951 nmdc:mga00v17_330099_c1
952 nmdc:mga05p37_102927_c1
953 nmdc:mga05p37_1464898_c1
954 nmdc:mga05p37_1504047_c1
955 nmdc:mga05p37_303106_c1
956 nmdc:mga05p37_43944_c1
957 nmdc:mga05p37_85_c1
958 nmdc:mga0qj67_1087293_c1
959 nmdc:mga0qj67_458169_c1
960 nmdc:mga0qj67_51028_c1
961 nmdc:mga0qj67_5745_c1
962 nmdc:mga06r32_1448_c1
963 nmdc:mga06r32_1721362_c1
964 nmdc:mga06r32_218039_c1
965 nmdc:mga06r32_229889_c1
966 nmdc:mga06r32_379111_c1
967 nmdc:mga06r32_427791_c1
968 nmdc:mga06r32_509891_c1
969 nmdc:mga06r32_867624_c1
970 nmdc:mga08y16_185485_c1
971 nmdc:mga08y16_239874_c1
972 nmdc:mga08y16_2904_c1
973 nmdc:mga08y16_6106_c1
974 nmdc:mga0n895_61757_c1
975 nmdc:mga0n895_750115_c1
976 nmdc:mga0rr50_12716_c1
977 nmdc:mga0rr50_38926_c1
978 nmdc:mga0rr50_643766_c1
979 nmdc:mga08x19_61451_c1
980 nmdc:mga08x19_93850_c1
981 nmdc:mga0a205_104088_c1
982 nmdc:mga0a205_160708_c1
983 Ga0500651_0143650
984 Ga0500556_0001942
985 Ga0501084_0016291
986 Ga0501084_0056548
987 Ga0590071_001107
988 Ga0590075_008403
989 Ga0590077_079417
990 Ga0501082_0002427
991 Ga0530510_0022748
992 Ga0530510_0427459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

46

177

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.7219 1 157
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.7109 7 153
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.7103 1 157
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.6741 3 159
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.6657 1 159
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7006 2 153 1.20.120.450
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6927 8 153 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6762 1 157 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6688 2 153 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6654 1 157 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V8HUC6-F1-model_v4 ABC transporter 0.9964 3 158
AF-A0A2V8XBX3-F1-model_v4 ABC transporter 0.991 25 159
AF-A0A2V9J496-F1-model_v4 ABC transporter 0.9884 3 158
AF-Q2S0D5-F1-model_v4 DinB-like domain-containing protein 0.9878 3 156
AF-A0A4D7JX47-F1-model_v4 ABC transporter 0.9874 1 156

Map