F454860

General Info

Members Datasets Scaffolds Average Seq Length
496 360 992 155

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10075074|Ga0081455_100750741
Length 176
Sequence MNSSSIRQMLDGLCRAAEQRDGKTFASHFAEDGVYHDDFYGAFVGRERVAELINDWFHKDARALRWDMIEPAYDGGRLYVRYVFSYNSTLPEARDARAMFEGVAIMSLRDGKITEYREIISCGTAFVDMNFHPERIFKIFARKAAAMKMKPEVQRHLPTVEKTSREPRAGHRPEAP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
137 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
138 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
141 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
235 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
236 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
237 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
238 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
239 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
248 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
249 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
250 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
251 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
254 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
255 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
256 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
257 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
258 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
259 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
260 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
261 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
262 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
263 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
264 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
265 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
266 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
267 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
268 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
269 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
270 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
271 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
272 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
273 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
274 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
275 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
276 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
277 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
278 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
279 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
280 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
281 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
282 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
283 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
284 2922368715
285 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
286 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
287 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
288 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
289 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
290 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
291 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
292 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
293 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
294 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
295 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
296 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
297 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
298 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
299 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
300 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
301 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
302 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
303 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
304 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
305 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
306 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
307 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
308 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
309 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
310 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
311 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
312 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
313 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
314 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
315 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
316 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
317 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
318 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
319 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
320 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
321 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
322 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
323 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
324 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
325 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
326 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
327 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
328 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
329 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
330 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
331 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
332 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
333 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
334 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
335 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
336 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
337 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
338 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
339 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
340 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
341 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
342 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
343 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
344 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
345 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
346 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
347 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
348 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
349 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
350 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
351 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
352 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
353 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
354 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
355 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
356 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
357 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
358 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
359 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
360 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.38
Metatranscriptomes 0.2
Isolates 21.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 18.55
Rhizoplane 4.84
Rhizosphere 57.66
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10075074 3300005937 Unclassified 2790
2 JGI25153J46596_10009574 3300003215 Bacteria 4479
3 JGI25160J50197_1016063 3300003354 Bacteria 2427
4 Ga0065165_1044635 3300005262 Bacteria 1295
5 Ga0070658_10644524 3300005327 Bacteria 919
6 Ga0070676_11068179 3300005328 Bacteria 609
7 Ga0070683_100004460 3300005329 Bacteria 11548
8 Ga0070683_100015277 3300005329 Bacteria 6741
9 Ga0070670_102029085 3300005331 Bacteria 530
10 Ga0068869_100786664 3300005334 Bacteria 817
11 Ga0070680_100093595 3300005336 Bacteria 2490
12 Ga0070680_100922329 3300005336 Bacteria 754
13 Ga0070680_101109936 3300005336 Bacteria 684
14 Ga0070682_100026381 3300005337 Bacteria 3476
15 Ga0070682_100113038 3300005337 Bacteria 1813
16 Ga0068868_101064024 3300005338 Bacteria 743
17 Ga0068868_101185142 3300005338 Bacteria 706
18 Ga0070687_100695425 3300005343 Bacteria 710
19 Ga0070661_100165801 3300005344 Bacteria 1675
20 Ga0070675_101183243 3300005354 Bacteria 704
21 Ga0070671_100721331 3300005355 Bacteria 865
22 Ga0070673_100694647 3300005364 Bacteria 934
23 Ga0070713_100756320 3300005436 Bacteria 930
24 Ga0070708_100102378 3300005445 Bacteria 2624
25 Ga0070678_100016811 3300005456 Bacteria 4690
26 Ga0070678_101875862 3300005456 Bacteria 566
27 Ga0070681_10012145 3300005458 Bacteria 8543
28 Ga0070681_10015192 3300005458 Bacteria 7658
29 Ga0070681_10258669 3300005458 Bacteria 1653
30 Ga0070681_10322347 3300005458 Bacteria 1455
31 Ga0070706_100112399 3300005467 Bacteria 2535
32 Ga0070706_100310566 3300005467 Bacteria 1471
33 Ga0070698_100003587 3300005471 Bacteria 17059
34 Ga0070698_100830042 3300005471 Bacteria 869
35 Ga0070699_100409643 3300005518 Bacteria 1226
36 Ga0070679_100007272 3300005530 Bacteria 10338
37 Ga0070679_100030356 3300005530 Bacteria 5337
38 Ga0070684_100010952 3300005535 Bacteria 7209
39 Ga0070684_100072138 3300005535 Bacteria 3039
40 Ga0070697_100060057 3300005536 Bacteria 3098
41 Ga0070697_100294277 3300005536 Bacteria 1395
42 Ga0068853_100068121 3300005539 Bacteria 3093
43 Ga0068853_100094100 3300005539 Bacteria 2639
44 Ga0070672_101195000 3300005543 Unclassified 677
45 Ga0070693_100268717 3300005547 Unclassified 1137
46 Ga0070693_101009681 3300005547 Bacteria 630
47 Ga0070665_100033886 3300005548 Bacteria 5137
48 Ga0070665_100050153 3300005548 Bacteria 4188
49 Ga0070704_100599894 3300005549 Bacteria 968
50 Ga0068855_100088206 3300005563 Bacteria 3583
51 Ga0068855_101189030 3300005563 Unclassified 793
52 Ga0068855_101191090 3300005563 Bacteria 793
53 Ga0070664_100021866 3300005564 Bacteria 5273
54 Ga0068856_100140571 3300005614 Bacteria 2421
55 Ga0068856_100507118 3300005614 Bacteria 1227
56 Ga0068856_101023416 3300005614 Unclassified 844
57 Ga0068856_101203907 3300005614 Bacteria 774
58 Ga0068852_100024177 3300005616 Bacteria 4906
59 Ga0068852_100516385 3300005616 Bacteria 1191
60 Ga0068859_100149351 3300005617 Bacteria 2413
61 Ga0068859_100362051 3300005617 Bacteria 1545
62 Ga0068864_100960957 3300005618 Bacteria 846
63 Ga0068858_101573254 3300005842 Bacteria 649
64 Ga0068860_100224889 3300005843 Bacteria 1823
65 Ga0068862_101347585 3300005844 Bacteria 716
66 Ga0068862_101666537 3300005844 Bacteria 645
67 Ga0081455_10000165 3300005937 Bacteria 81987
68 Ga0081455_10033257 3300005937 Bacteria 4636
69 Ga0081455_10058499 3300005937 Bacteria 3261
70 Ga0081540_1246509 3300005983 Bacteria 625
71 Ga0081539_10084052 3300005985 Bacteria 1665
72 Ga0070717_10893199 3300006028 Bacteria 809
73 Ga0075365_10020137 3300006038 Bacteria 4131
74 Ga0075365_10431562 3300006038 Bacteria 930
75 Ga0075365_10848082 3300006038 Bacteria 644
76 Ga0070712_101300145 3300006175 Bacteria 634
77 Ga0075367_10250652 3300006178 Bacteria 1110
78 Ga0075366_10535482 3300006195 Bacteria 725
79 Ga0097621_100294441 3300006237 Bacteria 1432
80 Ga0075370_10186488 3300006353 Bacteria 1221
81 Ga0075370_10435065 3300006353 Bacteria 789
82 Ga0097620_100149350 3300006931 Bacteria 2413
83 Ga0097620_100362044 3300006931 Bacteria 1545
84 Ga0099794_10020634 3300007265 Bacteria 2984
85 Ga0105240_10244910 3300009093 Bacteria 2076
86 Ga0105240_11099761 3300009093 Bacteria 846
87 Ga0111539_10739439 3300009094 Bacteria 1145
88 Ga0111539_12118668 3300009094 Bacteria 652
89 Ga0105247_10243317 3300009101 Bacteria 1227
90 Ga0105241_10109113 3300009174 Bacteria 2213
91 Ga0105248_10208966 3300009177 Bacteria 2199
92 Ga0105248_10831268 3300009177 Bacteria 1042
93 Ga0105248_10959623 3300009177 Bacteria 966
94 Ga0105237_10540997 3300009545 Bacteria 1171
95 Ga0105238_10102507 3300009551 Bacteria 2843
96 Ga0105238_10441049 3300009551 Bacteria 1298
97 Ga0105249_10061794 3300009553 Bacteria 3438
98 Ga0105249_11081298 3300009553 Bacteria 872
99 Ga0105239_11015610 3300010375 Bacteria 954
100 Ga0157370_10010808 3300013104 Bacteria 9594
101 Ga0157370_10614622 3300013104 Bacteria 994
102 Ga0157369_10055172 3300013105 Bacteria 4289
103 Ga0157369_11104129 3300013105 Unclassified 811
104 Ga0157369_11718432 3300013105 Bacteria 638
105 Ga0157374_10212779 3300013296 Bacteria 1896
106 Ga0157374_10859675 3300013296 Bacteria 924
107 Ga0163162_10605122 3300013306 Bacteria 1222
108 Ga0163162_10773392 3300013306 Bacteria 1078
109 Ga0163162_11432791 3300013306 Bacteria 786
110 Ga0157372_11332824 3300013307 Bacteria 828
111 Ga0157375_10705812 3300013308 Bacteria 1162
112 Ga0157375_12303677 3300013308 Bacteria 642
113 Ga0163163_12198306 3300014325 Bacteria 611
114 Ga0182008_10565434 3300014497 Bacteria 634
115 Ga0157379_10172963 3300014968 Bacteria 1950
116 Ga0157379_10756295 3300014968 Bacteria 915
117 Ga0182007_10236819 3300015262 Bacteria 650
118 Ga0206353_10077123 3300020082 Bacteria 682
119 Ga0213871_10005818 3300021441 Bacteria 2575
120 Ga0209677_101289 3300025253 Bacteria 11184
121 Ga0209758_1001177 3300025297 Bacteria 33138
122 Ga0209758_1006424 3300025297 Bacteria 8456
123 Ga0209758_1019339 3300025297 Bacteria 3288
124 Ga0207426_1002219 3300025302 Bacteria 13027
125 Ga0207426_1005323 3300025302 Bacteria 5915
126 Ga0207426_1011734 3300025302 Bacteria 3320
127 Ga0207426_1021850 3300025302 Bacteria 2205
128 Ga0207426_1055766 3300025302 Bacteria 1156
129 Ga0209257_1040726 3300025304 Bacteria 1383
130 Ga0207710_10197174 3300025900 Bacteria 993
131 Ga0207647_10124872 3300025904 Bacteria 1515
132 Ga0207647_10398942 3300025904 Bacteria 775
133 Ga0207645_10419753 3300025907 Bacteria 901
134 Ga0207705_10795101 3300025909 Bacteria 734
135 Ga0207684_10068738 3300025910 Bacteria 3010
136 Ga0207684_10494629 3300025910 Bacteria 1048
137 Ga0207654_10068048 3300025911 Bacteria 2106
138 Ga0207654_10479673 3300025911 Bacteria 876
139 Ga0207707_10000100 3300025912 Bacteria 85682
140 Ga0207707_10013022 3300025912 Bacteria 7241
141 Ga0207707_10653026 3300025912 Bacteria 886
142 Ga0207695_10046470 3300025913 Bacteria 4602
143 Ga0207660_10168390 3300025917 Bacteria 1695
144 Ga0207662_10557783 3300025918 Bacteria 794
145 Ga0207657_10404959 3300025919 Bacteria 1073
146 Ga0207649_10089196 3300025920 Bacteria 2015
147 Ga0207649_10395392 3300025920 Bacteria 1033
148 Ga0207652_10093647 3300025921 Bacteria 2644
149 Ga0207652_11650171 3300025921 Bacteria 545
150 Ga0207681_10166024 3300025923 Bacteria 1669
151 Ga0207694_10205995 3300025924 Bacteria 1601
152 Ga0207694_10574515 3300025924 Bacteria 947
153 Ga0207659_10576244 3300025926 Bacteria 958
154 Ga0207700_10029810 3300025928 Bacteria 3854
155 Ga0207644_10436196 3300025931 Bacteria 1075
156 Ga0207661_10006741 3300025944 Bacteria 8129
157 Ga0207661_10254048 3300025944 Bacteria 1563
158 Ga0207679_10040119 3300025945 Bacteria 3349
159 Ga0207667_10204442 3300025949 Bacteria 2025
160 Ga0207667_10981575 3300025949 Bacteria 833
161 Ga0207668_10970704 3300025972 Bacteria 758
162 Ga0207640_10905192 3300025981 Bacteria 771
163 Ga0207703_11049553 3300026035 Bacteria 782
164 Ga0207639_10075381 3300026041 Bacteria 2652
165 Ga0207678_10201664 3300026067 Bacteria 1701
166 Ga0207702_10325683 3300026078 Bacteria 1464
167 Ga0207702_10962770 3300026078 Unclassified 846
168 Ga0207702_11238975 3300026078 Bacteria 740
169 Ga0207641_12118935 3300026088 Bacteria 563
170 Ga0207648_10266981 3300026089 Bacteria 1528
171 Ga0207674_10073705 3300026116 Bacteria 3427
172 Ga0207675_100872184 3300026118 Bacteria 915
173 Ga0207683_10013541 3300026121 Bacteria 6959
174 Ga0207428_10597044 3300027907 Bacteria 796
175 Ga0268266_10035191 3300028379 Bacteria 4260
176 Ga0268266_10214817 3300028379 Bacteria 1765
177 Ga0268266_10318435 3300028379 Bacteria 1455
178 Ga0268265_10285532 3300028380 Bacteria 1479
179 Ga0268264_10772897 3300028381 Bacteria 958
180 Ga0268264_11350849 3300028381 Bacteria 723
181 Ga0265334_10003250 3300028573 Bacteria 7418
182 Ga0265340_10012237 3300031247 Bacteria 4534
183 Ga0307513_10037882 3300031456 Bacteria 5361
184 Ga0373936_0015383 3300035113 Bacteria 2933
185 Ga0373939_0018613 3300035114 Bacteria 1864
186 Ga0373960_0111342 3300035121 Bacteria 899
187 Ga0373943_0323985 3300035170 Bacteria 879
188 Ga0373942_0112015 3300035207 Bacteria 845
189 Ga0373931_0114934 3300035691 Bacteria 1531
190 Ga0373931_0241506 3300035691 Bacteria 1095
191 Ga0373931_0267543 3300035691 Bacteria 1045
192 Ga0373935_0950156 3300035692 Bacteria 638
193 Ga0373927_0432914 3300035695 Bacteria 868
194 Ga0373937_0685154 3300036401 Bacteria 971
195 Ga0373925_1269582 3300037068 Bacteria 604
196 Ga0395899_0009033 3300037312 Bacteria 7660
197 Ga0395899_0121221 3300037312 Bacteria 1873
198 Ga0395900_0001350 3300037418 Bacteria 29640
199 Ga0395900_0045645 3300037418 Bacteria 4513
200 Ga0395900_0405001 3300037418 Bacteria 1327
201 Ga0395898_0029321 3300037466 Bacteria 5514
202 Ga0395898_0265353 3300037466 Bacteria 1637
203 Ga0395905_0003532 3300037471 Bacteria 16666
204 Ga0395905_0161919 3300037471 Bacteria 2103
205 Ga0395905_0351338 3300037471 Bacteria 1366
206 Ga0395905_0367892 3300037471 Bacteria 1331
207 Ga0395905_0998986 3300037471 Bacteria 740
208 Ga0395901_0006638 3300038443 Bacteria 11691
209 Ga0395901_0008112 3300038443 Bacteria 10605
210 Ga0395901_0014435 3300038443 Bacteria 8038
211 Ga0395901_0150459 3300038443 Bacteria 2446
212 Ga0395901_0572247 3300038443 Bacteria 1142
213 Ga0436365_0296096 3300039437 Bacteria 2876
214 Ga0436360_0556698 3300039438 Bacteria 5831
215 Ga0436361_0603476 3300039447 Bacteria 7241
216 Ga0436363_0759156 3300039450 Bacteria 3134
217 Ga0436363_1716462 3300039450 Bacteria 599
218 Ga0439447_064844 3300041407 Bacteria 855
219 Ga0451787_242462 3300041441 Bacteria 613
220 Ga0451789_0651673 3300041443 Bacteria 1217
221 Ga0451793_0051564 3300041452 Bacteria 1653
222 Ga0451839_0317516 3300041496 Bacteria 705
223 Ga0451855_1417582 3300041511 Bacteria 799
224 Ga0451853_1625668 3300041512 Bacteria 1200
225 Ga0466967_0020928 3300045976 Bacteria 5299
226 Ga0495592_0195716 3300046454 Bacteria 1367
227 Ga0495629_0230874 3300046459 Bacteria 1275
228 Ga0495651_0008047 3300046462 Bacteria 8083
229 Ga0495651_0233100 3300046462 Bacteria 1267
230 Ga0495653_0638479 3300046463 Bacteria 651
231 Ga0495605_0163305 3300046474 Bacteria 988
232 Ga0495605_0183817 3300046474 Bacteria 918
233 Ga0495664_0015315 3300046477 Bacteria 4357
234 Ga0495664_0086875 3300046477 Bacteria 1879
235 Ga0495664_0573337 3300046477 Bacteria 672
236 Ga0495584_0193670 3300046491 Bacteria 1033
237 Ga0495584_0648246 3300046491 Bacteria 538
238 Ga0495607_0222291 3300046501 Bacteria 923
239 Ga0495583_0069993 3300046506 Bacteria 1544
240 Ga0495606_0067588 3300046507 Bacteria 2262
241 Ga0495606_0087674 3300046507 Bacteria 1920
242 Ga0495608_0536702 3300046511 Bacteria 706
243 Ga0495616_0053540 3300046513 Bacteria 2005
244 Ga0495618_0624477 3300046514 Bacteria 639
245 Ga0495628_0046301 3300046516 Bacteria 3455
246 Ga0495648_0007591 3300046524 Bacteria 8661
247 Ga0495648_0129425 3300046524 Bacteria 1344
248 Ga0495652_0026606 3300046529 Bacteria 5107
249 Ga0495652_0079832 3300046529 Bacteria 2704
250 Ga0495652_0572179 3300046529 Bacteria 774
251 Ga0495665_0150749 3300046531 Bacteria 1214
252 Ga0495640_0053549 3300046533 Bacteria 2766
253 Ga0495640_0384373 3300046533 Bacteria 863
254 Ga0495587_0020838 3300046536 Bacteria 4044
255 Ga0495622_0007520 3300046557 Bacteria 5054
256 Ga0495622_0030278 3300046557 Bacteria 2529
257 Ga0495667_0027440 3300046559 Bacteria 3837
258 Ga0495656_0160783 3300046615 Bacteria 1091
259 Ga0495668_0064460 3300046616 Bacteria 2017
260 Ga0495668_0387120 3300046616 Bacteria 768
261 Ga0495668_0599198 3300046616 Bacteria 609
262 Ga0495634_0022629 3300046642 Bacteria 4427
263 Ga0495625_0333583 3300046660 Bacteria 963
264 Ga0495635_0008534 3300046663 Bacteria 7156
265 Ga0495635_0110288 3300046663 Bacteria 1879
266 Ga0495659_0313178 3300046664 Bacteria 665
267 Ga0495661_0216643 3300046665 Bacteria 994
268 Ga0495588_0079618 3300046674 Bacteria 1710
269 Ga0495599_0292091 3300046678 Bacteria 985
270 Ga0495599_0722658 3300046678 Bacteria 573
271 Ga0495623_0003900 3300046679 Bacteria 9836
272 Ga0495646_0050416 3300046680 Bacteria 2523
273 Ga0495646_0243834 3300046680 Bacteria 965
274 Ga0495647_0130167 3300046681 Bacteria 1066
275 Ga0495613_0066962 3300046689 Bacteria 2621
276 Ga0495624_0067530 3300046690 Bacteria 2230
277 Ga0495671_0015307 3300046692 Bacteria 4113
278 Ga0495649_0109077 3300046694 Bacteria 1468
279 Ga0495649_0654016 3300046694 Bacteria 517
280 Ga0495589_0124536 3300046794 Bacteria 1240
281 Ga0495600_0038537 3300046809 Bacteria 3110
282 Ga0495660_0208416 3300046810 Bacteria 929
283 Ga0495581_0077806 3300047315 Bacteria 1920
284 Ga0495604_0016427 3300047317 Bacteria 5916
285 Ga0495604_0021055 3300047317 Bacteria 5203
286 Ga0495604_0240720 3300047317 Bacteria 1237
287 Ga0495636_0187048 3300047318 Bacteria 942
288 Ga0495674_0166415 3300047319 Bacteria 1842
289 Ga0495674_0185262 3300047319 Bacteria 1732
290 Ga0495674_1448394 3300047319 Bacteria 510
291 Ga0495676_0047026 3300047321 Bacteria 3494
292 Ga0495676_1056225 3300047321 Bacteria 517
293 Ga0495675_0002868 3300047444 Bacteria 10339
294 Ga0495677_0201950 3300047445 Bacteria 773
295 Ga0495685_072604 3300047447 Bacteria 1151
296 Ga0495684_0406505 3300047471 Bacteria 954
297 Ga0495684_0474483 3300047471 Bacteria 865
298 Ga0495686_0207557 3300047472 Bacteria 1121
299 Ga0495593_0077057 3300047673 Bacteria 1727
300 Ga0495593_0269918 3300047673 Bacteria 851
301 Ga0495602_0006250 3300048088 Bacteria 12494
302 Ga0495602_0065373 3300048088 Bacteria 3139
303 Ga0496101_0533869 3300048904 Bacteria 927
304 Ga0496102_0163600 3300048905 Bacteria 2093
305 Ga0496104_0005317 3300048907 Bacteria 11262
306 Ga0496104_0264481 3300048907 Bacteria 1632
307 Ga0496104_0718501 3300048907 Bacteria 907
308 Ga0496105_0008712 3300048908 Bacteria 7893
309 Ga0496105_0357564 3300048908 Bacteria 1165
310 Ga0496105_0567770 3300048908 Bacteria 884
311 Ga0496106_0122703 3300048909 Bacteria 2032
312 Ga0496108_0924164 3300048911 Bacteria 748
313 Ga0496109_0280152 3300048912 Bacteria 1571
314 Ga0496110_1352616 3300048913 Bacteria 621
315 Ga0496111_0081497 3300048914 Bacteria 2362
316 Ga0496112_0075249 3300048915 Bacteria 3339
317 Ga0496112_0307551 3300048915 Bacteria 1530
318 Ga0496113_0022521 3300048916 Bacteria 4458
319 Ga0496113_0058728 3300048916 Bacteria 2895
320 Ga0496114_0070345 3300048917 Bacteria 2939
321 Ga0496114_0296409 3300048917 Bacteria 1427
322 Ga0496115_0219527 3300048918 Bacteria 1569
323 Ga0496115_0451303 3300048918 Bacteria 1038
324 Ga0496116_0115080 3300048919 Bacteria 1570
325 Ga0496117_0260714 3300048920 Bacteria 940
326 Ga0496118_0136851 3300048921 Bacteria 1561
327 Ga0496118_0312475 3300048921 Bacteria 857
328 Ga0496119_0014481 3300048922 Bacteria 6168
329 Ga0496120_0008272 3300048923 Bacteria 7592
330 Ga0496121_0360062 3300048924 Bacteria 966
331 Ga0496121_0396984 3300048924 Bacteria 904
332 Ga0496126_0059143 3300048929 Bacteria 3452
333 Ga0496126_0085867 3300048929 Bacteria 2774
334 Ga0496126_0112120 3300048929 Bacteria 2375
335 Ga0496126_0297636 3300048929 Bacteria 1332
336 Ga0496126_0516056 3300048929 Bacteria 953
337 Ga0496126_0618248 3300048929 Bacteria 851
338 Ga0495682_0017444 3300049460 Bacteria 2709
339 Ga0501034_0000663 3300049571 Bacteria 52410
340 Ga0501034_0002763 3300049571 Bacteria 20594
341 Ga0501043_0905724 3300049579 Unclassified 632
342 Ga0501047_0217546 3300049581 Bacteria 1767
343 Ga0501068_0402493 3300049584 Bacteria 883
344 Ga0501072_0148521 3300049588 Bacteria 1869
345 Ga0501072_1249641 3300049588 Bacteria 576
346 Ga0501074_0338734 3300049590 Bacteria 1068
347 nmdc:mga03683_426860_c1 3300050489 Bacteria 635
348 nmdc:mga03683_566761_c1 3300050489 Bacteria 554
349 nmdc:mga00v17_560377_c1 3300050491 Bacteria 738
350 nmdc:mga0yw44_1147092_c1 3300050492 Bacteria 525
351 nmdc:mga0yw44_36677_c1 3300050492 Bacteria 2890
352 nmdc:mga0k408_182657_c1 3300050493 Bacteria 1251
353 nmdc:mga06z11_124099_c1 3300050494 Bacteria 1443
354 nmdc:mga06z11_433666_c1 3300050494 Bacteria 793
355 nmdc:mga07m45_360689_c1 3300050496 Bacteria 844
356 nmdc:mga07m45_375105_c1 3300050496 Bacteria 826
357 nmdc:mga0qj67_1272946_c1 3300050509 Bacteria 570
358 nmdc:mga08x19_1323_c1 3300050514 Bacteria 15368
359 nmdc:mga0sz30_30277_c1 3300050516 Bacteria 2236
360 Ga0500635_0189461 3300053080 Bacteria 797
361 Ga0495619_0053857 3300053085 Bacteria 2662
362 Ga0495619_0489933 3300053085 Bacteria 846
363 Ga0500578_0038187 3300053086 Bacteria 3085
364 Ga0500578_0060200 3300053086 Bacteria 2426
365 Ga0500644_0099855 3300053088 Bacteria 1101
366 Ga0500647_0031022 3300053091 Bacteria 2541
367 Ga0500566_0001036 3300053094 Bacteria 16076
368 Ga0500566_0058910 3300053094 Bacteria 2179
369 Ga0500566_0266563 3300053094 Bacteria 824
370 Ga0500557_000113 3300053105 Bacteria 22739
371 Ga0500572_015020 3300053111 Bacteria 1945
372 Ga0500595_030924 3300053119 Bacteria 1799
373 Ga0500595_125441 3300053119 Bacteria 724
374 Ga0500607_128499 3300053121 Bacteria 1212
375 Ga0500608_228945 3300053122 Bacteria 743
376 Ga0500614_019819 3300053123 Bacteria 1545
377 Ga0500642_0000056 3300053130 Bacteria 67746
378 Ga0500652_119262 3300053131 Bacteria 1103
379 Ga0500559_0127453 3300053136 Bacteria 1187
380 Ga0500559_0381043 3300053136 Bacteria 657
381 Ga0500585_270576 3300053144 Bacteria 529
382 Ga0500590_130673 3300053148 Bacteria 1162
383 Ga0500590_161864 3300053148 Bacteria 996
384 Ga0500619_247555 3300053154 Bacteria 587
385 Ga0500620_172761 3300053155 Bacteria 746
386 Ga0500638_206402 3300053162 Bacteria 826
387 Ga0500636_0002161 3300053177 Bacteria 10852
388 Ga0500636_0374347 3300053177 Bacteria 670
389 Ga0500625_000216 3300053729 Bacteria 13088
390 2508539085 2508501009 Bacteria 7784016
391 2508695446 2508501042 Bacteria 8719808
392 2511400862 2511231028 Bacteria 8046582
393 2513674658 2513237098 Bacteria 9902361
394 2513860495 2513237137 Bacteria 9558895
395 2515625582 2515154112 Bacteria 8294334
396 2517107102 2517093001 Bacteria 9002274
397 2524436005 2524023205 Bacteria 8918781
398 2524467775 2524023210 Bacteria 9029266
399 2528851276 2528768022 Bacteria 10457665
400 2745081602 2744054633 Bacteria 8678936
401 2793064869 2791355196 Bacteria 7323613
402 2824663830 2824661429 Bacteria 9877870
403 2824682681 2824679649 Bacteria 8248951
404 2824709954 2824704595 Bacteria 9667483
405 2824757706 2824753945 Bacteria 9787441
406 2824768782 2824763712 Bacteria 9792355
407 2874597151 2874590934 Bacteria 8299676
408 2874628889 2874628541 Bacteria 8630250
409 2874646957 2874645413 Bacteria 8214782
410 2876777615 2876771140 Bacteria 8287509
411 2876825697 2876818435 Bacteria 8274608
412 2879076176 2879074833 Bacteria 8279565
413 2879108636 2879099564 Bacteria 10442239
414 2879130983 2879127579 Bacteria 8294491
415 2879148782 2879142872 Bacteria 8267021
416 2885413947 2885409591 Bacteria 9235467
417 2888390757 2888388044 Bacteria 7304136
418 2903775693 2903768456 Bacteria 9749579
419 2904713092 2904711408 Bacteria 9771557
420 2922378704
421 2922398927 2922393267 Bacteria 8285685
422 2929618515 2929615660 Bacteria 9193770
423 2929628800 2929624759 Bacteria 9339455
424 2932786703 2932784394 Bacteria 9704911
425 2932794399 2932794094 Bacteria 7915132
426 2932806683 2932801729 Bacteria 7987968
427 2932812253 2932809354 Bacteria 9135765
428 2932823244 2932818245 Bacteria 9955613
429 2932829916 2932828146 Bacteria 9745859
430 2933580773 2933577622 Bacteria 9116884
431 2935618434 2935616580 Bacteria 9032984
432 2935641168 2935638405 Bacteria 10015038
433 2935653685 2935648319 Bacteria 8801166
434 2935662434 2935656913 Bacteria 8965014
435 2935670084 2935665750 Bacteria 9571747
436 2935679063 2935675223 Bacteria 9928132
437 2935689937 2935684952 Bacteria 9590419
438 2935698458 2935694250 Bacteria 9291695
439 2935707600 2935703347 Bacteria 10242284
440 2935717456 2935713505 Bacteria 9608509
441 2935723874 2935722832 Bacteria 9608746
442 2935740083 2935732158 Bacteria 9706831
443 2935749346 2935741537 Bacteria 9707219
444 2935757291 2935750917 Bacteria 9590372
445 2935763623 2935760218 Bacteria 9817913
446 2935773338 2935769743 Bacteria 7878163
447 2935782203 2935777560 Bacteria 8077691
448 2935789164 2935785616 Bacteria 7962367
449 2935797101 2935793552 Bacteria 8012592
450 2935804012 2935801545 Bacteria 9301974
451 2935815106 2935810662 Bacteria 9401221
452 2935830899 2935827899 Bacteria 10038562
453 2935841509 2935837841 Bacteria 9454360
454 2935862471 2935855204 Bacteria 9035059
455 2935866601 2935864058 Bacteria 9784707
456 2935874908 2935873716 Bacteria 9632195
457 2935888454 2935883170 Bacteria 7964738
458 2935977621 2935975950 Bacteria 8347125
459 2935985104 2935984226 Bacteria 8302647
460 2935994414 2935992306 Bacteria 9802711
461 2936004608 2936002035 Bacteria 9362176
462 2936016736 2936011229 Bacteria 8801034
463 2936025369 2936019824 Bacteria 8804134
464 2936034211 2936028420 Bacteria 8965941
465 2936043173 2936037263 Bacteria 9446081
466 2936052268 2936046547 Bacteria 8903709
467 2936056273 2936055302 Bacteria 8785755
468 2940563204 2940556831 Bacteria 9590747
469 2941535592 2941531003 Bacteria 7653939
470 2941543121 2941538514 Bacteria 9402094
471 3005593153 3005587118 Bacteria 7794411
472 3005594941 3005594810 Bacteria 8716512
473 3005710918 3005710791 Bacteria 7622528
474 8016518276 8016511872 Bacteria 9921665
475 8016526052 8016522445 Bacteria 8156687
476 8016539660 8016530956 Bacteria 8155261
477 8016543961 8016539877 Bacteria 8155419
478 8016549343 8016548790 Bacteria 8155074
479 8016557770 8016557553 Bacteria 8154380
480 8016569362 8016566248 Bacteria 8158151
481 8016581984 8016575299 Bacteria 8154085
482 8016595795 8016595262 Bacteria 8149947
483 8016606658 8016603502 Bacteria 8731218
484 8016618554 8016613128 Bacteria 8794220
485 8016623287 8016622563 Bacteria 7999408
486 8016635716 8016630954 Bacteria 9217207
487 8017058377 8017057580 Bacteria 10023680
488 8019530938 8019530166 Bacteria 8155624
489 8019540642 8019538911 Bacteria 7872763
490 8019550306 8019547302 Bacteria 7996444
491 8019622884 8019619141 Bacteria 9218857
492 8019630226 8019629233 Bacteria 8687553
493 8019652567 8019648815 Bacteria 10014479
494 8019667058 8019659431 Bacteria 8577854
495 8019676847 8019668869 Bacteria 8791617
496 8055742365 8055742211 Bacteria 9226248
497 Ga0081455_10075074
498 JGI25153J46596_10009574
499 JGI25160J50197_1016063
500 Ga0065165_1044635
501 Ga0070658_10644524
502 Ga0070676_11068179
503 Ga0070683_100004460
504 Ga0070683_100015277
505 Ga0070670_102029085
506 Ga0068869_100786664
507 Ga0070680_100093595
508 Ga0070680_100922329
509 Ga0070680_101109936
510 Ga0070682_100026381
511 Ga0070682_100113038
512 Ga0068868_101064024
513 Ga0068868_101185142
514 Ga0070687_100695425
515 Ga0070661_100165801
516 Ga0070675_101183243
517 Ga0070671_100721331
518 Ga0070673_100694647
519 Ga0070713_100756320
520 Ga0070708_100102378
521 Ga0070678_100016811
522 Ga0070678_101875862
523 Ga0070681_10012145
524 Ga0070681_10015192
525 Ga0070681_10258669
526 Ga0070681_10322347
527 Ga0070706_100112399
528 Ga0070706_100310566
529 Ga0070698_100003587
530 Ga0070698_100830042
531 Ga0070699_100409643
532 Ga0070679_100007272
533 Ga0070679_100030356
534 Ga0070684_100010952
535 Ga0070684_100072138
536 Ga0070697_100060057
537 Ga0070697_100294277
538 Ga0068853_100068121
539 Ga0068853_100094100
540 Ga0070672_101195000
541 Ga0070693_100268717
542 Ga0070693_101009681
543 Ga0070665_100033886
544 Ga0070665_100050153
545 Ga0070704_100599894
546 Ga0068855_100088206
547 Ga0068855_101189030
548 Ga0068855_101191090
549 Ga0070664_100021866
550 Ga0068856_100140571
551 Ga0068856_100507118
552 Ga0068856_101023416
553 Ga0068856_101203907
554 Ga0068852_100024177
555 Ga0068852_100516385
556 Ga0068859_100149351
557 Ga0068859_100362051
558 Ga0068864_100960957
559 Ga0068858_101573254
560 Ga0068860_100224889
561 Ga0068862_101347585
562 Ga0068862_101666537
563 Ga0081455_10000165
564 Ga0081455_10033257
565 Ga0081455_10058499
566 Ga0081540_1246509
567 Ga0081539_10084052
568 Ga0070717_10893199
569 Ga0075365_10020137
570 Ga0075365_10431562
571 Ga0075365_10848082
572 Ga0070712_101300145
573 Ga0075367_10250652
574 Ga0075366_10535482
575 Ga0097621_100294441
576 Ga0075370_10186488
577 Ga0075370_10435065
578 Ga0097620_100149350
579 Ga0097620_100362044
580 Ga0099794_10020634
581 Ga0105240_10244910
582 Ga0105240_11099761
583 Ga0111539_10739439
584 Ga0111539_12118668
585 Ga0105247_10243317
586 Ga0105241_10109113
587 Ga0105248_10208966
588 Ga0105248_10831268
589 Ga0105248_10959623
590 Ga0105237_10540997
591 Ga0105238_10102507
592 Ga0105238_10441049
593 Ga0105249_10061794
594 Ga0105249_11081298
595 Ga0105239_11015610
596 Ga0157370_10010808
597 Ga0157370_10614622
598 Ga0157369_10055172
599 Ga0157369_11104129
600 Ga0157369_11718432
601 Ga0157374_10212779
602 Ga0157374_10859675
603 Ga0163162_10605122
604 Ga0163162_10773392
605 Ga0163162_11432791
606 Ga0157372_11332824
607 Ga0157375_10705812
608 Ga0157375_12303677
609 Ga0163163_12198306
610 Ga0182008_10565434
611 Ga0157379_10172963
612 Ga0157379_10756295
613 Ga0182007_10236819
614 Ga0206353_10077123
615 Ga0213871_10005818
616 Ga0209677_101289
617 Ga0209758_1001177
618 Ga0209758_1006424
619 Ga0209758_1019339
620 Ga0207426_1002219
621 Ga0207426_1005323
622 Ga0207426_1011734
623 Ga0207426_1021850
624 Ga0207426_1055766
625 Ga0209257_1040726
626 Ga0207710_10197174
627 Ga0207647_10124872
628 Ga0207647_10398942
629 Ga0207645_10419753
630 Ga0207705_10795101
631 Ga0207684_10068738
632 Ga0207684_10494629
633 Ga0207654_10068048
634 Ga0207654_10479673
635 Ga0207707_10000100
636 Ga0207707_10013022
637 Ga0207707_10653026
638 Ga0207695_10046470
639 Ga0207660_10168390
640 Ga0207662_10557783
641 Ga0207657_10404959
642 Ga0207649_10089196
643 Ga0207649_10395392
644 Ga0207652_10093647
645 Ga0207652_11650171
646 Ga0207681_10166024
647 Ga0207694_10205995
648 Ga0207694_10574515
649 Ga0207659_10576244
650 Ga0207700_10029810
651 Ga0207644_10436196
652 Ga0207661_10006741
653 Ga0207661_10254048
654 Ga0207679_10040119
655 Ga0207667_10204442
656 Ga0207667_10981575
657 Ga0207668_10970704
658 Ga0207640_10905192
659 Ga0207703_11049553
660 Ga0207639_10075381
661 Ga0207678_10201664
662 Ga0207702_10325683
663 Ga0207702_10962770
664 Ga0207702_11238975
665 Ga0207641_12118935
666 Ga0207648_10266981
667 Ga0207674_10073705
668 Ga0207675_100872184
669 Ga0207683_10013541
670 Ga0207428_10597044
671 Ga0268266_10035191
672 Ga0268266_10214817
673 Ga0268266_10318435
674 Ga0268265_10285532
675 Ga0268264_10772897
676 Ga0268264_11350849
677 Ga0265334_10003250
678 Ga0265340_10012237
679 Ga0307513_10037882
680 Ga0373936_0015383
681 Ga0373939_0018613
682 Ga0373960_0111342
683 Ga0373943_0323985
684 Ga0373942_0112015
685 Ga0373931_0114934
686 Ga0373931_0241506
687 Ga0373931_0267543
688 Ga0373935_0950156
689 Ga0373927_0432914
690 Ga0373937_0685154
691 Ga0373925_1269582
692 Ga0395899_0009033
693 Ga0395899_0121221
694 Ga0395900_0001350
695 Ga0395900_0045645
696 Ga0395900_0405001
697 Ga0395898_0029321
698 Ga0395898_0265353
699 Ga0395905_0003532
700 Ga0395905_0161919
701 Ga0395905_0351338
702 Ga0395905_0367892
703 Ga0395905_0998986
704 Ga0395901_0006638
705 Ga0395901_0008112
706 Ga0395901_0014435
707 Ga0395901_0150459
708 Ga0395901_0572247
709 Ga0436365_0296096
710 Ga0436360_0556698
711 Ga0436361_0603476
712 Ga0436363_0759156
713 Ga0436363_1716462
714 Ga0439447_064844
715 Ga0451787_242462
716 Ga0451789_0651673
717 Ga0451793_0051564
718 Ga0451839_0317516
719 Ga0451855_1417582
720 Ga0451853_1625668
721 Ga0466967_0020928
722 Ga0495592_0195716
723 Ga0495629_0230874
724 Ga0495651_0008047
725 Ga0495651_0233100
726 Ga0495653_0638479
727 Ga0495605_0163305
728 Ga0495605_0183817
729 Ga0495664_0015315
730 Ga0495664_0086875
731 Ga0495664_0573337
732 Ga0495584_0193670
733 Ga0495584_0648246
734 Ga0495607_0222291
735 Ga0495583_0069993
736 Ga0495606_0067588
737 Ga0495606_0087674
738 Ga0495608_0536702
739 Ga0495616_0053540
740 Ga0495618_0624477
741 Ga0495628_0046301
742 Ga0495648_0007591
743 Ga0495648_0129425
744 Ga0495652_0026606
745 Ga0495652_0079832
746 Ga0495652_0572179
747 Ga0495665_0150749
748 Ga0495640_0053549
749 Ga0495640_0384373
750 Ga0495587_0020838
751 Ga0495622_0007520
752 Ga0495622_0030278
753 Ga0495667_0027440
754 Ga0495656_0160783
755 Ga0495668_0064460
756 Ga0495668_0387120
757 Ga0495668_0599198
758 Ga0495634_0022629
759 Ga0495625_0333583
760 Ga0495635_0008534
761 Ga0495635_0110288
762 Ga0495659_0313178
763 Ga0495661_0216643
764 Ga0495588_0079618
765 Ga0495599_0292091
766 Ga0495599_0722658
767 Ga0495623_0003900
768 Ga0495646_0050416
769 Ga0495646_0243834
770 Ga0495647_0130167
771 Ga0495613_0066962
772 Ga0495624_0067530
773 Ga0495671_0015307
774 Ga0495649_0109077
775 Ga0495649_0654016
776 Ga0495589_0124536
777 Ga0495600_0038537
778 Ga0495660_0208416
779 Ga0495581_0077806
780 Ga0495604_0016427
781 Ga0495604_0021055
782 Ga0495604_0240720
783 Ga0495636_0187048
784 Ga0495674_0166415
785 Ga0495674_0185262
786 Ga0495674_1448394
787 Ga0495676_0047026
788 Ga0495676_1056225
789 Ga0495675_0002868
790 Ga0495677_0201950
791 Ga0495685_072604
792 Ga0495684_0406505
793 Ga0495684_0474483
794 Ga0495686_0207557
795 Ga0495593_0077057
796 Ga0495593_0269918
797 Ga0495602_0006250
798 Ga0495602_0065373
799 Ga0496101_0533869
800 Ga0496102_0163600
801 Ga0496104_0005317
802 Ga0496104_0264481
803 Ga0496104_0718501
804 Ga0496105_0008712
805 Ga0496105_0357564
806 Ga0496105_0567770
807 Ga0496106_0122703
808 Ga0496108_0924164
809 Ga0496109_0280152
810 Ga0496110_1352616
811 Ga0496111_0081497
812 Ga0496112_0075249
813 Ga0496112_0307551
814 Ga0496113_0022521
815 Ga0496113_0058728
816 Ga0496114_0070345
817 Ga0496114_0296409
818 Ga0496115_0219527
819 Ga0496115_0451303
820 Ga0496116_0115080
821 Ga0496117_0260714
822 Ga0496118_0136851
823 Ga0496118_0312475
824 Ga0496119_0014481
825 Ga0496120_0008272
826 Ga0496121_0360062
827 Ga0496121_0396984
828 Ga0496126_0059143
829 Ga0496126_0085867
830 Ga0496126_0112120
831 Ga0496126_0297636
832 Ga0496126_0516056
833 Ga0496126_0618248
834 Ga0495682_0017444
835 Ga0501034_0000663
836 Ga0501034_0002763
837 Ga0501043_0905724
838 Ga0501047_0217546
839 Ga0501068_0402493
840 Ga0501072_0148521
841 Ga0501072_1249641
842 Ga0501074_0338734
843 nmdc:mga03683_426860_c1
844 nmdc:mga03683_566761_c1
845 nmdc:mga00v17_560377_c1
846 nmdc:mga0yw44_1147092_c1
847 nmdc:mga0yw44_36677_c1
848 nmdc:mga0k408_182657_c1
849 nmdc:mga06z11_124099_c1
850 nmdc:mga06z11_433666_c1
851 nmdc:mga07m45_360689_c1
852 nmdc:mga07m45_375105_c1
853 nmdc:mga0qj67_1272946_c1
854 nmdc:mga08x19_1323_c1
855 nmdc:mga0sz30_30277_c1
856 Ga0500635_0189461
857 Ga0495619_0053857
858 Ga0495619_0489933
859 Ga0500578_0038187
860 Ga0500578_0060200
861 Ga0500644_0099855
862 Ga0500647_0031022
863 Ga0500566_0001036
864 Ga0500566_0058910
865 Ga0500566_0266563
866 Ga0500557_000113
867 Ga0500572_015020
868 Ga0500595_030924
869 Ga0500595_125441
870 Ga0500607_128499
871 Ga0500608_228945
872 Ga0500614_019819
873 Ga0500642_0000056
874 Ga0500652_119262
875 Ga0500559_0127453
876 Ga0500559_0381043
877 Ga0500585_270576
878 Ga0500590_130673
879 Ga0500590_161864
880 Ga0500619_247555
881 Ga0500620_172761
882 Ga0500638_206402
883 Ga0500636_0002161
884 Ga0500636_0374347
885 Ga0500625_000216
886 2508539085
887 2508695446
888 2511400862
889 2513674658
890 2513860495
891 2515625582
892 2517107102
893 2524436005
894 2524467775
895 2528851276
896 2745081602
897 2793064869
898 2824663830
899 2824682681
900 2824709954
901 2824757706
902 2824768782
903 2874597151
904 2874628889
905 2874646957
906 2876777615
907 2876825697
908 2879076176
909 2879108636
910 2879130983
911 2879148782
912 2885413947
913 2888390757
914 2903775693
915 2904713092
916 2922378704
917 2922398927
918 2929618515
919 2929628800
920 2932786703
921 2932794399
922 2932806683
923 2932812253
924 2932823244
925 2932829916
926 2933580773
927 2935618434
928 2935641168
929 2935653685
930 2935662434
931 2935670084
932 2935679063
933 2935689937
934 2935698458
935 2935707600
936 2935717456
937 2935723874
938 2935740083
939 2935749346
940 2935757291
941 2935763623
942 2935773338
943 2935782203
944 2935789164
945 2935797101
946 2935804012
947 2935815106
948 2935830899
949 2935841509
950 2935862471
951 2935866601
952 2935874908
953 2935888454
954 2935977621
955 2935985104
956 2935994414
957 2936004608
958 2936016736
959 2936025369
960 2936034211
961 2936043173
962 2936052268
963 2936056273
964 2940563204
965 2941535592
966 2941543121
967 3005593153
968 3005594941
969 3005710918
970 8016518276
971 8016526052
972 8016539660
973 8016543961
974 8016549343
975 8016557770
976 8016569362
977 8016581984
978 8016595795
979 8016606658
980 8016618554
981 8016623287
982 8016635716
983 8017058377
984 8019530938
985 8019540642
986 8019550306
987 8019622884
988 8019630226
989 8019652567
990 8019667058
991 8019676847
992 8055742365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

10

116

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dre-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38gp39gd99n mutant from pseudomonas testosteroni (tksi) 0.8788 2 122
3ov4-assembly2.cif.gz_D crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8729 2 122
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8694 2 122
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.8669 13 119
3ov4-assembly2.cif.gz_C crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8667 2 122
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8874 13 119 3.10.450.50
4hvnB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8733 7 130 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8729 2 122 3.10.450.50
af_Q10083_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.85 2 119 3.10.450.50
af_A0A1D8PLG7_12_136_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8436 3 119 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2H9V4T9-F1-model_v4 deleted 0.9974 5 139
AF-A0A562S659-F1-model_v4 Ketosteroid isomerase-like protein 0.9937 4 156 GO:0016853
AF-A0A0D7PAZ9-F1-model_v4 Polyketide cyclase 0.9935 4 156
AF-A0A0R3BI51-F1-model_v4 Polyketide cyclase 0.9927 4 156
AF-A0A0R3BN22-F1-model_v4 deleted 0.9915 4 156

Map