F454858

General Info

Members Datasets Scaffolds Average Seq Length
496 208 992 114

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_101350980|Ga0068859_1013509802
Length 124
Sequence MELVRDCLDKQVDDRSQRRMGRVDGIILVLEPDRAPRVAYVELGVTTLMNRLSRRLGRIVTRWFGRWGISPEPYRIPWGKLKIGLNTVIADVEAEKTPALEWELWLRKKVIGRIPGAKSQIVKQ

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
145 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
162 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
163 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
164 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
165 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
166 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
167 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
168 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
169 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
170 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
171 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
172 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
173 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
174 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
175 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
176 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
177 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
178 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
179 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
180 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
181 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
182 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
183 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
186 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
187 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
188 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
189 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
190 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
191 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
192 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
193 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
194 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
197 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
198 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
199 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
200 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
201 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
202 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
203 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
204 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
205 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.22
Rhizosphere 97.38
Stem 0
Stem Tuber 0
Unclassified 49.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_101350980 3300005617 Unclassified 786
2 JGI24751J29686_10000136 3300002459 Bacteria 36776
3 JGI25406J46586_10007942 3300003203 Unclassified 4827
4 JGI25406J46586_10064651 3300003203 Bacteria 1168
5 rootL2_10090456 3300003322 Bacteria 1967
6 Ga0065714_10064474 3300005288 Bacteria 60308
7 Ga0065712_10067750 3300005290 Bacteria 60312
8 Ga0065712_10070116 3300005290 Bacteria 6314
9 Ga0065712_10083028 3300005290 Bacteria 2849
10 Ga0065712_10130042 3300005290 Bacteria 1558
11 Ga0065712_10304015 3300005290 Unclassified 855
12 Ga0065715_10007567 3300005293 Unclassified 3686
13 Ga0065715_10090953 3300005293 Bacteria 6280
14 Ga0065715_10109531 3300005293 Bacteria 2664
15 Ga0065715_10155316 3300005293 Unclassified 1683
16 Ga0065715_10441261 3300005293 Unclassified 836
17 Ga0065715_10500248 3300005293 Unclassified 780
18 Ga0065707_10026315 3300005295 Bacteria 1217
19 Ga0065707_10104055 3300005295 Unclassified 2690
20 Ga0070676_11002444 3300005328 Unclassified 627
21 Ga0070670_100000098 3300005331 Bacteria 80608
22 Ga0068869_100020141 3300005334 Bacteria 4569
23 Ga0068869_100641402 3300005334 Unclassified 901
24 Ga0068869_100688448 3300005334 Unclassified 871
25 Ga0068869_100917546 3300005334 Unclassified 759
26 Ga0070682_100000145 3300005337 Bacteria 56593
27 Ga0070682_101124179 3300005337 Unclassified 659
28 Ga0068868_101399719 3300005338 Unclassified 652
29 Ga0068868_102065076 3300005338 Unclassified 542
30 Ga0070660_100704222 3300005339 Bacteria 847
31 Ga0070660_101261742 3300005339 Bacteria 627
32 Ga0070689_100445593 3300005340 Unclassified 1101
33 Ga0070689_100474250 3300005340 Bacteria 1068
34 Ga0070689_100634319 3300005340 Unclassified 928
35 Ga0070689_100991708 3300005340 Unclassified 747
36 Ga0070691_10468192 3300005341 Bacteria 723
37 Ga0070661_101312042 3300005344 Unclassified 607
38 Ga0070692_10034239 3300005345 Bacteria 2564
39 Ga0070692_10213360 3300005345 Unclassified 1137
40 Ga0070692_10269295 3300005345 Bacteria 1028
41 Ga0070692_10665375 3300005345 Unclassified 697
42 Ga0070669_100052385 3300005353 Bacteria 2986
43 Ga0070675_100562754 3300005354 Bacteria 1032
44 Ga0070675_100921677 3300005354 Unclassified 801
45 Ga0070673_101116346 3300005364 Bacteria 737
46 Ga0070673_101843524 3300005364 Unclassified 573
47 Ga0070688_100760681 3300005365 Unclassified 755
48 Ga0070659_100305649 3300005366 Unclassified 1327
49 Ga0070659_100972600 3300005366 Unclassified 744
50 Ga0070659_101251140 3300005366 Bacteria 657
51 Ga0070659_101906268 3300005366 Unclassified 533
52 Ga0070703_10002822 3300005406 Bacteria 4977
53 Ga0070701_10131893 3300005438 Bacteria 1420
54 Ga0070705_100003263 3300005440 Bacteria 7977
55 Ga0070705_100026739 3300005440 Unclassified 3144
56 Ga0070705_100077243 3300005440 Bacteria 2033
57 Ga0070705_100230104 3300005440 Bacteria 1289
58 Ga0070705_100422623 3300005440 Unclassified 993
59 Ga0070705_100952776 3300005440 Unclassified 694
60 Ga0070700_100159601 3300005441 Unclassified 1551
61 Ga0070700_101006440 3300005441 Unclassified 685
62 Ga0070694_100135593 3300005444 Bacteria 1783
63 Ga0070694_101582961 3300005444 Unclassified 556
64 Ga0070662_100662062 3300005457 Unclassified 881
65 Ga0070662_101458273 3300005457 Unclassified 590
66 Ga0070681_10006697 3300005458 Bacteria 11209
67 Ga0070681_10019243 3300005458 Bacteria 6831
68 Ga0070681_10643152 3300005458 Bacteria 975
69 Ga0068867_100469200 3300005459 Bacteria 1076
70 Ga0068867_101753165 3300005459 Unclassified 583
71 Ga0070699_100654334 3300005518 Bacteria 959
72 Ga0070679_100514372 3300005530 Bacteria 1141
73 Ga0068853_100018847 3300005539 Bacteria 5715
74 Ga0068853_101279343 3300005539 Bacteria 709
75 Ga0068853_101339538 3300005539 Unclassified 692
76 Ga0068853_102278032 3300005539 Unclassified 525
77 Ga0070695_100060001 3300005545 Unclassified 2465
78 Ga0070695_100108400 3300005545 Bacteria 1881
79 Ga0070695_100157074 3300005545 Bacteria 1593
80 Ga0070695_100197651 3300005545 Bacteria 1435
81 Ga0070695_100408865 3300005545 Bacteria 1031
82 Ga0070695_100717901 3300005545 Bacteria 795
83 Ga0070695_100797335 3300005545 Unclassified 756
84 Ga0070696_100007127 3300005546 Bacteria 7467
85 Ga0070696_100138602 3300005546 Bacteria 1775
86 Ga0070696_100151547 3300005546 Bacteria 1702
87 Ga0070696_100828905 3300005546 Unclassified 763
88 Ga0070696_101344488 3300005546 Unclassified 608
89 Ga0070693_100002445 3300005547 Bacteria 8557
90 Ga0070693_100118612 3300005547 Bacteria 1638
91 Ga0070693_100128398 3300005547 Bacteria 1581
92 Ga0070693_100142360 3300005547 Bacteria 1511
93 Ga0070693_100179417 3300005547 Bacteria 1362
94 Ga0070693_100527771 3300005547 Unclassified 841
95 Ga0070693_100824114 3300005547 Unclassified 689
96 Ga0070704_100303402 3300005549 Bacteria 1331
97 Ga0070704_100451596 3300005549 Bacteria 1107
98 Ga0070704_100631123 3300005549 Bacteria 944
99 Ga0070704_100838124 3300005549 Bacteria 824
100 Ga0068855_100475447 3300005563 Bacteria 1361
101 Ga0070664_100223967 3300005564 Unclassified 1683
102 Ga0068857_100183977 3300005577 Unclassified 1902
103 Ga0068857_100235948 3300005577 Unclassified 1673
104 Ga0068857_100391819 3300005577 Bacteria 1291
105 Ga0068857_100449220 3300005577 Unclassified 1205
106 Ga0068857_101643157 3300005577 Unclassified 627
107 Ga0068854_100243828 3300005578 Bacteria 1432
108 Ga0068854_101107275 3300005578 Bacteria 706
109 Ga0068856_100154313 3300005614 Unclassified 2306
110 Ga0070702_100010707 3300005615 Bacteria 4531
111 Ga0070702_101484173 3300005615 Unclassified 557
112 Ga0068852_100359390 3300005616 Unclassified 1424
113 Ga0068852_101103721 3300005616 Bacteria 813
114 Ga0068852_101314532 3300005616 Bacteria 745
115 Ga0068859_100010723 3300005617 Bacteria 9223
116 Ga0068859_100015823 3300005617 Bacteria 7579
117 Ga0068859_100044701 3300005617 Bacteria 4450
118 Ga0068859_100081829 3300005617 Plasmid 3271
119 Ga0068859_100291581 3300005617 Unclassified 1725
120 Ga0068859_100299364 3300005617 Bacteria 1702
121 Ga0068859_100301145 3300005617 Bacteria 1696
122 Ga0068859_100541512 3300005617 Unclassified 1259
123 Ga0068859_100585105 3300005617 Unclassified 1210
124 Ga0068859_100955491 3300005617 Unclassified 940
125 Ga0068864_100135269 3300005618 Bacteria 2219
126 Ga0068864_100165854 3300005618 Bacteria 2011
127 Ga0068864_100333577 3300005618 Bacteria 1427
128 Ga0068864_100492091 3300005618 Bacteria 1179
129 Ga0068864_101610179 3300005618 Unclassified 653
130 Ga0068861_100084544 3300005719 Bacteria 2491
131 Ga0068861_101175833 3300005719 Bacteria 740
132 Ga0068851_10001358 3300005834 Bacteria 10679
133 Ga0068870_10288741 3300005840 Bacteria 1031
134 Ga0068863_100368448 3300005841 Unclassified 1401
135 Ga0068863_100582130 3300005841 Bacteria 1107
136 Ga0068863_101039764 3300005841 Unclassified 822
137 Ga0068863_101233955 3300005841 Bacteria 754
138 Ga0068858_100135914 3300005842 Bacteria 2307
139 Ga0068858_100203992 3300005842 Unclassified 1870
140 Ga0068858_100270287 3300005842 Bacteria 1618
141 Ga0068858_100330255 3300005842 Unclassified 1458
142 Ga0068858_100411914 3300005842 Unclassified 1299
143 Ga0068858_100466454 3300005842 Bacteria 1218
144 Ga0068858_100925560 3300005842 Unclassified 853
145 Ga0068860_100056619 3300005843 Unclassified 3726
146 Ga0068860_100106064 3300005843 Unclassified 2683
147 Ga0068860_100184826 3300005843 Unclassified 2015
148 Ga0068860_100894658 3300005843 Unclassified 904
149 Ga0068860_101306815 3300005843 Unclassified 746
150 Ga0068862_100176227 3300005844 Bacteria 1917
151 Ga0068862_100220193 3300005844 Bacteria 1718
152 Ga0068862_100859407 3300005844 Bacteria 889
153 Ga0068862_101099698 3300005844 Unclassified 790
154 Ga0068862_101566797 3300005844 Unclassified 665
155 Ga0068862_101638513 3300005844 Unclassified 651
156 Ga0081539_10000119 3300005985 Bacteria 184136
157 Ga0081539_10000884 3300005985 Bacteria 57334
158 Ga0075432_10050526 3300006058 Bacteria 1467
159 Ga0070716_100006865 3300006173 Bacteria 5582
160 Ga0070716_100331437 3300006173 Bacteria 1070
161 Ga0070716_101264125 3300006173 Bacteria 595
162 Ga0097621_100050706 3300006237 Unclassified 3376
163 Ga0097621_102185379 3300006237 Unclassified 529
164 Ga0068871_100010219 3300006358 Bacteria 6837
165 Ga0075428_100497063 3300006844 Unclassified 1305
166 Ga0075428_101470077 3300006844 Unclassified 714
167 Ga0075433_10025329 3300006852 Bacteria 5013
168 Ga0075433_10048328 3300006852 Bacteria 3699
169 Ga0075433_10114939 3300006852 Unclassified 2388
170 Ga0075433_10405580 3300006852 Bacteria 1202
171 Ga0075434_100123651 3300006871 Bacteria 2604
172 Ga0075434_100215127 3300006871 Bacteria 1942
173 Ga0075434_100428591 3300006871 Unclassified 1344
174 Ga0075434_100782457 3300006871 Unclassified 971
175 Ga0075434_100856754 3300006871 Unclassified 924
176 Ga0097620_100010723 3300006931 Bacteria 9223
177 Ga0097620_100015824 3300006931 Bacteria 7579
178 Ga0097620_100044703 3300006931 Bacteria 4450
179 Ga0097620_100081830 3300006931 Plasmid 3271
180 Ga0097620_100232201 3300006931 Bacteria 1933
181 Ga0097620_100291580 3300006931 Unclassified 1725
182 Ga0097620_100299340 3300006931 Bacteria 1702
183 Ga0097620_100301162 3300006931 Bacteria 1696
184 Ga0097620_100381291 3300006931 Bacteria 1505
185 Ga0097620_100541597 3300006931 Unclassified 1259
186 Ga0097620_100585121 3300006931 Unclassified 1210
187 Ga0097620_100955527 3300006931 Unclassified 940
188 Ga0097620_101350798 3300006931 Unclassified 786
189 Ga0105240_10096752 3300009093 Unclassified 3597
190 Ga0105240_10229373 3300009093 Bacteria 2159
191 Ga0105240_11465361 3300009093 Unclassified 716
192 Ga0111539_10043211 3300009094 Bacteria 5404
193 Ga0111539_10049890 3300009094 Bacteria 4988
194 Ga0111539_12097774 3300009094 Bacteria 656
195 Ga0105245_11127262 3300009098 Unclassified 831
196 Ga0105245_12171887 3300009098 Unclassified 609
197 Ga0105247_10000841 3300009101 Bacteria 23337
198 Ga0105247_10104879 3300009101 Bacteria 1812
199 Ga0105247_10483938 3300009101 Bacteria 899
200 Ga0105247_10590384 3300009101 Unclassified 822
201 Ga0114129_10028076 3300009147 Bacteria 7972
202 Ga0114129_11359976 3300009147 Unclassified 878
203 Ga0105243_10014264 3300009148 Bacteria 6013
204 Ga0105243_11126179 3300009148 Bacteria 794
205 Ga0105243_11475058 3300009148 Unclassified 703
206 Ga0105243_12196518 3300009148 Unclassified 588
207 Ga0105241_10003816 3300009174 Bacteria 11170
208 Ga0105241_10076223 3300009174 Bacteria 2614
209 Ga0105241_10154306 3300009174 Bacteria 1881
210 Ga0105241_10294659 3300009174 Unclassified 1390
211 Ga0105241_10489133 3300009174 Bacteria 1095
212 Ga0105241_10904412 3300009174 Unclassified 820
213 Ga0105241_11394293 3300009174 Unclassified 671
214 Ga0105241_11555502 3300009174 Unclassified 638
215 Ga0105242_10023657 3300009176 Unclassified 4843
216 Ga0105242_10624354 3300009176 Bacteria 1044
217 Ga0105242_10693064 3300009176 Bacteria 996
218 Ga0105248_10001687 3300009177 Bacteria 24588
219 Ga0105248_10031596 3300009177 Bacteria 5916
220 Ga0105248_10378138 3300009177 Bacteria 1594
221 Ga0105248_10633369 3300009177 Bacteria 1206
222 Ga0105248_10981402 3300009177 Unclassified 954
223 Ga0105248_11427152 3300009177 Unclassified 783
224 Ga0105248_13264639 3300009177 Unclassified 516
225 Ga0105237_10000199 3300009545 Bacteria 85277
226 Ga0105237_10277922 3300009545 Bacteria 1677
227 Ga0105237_10715059 3300009545 Unclassified 1008
228 Ga0105237_10719851 3300009545 Bacteria 1005
229 Ga0105238_10182322 3300009551 Bacteria 2076
230 Ga0105238_10302082 3300009551 Unclassified 1584
231 Ga0105249_10132025 3300009553 Bacteria 2385
232 Ga0105249_11775970 3300009553 Bacteria 689
233 Ga0105239_10414482 3300010375 Unclassified 1525
234 Ga0105239_10736067 3300010375 Bacteria 1128
235 Ga0105239_10736392 3300010375 Unclassified 1128
236 Ga0105239_12034248 3300010375 Bacteria 667
237 Ga0105239_12536223 3300010375 Unclassified 598
238 Ga0105239_12865004 3300010375 Unclassified 563
239 Ga0105246_11047063 3300011119 Bacteria 742
240 Ga0105246_11197564 3300011119 Bacteria 699
241 Ga0105246_11385310 3300011119 Unclassified 655
242 Ga0157373_10005740 3300013100 Bacteria 9295
243 Ga0157373_10109165 3300013100 Bacteria 1945
244 Ga0157378_10850368 3300013297 Bacteria 941
245 Ga0157378_10965019 3300013297 Bacteria 885
246 Ga0157378_12198226 3300013297 Unclassified 603
247 Ga0163162_10225139 3300013306 Bacteria 2005
248 Ga0163162_11065555 3300013306 Unclassified 915
249 Ga0163162_11161280 3300013306 Unclassified 876
250 Ga0157372_10390310 3300013307 Bacteria 1622
251 Ga0157372_10879732 3300013307 Unclassified 1040
252 Ga0157372_12371613 3300013307 Unclassified 609
253 Ga0157372_12542915 3300013307 Unclassified 588
254 Ga0157375_10038676 3300013308 Unclassified 4582
255 Ga0157375_10472306 3300013308 Bacteria 1419
256 Ga0157375_11199587 3300013308 Unclassified 890
257 Ga0163163_10000465 3300014325 Bacteria 36944
258 Ga0163163_10071683 3300014325 Bacteria 3453
259 Ga0163163_10382087 3300014325 Bacteria 1466
260 Ga0163163_11141114 3300014325 Bacteria 842
261 Ga0163163_12356579 3300014325 Unclassified 591
262 Ga0163163_12394173 3300014325 Bacteria 586
263 Ga0157380_10280953 3300014326 Bacteria 1523
264 Ga0157380_12191032 3300014326 Unclassified 616
265 Ga0157380_12960713 3300014326 Unclassified 541
266 Ga0157377_10184206 3300014745 Unclassified 1315
267 Ga0157379_10167793 3300014968 Bacteria 1982
268 Ga0182007_10259229 3300015262 Unclassified 626
269 Ga0207653_10005858 3300025885 Bacteria 3834
270 Ga0207710_10000563 3300025900 Bacteria 22203
271 Ga0207710_10193574 3300025900 Unclassified 1002
272 Ga0207710_10460376 3300025900 Bacteria 657
273 Ga0207680_10599401 3300025903 Unclassified 788
274 Ga0207647_10054933 3300025904 Bacteria 2448
275 Ga0207647_10372031 3300025904 Unclassified 807
276 Ga0207645_10549295 3300025907 Unclassified 783
277 Ga0207643_10054064 3300025908 Unclassified 2282
278 Ga0207643_10792205 3300025908 Unclassified 614
279 Ga0207654_10053903 3300025911 Bacteria 2323
280 Ga0207654_10434622 3300025911 Bacteria 918
281 Ga0207654_10930853 3300025911 Bacteria 631
282 Ga0207654_11045979 3300025911 Unclassified 594
283 Ga0207707_10005841 3300025912 Bacteria 10754
284 Ga0207695_10100888 3300025913 Bacteria 2881
285 Ga0207671_10001814 3300025914 Bacteria 23845
286 Ga0207671_10339362 3300025914 Unclassified 1190
287 Ga0207662_10088599 3300025918 Bacteria 1900
288 Ga0207662_10652606 3300025918 Bacteria 735
289 Ga0207657_10606248 3300025919 Bacteria 854
290 Ga0207652_10838869 3300025921 Unclassified 814
291 Ga0207681_10047753 3300025923 Bacteria 2886
292 Ga0207694_10189806 3300025924 Bacteria 1669
293 Ga0207694_10339942 3300025924 Unclassified 1241
294 Ga0207650_10000156 3300025925 Bacteria 81983
295 Ga0207650_10120347 3300025925 Bacteria 2043
296 Ga0207650_10998666 3300025925 Unclassified 712
297 Ga0207659_10105581 3300025926 Bacteria 2132
298 Ga0207659_10481609 3300025926 Unclassified 1048
299 Ga0207659_11210693 3300025926 Unclassified 649
300 Ga0207687_10868040 3300025927 Bacteria 771
301 Ga0207644_10475113 3300025931 Bacteria 1029
302 Ga0207690_10073952 3300025932 Unclassified 2359
303 Ga0207690_10823190 3300025932 Unclassified 768
304 Ga0207706_10486741 3300025933 Unclassified 1066
305 Ga0207706_11155997 3300025933 Viruses 645
306 Ga0207686_10235241 3300025934 Unclassified 1330
307 Ga0207709_10115956 3300025935 Bacteria 1800
308 Ga0207709_11192450 3300025935 Unclassified 627
309 Ga0207709_11535339 3300025935 Unclassified 553
310 Ga0207665_10039103 3300025939 Unclassified 3161
311 Ga0207665_10207150 3300025939 Bacteria 1431
312 Ga0207665_11166869 3300025939 Unclassified 614
313 Ga0207711_10033707 3300025941 Bacteria 4335
314 Ga0207711_10081776 3300025941 Bacteria 2823
315 Ga0207711_10371092 3300025941 Bacteria 1327
316 Ga0207689_10210294 3300025942 Bacteria 1607
317 Ga0207689_10574568 3300025942 Bacteria 947
318 Ga0207689_10835008 3300025942 Unclassified 778
319 Ga0207679_10438822 3300025945 Bacteria 1156
320 Ga0207679_11879460 3300025945 Unclassified 546
321 Ga0207667_10700149 3300025949 Unclassified 1015
322 Ga0207667_10896971 3300025949 Unclassified 878
323 Ga0207651_10486227 3300025960 Bacteria 1065
324 Ga0207651_10742707 3300025960 Bacteria 867
325 Ga0207712_10734245 3300025961 Unclassified 864
326 Ga0207640_10083948 3300025981 Bacteria 2185
327 Ga0207640_11052609 3300025981 Bacteria 718
328 Ga0207677_10585292 3300026023 Unclassified 977
329 Ga0207703_10040173 3300026035 Bacteria 3743
330 Ga0207703_10045389 3300026035 Bacteria 3535
331 Ga0207703_10134753 3300026035 Bacteria 2137
332 Ga0207703_10847299 3300026035 Bacteria 874
333 Ga0207703_10850369 3300026035 Unclassified 872
334 Ga0207703_11032028 3300026035 Bacteria 789
335 Ga0207703_12109853 3300026035 Unclassified 540
336 Ga0207639_10713723 3300026041 Bacteria 931
337 Ga0207639_10820084 3300026041 Unclassified 867
338 Ga0207639_10989067 3300026041 Bacteria 788
339 Ga0207708_10024121 3300026075 Unclassified 4600
340 Ga0207708_10345716 3300026075 Bacteria 1219
341 Ga0207708_10979208 3300026075 Unclassified 734
342 Ga0207702_10449150 3300026078 Unclassified 1250
343 Ga0207641_10984422 3300026088 Bacteria 840
344 Ga0207641_11138441 3300026088 Bacteria 779
345 Ga0207641_12275953 3300026088 Bacteria 542
346 Ga0207648_10119700 3300026089 Bacteria 2314
347 Ga0207648_10213492 3300026089 Unclassified 1713
348 Ga0207648_11072757 3300026089 Unclassified 755
349 Ga0207648_11860998 3300026089 Unclassified 563
350 Ga0207676_10172126 3300026095 Bacteria 1888
351 Ga0207676_10247509 3300026095 Bacteria 1603
352 Ga0207676_10597247 3300026095 Bacteria 1060
353 Ga0207676_10607948 3300026095 Bacteria 1051
354 Ga0207676_11312475 3300026095 Unclassified 719
355 Ga0207674_10024472 3300026116 Bacteria 6453
356 Ga0207674_10117920 3300026116 Bacteria 2625
357 Ga0207674_10263505 3300026116 Bacteria 1671
358 Ga0207674_10586509 3300026116 Bacteria 1077
359 Ga0207674_10680223 3300026116 Bacteria 993
360 Ga0207675_100147504 3300026118 Bacteria 2238
361 Ga0207675_100787576 3300026118 Unclassified 963
362 Ga0207675_101144497 3300026118 Unclassified 798
363 Ga0207675_101264908 3300026118 Unclassified 758
364 Ga0207698_10330778 3300026142 Bacteria 1431
365 Ga0207698_10352952 3300026142 Unclassified 1390
366 Ga0207698_11211099 3300026142 Bacteria 769
367 Ga0207698_11370221 3300026142 Bacteria 722
368 Ga0207428_10003819 3300027907 Bacteria 14446
369 Ga0268265_10156790 3300028380 Bacteria 1928
370 Ga0268265_11340140 3300028380 Unclassified 717
371 Ga0268265_11850475 3300028380 Unclassified 610
372 Ga0268265_11932709 3300028380 Unclassified 597
373 Ga0268264_10075759 3300028381 Unclassified 2861
374 Ga0268264_10222229 3300028381 Bacteria 1739
375 Ga0268264_10669912 3300028381 Unclassified 1028
376 Ga0307408_100003938 3300031548 Bacteria 10115
377 Ga0307408_100275501 3300031548 Unclassified 1399
378 Ga0307405_10004763 3300031731 Bacteria 6465
379 Ga0307413_10112242 3300031824 Bacteria 1827
380 Ga0307406_10056123 3300031901 Bacteria 2520
381 Ga0307407_11017081 3300031903 Unclassified 641
382 Ga0307412_10077745 3300031911 Bacteria 2283
383 Ga0307414_10001159 3300032004 Bacteria 13522
384 Ga0307411_10029299 3300032005 Unclassified 3359
385 Ga0307415_100040643 3300032126 Bacteria 3082
386 Ga0307415_101081591 3300032126 Unclassified 750
387 Ga0307507_10391525 3300033179 Unclassified 795
388 Ga0395898_0430274 3300037466 Bacteria 1258
389 Ga0395898_0972496 3300037466 Unclassified 785
390 Ga0395898_1543574 3300037466 Unclassified 589
391 Ga0395901_0471784 3300038443 Bacteria 1281
392 Ga0395901_0732701 3300038443 Unclassified 983
393 Ga0242422_00500 3300038699 Bacteria 2501
394 Ga0242420_004461 3300038996 Bacteria 2117
395 Ga0439448_0046530 3300042005 Bacteria 1414
396 Ga0439455_0113749 3300042012 Bacteria 754
397 Ga0439458_0007486 3300042157 Bacteria 2432
398 Ga0439459_0209707 3300042438 Unclassified 535
399 Ga0495643_0245997 3300046522 Unclassified 837
400 Ga0496102_0651816 3300048905 Unclassified 976
401 Ga0496106_0116524 3300048909 Unclassified 2084
402 Ga0496106_0117794 3300048909 Unclassified 2073
403 Ga0496108_0234264 3300048911 Unclassified 1597
404 Ga0496109_0860223 3300048912 Bacteria 845
405 Ga0496109_1313569 3300048912 Unclassified 659
406 Ga0496110_0919916 3300048913 Unclassified 781
407 Ga0496112_0279771 3300048915 Unclassified 1616
408 Ga0496112_1814533 3300048915 Unclassified 522
409 Ga0496113_0523767 3300048916 Unclassified 951
410 Ga0496113_1123042 3300048916 Unclassified 616
411 Ga0501292_010425 3300049515 Unclassified 1391
412 Ga0501292_028397 3300049515 Unclassified 931
413 Ga0501298_026459 3300049521 Unclassified 1116
414 Ga0501298_040557 3300049521 Unclassified 943
415 Ga0501299_025442 3300049522 Unclassified 1111
416 Ga0501303_012581 3300049526 Unclassified 817
417 Ga0501303_020259 3300049526 Unclassified 703
418 Ga0501198_007272 3300049649 Bacteria 1590
419 Ga0501199_004548 3300049650 Bacteria 1368
420 Ga0501202_012489 3300049652 Bacteria 1603
421 Ga0501202_032584 3300049652 Unclassified 1094
422 Ga0501206_006374 3300049653 Bacteria 1533
423 Ga0501207_065958 3300049654 Unclassified 671
424 Ga0501208_101507 3300049655 Unclassified 617
425 Ga0501209_014087 3300049656 Bacteria 1748
426 Ga0501209_033210 3300049656 Bacteria 1323
427 Ga0501210_012230 3300049657 Unclassified 714
428 Ga0501216_016729 3300049660 Unclassified 1247
429 Ga0501217_003896 3300049661 Unclassified 3039
430 Ga0501217_005830 3300049661 Unclassified 2590
431 Ga0501217_052777 3300049661 Unclassified 1067
432 Ga0501223_004286 3300049663 Unclassified 3064
433 Ga0501224_009159 3300049664 Unclassified 1447
434 Ga0501224_018642 3300049664 Unclassified 1034
435 Ga0501227_001899 3300049665 Bacteria 4631
436 Ga0501227_003302 3300049665 Bacteria 3502
437 Ga0501227_013756 3300049665 Unclassified 1787
438 Ga0501228_073404 3300049666 Unclassified 504
439 Ga0501230_059733 3300049667 Unclassified 770
440 Ga0501233_000236 3300049668 Bacteria 8343
441 Ga0501233_033931 3300049668 Unclassified 1168
442 Ga0501235_014434 3300049669 Unclassified 1741
443 Ga0501235_084454 3300049669 Unclassified 761
444 Ga0501238_030521 3300049671 Unclassified 779
445 Ga0501238_050717 3300049671 Unclassified 622
446 Ga0501239_016906 3300049672 Unclassified 865
447 Ga0501240_000903 3300049673 Bacteria 2693
448 Ga0501243_003158 3300049675 Unclassified 2435
449 Ga0501243_009757 3300049675 Unclassified 1493
450 Ga0501247_012454 3300049677 Unclassified 1035
451 Ga0501249_019256 3300049679 Unclassified 1481
452 Ga0501250_029687 3300049680 Unclassified 753
453 Ga0501253_059977 3300049683 Unclassified 817
454 Ga0501255_022807 3300049684 Unclassified 823
455 Ga0501256_006291 3300049685 Unclassified 1068
456 Ga0501256_015877 3300049685 Unclassified 758
457 Ga0501257_013742 3300049686 Bacteria 1858
458 Ga0501257_038580 3300049686 Unclassified 1168
459 Ga0501259_050424 3300049688 Unclassified 843
460 Ga0501260_010467 3300049689 Unclassified 931
461 Ga0501260_017702 3300049689 Unclassified 756
462 Ga0501261_076849 3300049690 Unclassified 596
463 Ga0501219_021433 3300049703 Unclassified 563
464 Ga0501221_005872 3300049704 Unclassified 2063
465 Ga0501221_071833 3300049704 Unclassified 818
466 Ga0501225_0000779 3300049705 Bacteria 9947
467 Ga0501225_0018107 3300049705 Unclassified 1954
468 Ga0501229_008722 3300049706 Bacteria 1270
469 Ga0501234_001206 3300049707 Bacteria 4076
470 Ga0501234_014669 3300049707 Bacteria 1231
471 Ga0501245_007413 3300049708 Unclassified 1550
472 Ga0501245_015546 3300049708 Bacteria 1146
473 Ga0501245_033410 3300049708 Unclassified 859
474 Ga0501263_012125 3300049760 Unclassified 1078
475 Ga0501271_060789 3300049768 Unclassified 530
476 Ga0501273_006788 3300049770 Bacteria 1334
477 Ga0501273_047716 3300049770 Unclassified 648
478 Ga0501273_077098 3300049770 Unclassified 549
479 Ga0501283_063327 3300049779 Unclassified 671
480 Ga0501283_068656 3300049779 Unclassified 650
481 Ga0501204_017849 3300049850 Unclassified 902
482 Ga0501212_086395 3300049851 Unclassified 574
483 Ga0501226_000853 3300049853 Bacteria 4084
484 nmdc:mga08y16_132893_c1 3300050511 Unclassified 2587
485 nmdc:mga08y16_4844_c1 3300050511 Bacteria 14046
486 nmdc:mga0n895_410903_c1 3300050512 Unclassified 1368
487 nmdc:mga0n895_451241_c1 3300050512 Bacteria 1298
488 nmdc:mga0n895_509488_c1 3300050512 Unclassified 1212
489 nmdc:mga0a205_103815_c2 3300050515 Unclassified 1281
490 nmdc:mga0a205_152470_c1 3300050515 Unclassified 2210
491 nmdc:mga0a205_23201_c1 3300050515 Bacteria 5885
492 nmdc:mga0a205_377320_c1 3300050515 Bacteria 1283
493 nmdc:mga0a205_390344_c1 3300050515 Bacteria 1256
494 nmdc:mga0a205_42796_c1 3300050515 Bacteria 4365
495 nmdc:mga0a205_830736_c1 3300050515 Bacteria 771
496 nmdc:mga0a205_84368_c1 3300050515 Bacteria 3068
497 Ga0068859_101350980
498 JGI24751J29686_10000136
499 JGI25406J46586_10007942
500 JGI25406J46586_10064651
501 rootL2_10090456
502 Ga0065714_10064474
503 Ga0065712_10067750
504 Ga0065712_10070116
505 Ga0065712_10083028
506 Ga0065712_10130042
507 Ga0065712_10304015
508 Ga0065715_10007567
509 Ga0065715_10090953
510 Ga0065715_10109531
511 Ga0065715_10155316
512 Ga0065715_10441261
513 Ga0065715_10500248
514 Ga0065707_10026315
515 Ga0065707_10104055
516 Ga0070676_11002444
517 Ga0070670_100000098
518 Ga0068869_100020141
519 Ga0068869_100641402
520 Ga0068869_100688448
521 Ga0068869_100917546
522 Ga0070682_100000145
523 Ga0070682_101124179
524 Ga0068868_101399719
525 Ga0068868_102065076
526 Ga0070660_100704222
527 Ga0070660_101261742
528 Ga0070689_100445593
529 Ga0070689_100474250
530 Ga0070689_100634319
531 Ga0070689_100991708
532 Ga0070691_10468192
533 Ga0070661_101312042
534 Ga0070692_10034239
535 Ga0070692_10213360
536 Ga0070692_10269295
537 Ga0070692_10665375
538 Ga0070669_100052385
539 Ga0070675_100562754
540 Ga0070675_100921677
541 Ga0070673_101116346
542 Ga0070673_101843524
543 Ga0070688_100760681
544 Ga0070659_100305649
545 Ga0070659_100972600
546 Ga0070659_101251140
547 Ga0070659_101906268
548 Ga0070703_10002822
549 Ga0070701_10131893
550 Ga0070705_100003263
551 Ga0070705_100026739
552 Ga0070705_100077243
553 Ga0070705_100230104
554 Ga0070705_100422623
555 Ga0070705_100952776
556 Ga0070700_100159601
557 Ga0070700_101006440
558 Ga0070694_100135593
559 Ga0070694_101582961
560 Ga0070662_100662062
561 Ga0070662_101458273
562 Ga0070681_10006697
563 Ga0070681_10019243
564 Ga0070681_10643152
565 Ga0068867_100469200
566 Ga0068867_101753165
567 Ga0070699_100654334
568 Ga0070679_100514372
569 Ga0068853_100018847
570 Ga0068853_101279343
571 Ga0068853_101339538
572 Ga0068853_102278032
573 Ga0070695_100060001
574 Ga0070695_100108400
575 Ga0070695_100157074
576 Ga0070695_100197651
577 Ga0070695_100408865
578 Ga0070695_100717901
579 Ga0070695_100797335
580 Ga0070696_100007127
581 Ga0070696_100138602
582 Ga0070696_100151547
583 Ga0070696_100828905
584 Ga0070696_101344488
585 Ga0070693_100002445
586 Ga0070693_100118612
587 Ga0070693_100128398
588 Ga0070693_100142360
589 Ga0070693_100179417
590 Ga0070693_100527771
591 Ga0070693_100824114
592 Ga0070704_100303402
593 Ga0070704_100451596
594 Ga0070704_100631123
595 Ga0070704_100838124
596 Ga0068855_100475447
597 Ga0070664_100223967
598 Ga0068857_100183977
599 Ga0068857_100235948
600 Ga0068857_100391819
601 Ga0068857_100449220
602 Ga0068857_101643157
603 Ga0068854_100243828
604 Ga0068854_101107275
605 Ga0068856_100154313
606 Ga0070702_100010707
607 Ga0070702_101484173
608 Ga0068852_100359390
609 Ga0068852_101103721
610 Ga0068852_101314532
611 Ga0068859_100010723
612 Ga0068859_100015823
613 Ga0068859_100044701
614 Ga0068859_100081829
615 Ga0068859_100291581
616 Ga0068859_100299364
617 Ga0068859_100301145
618 Ga0068859_100541512
619 Ga0068859_100585105
620 Ga0068859_100955491
621 Ga0068864_100135269
622 Ga0068864_100165854
623 Ga0068864_100333577
624 Ga0068864_100492091
625 Ga0068864_101610179
626 Ga0068861_100084544
627 Ga0068861_101175833
628 Ga0068851_10001358
629 Ga0068870_10288741
630 Ga0068863_100368448
631 Ga0068863_100582130
632 Ga0068863_101039764
633 Ga0068863_101233955
634 Ga0068858_100135914
635 Ga0068858_100203992
636 Ga0068858_100270287
637 Ga0068858_100330255
638 Ga0068858_100411914
639 Ga0068858_100466454
640 Ga0068858_100925560
641 Ga0068860_100056619
642 Ga0068860_100106064
643 Ga0068860_100184826
644 Ga0068860_100894658
645 Ga0068860_101306815
646 Ga0068862_100176227
647 Ga0068862_100220193
648 Ga0068862_100859407
649 Ga0068862_101099698
650 Ga0068862_101566797
651 Ga0068862_101638513
652 Ga0081539_10000119
653 Ga0081539_10000884
654 Ga0075432_10050526
655 Ga0070716_100006865
656 Ga0070716_100331437
657 Ga0070716_101264125
658 Ga0097621_100050706
659 Ga0097621_102185379
660 Ga0068871_100010219
661 Ga0075428_100497063
662 Ga0075428_101470077
663 Ga0075433_10025329
664 Ga0075433_10048328
665 Ga0075433_10114939
666 Ga0075433_10405580
667 Ga0075434_100123651
668 Ga0075434_100215127
669 Ga0075434_100428591
670 Ga0075434_100782457
671 Ga0075434_100856754
672 Ga0097620_100010723
673 Ga0097620_100015824
674 Ga0097620_100044703
675 Ga0097620_100081830
676 Ga0097620_100232201
677 Ga0097620_100291580
678 Ga0097620_100299340
679 Ga0097620_100301162
680 Ga0097620_100381291
681 Ga0097620_100541597
682 Ga0097620_100585121
683 Ga0097620_100955527
684 Ga0097620_101350798
685 Ga0105240_10096752
686 Ga0105240_10229373
687 Ga0105240_11465361
688 Ga0111539_10043211
689 Ga0111539_10049890
690 Ga0111539_12097774
691 Ga0105245_11127262
692 Ga0105245_12171887
693 Ga0105247_10000841
694 Ga0105247_10104879
695 Ga0105247_10483938
696 Ga0105247_10590384
697 Ga0114129_10028076
698 Ga0114129_11359976
699 Ga0105243_10014264
700 Ga0105243_11126179
701 Ga0105243_11475058
702 Ga0105243_12196518
703 Ga0105241_10003816
704 Ga0105241_10076223
705 Ga0105241_10154306
706 Ga0105241_10294659
707 Ga0105241_10489133
708 Ga0105241_10904412
709 Ga0105241_11394293
710 Ga0105241_11555502
711 Ga0105242_10023657
712 Ga0105242_10624354
713 Ga0105242_10693064
714 Ga0105248_10001687
715 Ga0105248_10031596
716 Ga0105248_10378138
717 Ga0105248_10633369
718 Ga0105248_10981402
719 Ga0105248_11427152
720 Ga0105248_13264639
721 Ga0105237_10000199
722 Ga0105237_10277922
723 Ga0105237_10715059
724 Ga0105237_10719851
725 Ga0105238_10182322
726 Ga0105238_10302082
727 Ga0105249_10132025
728 Ga0105249_11775970
729 Ga0105239_10414482
730 Ga0105239_10736067
731 Ga0105239_10736392
732 Ga0105239_12034248
733 Ga0105239_12536223
734 Ga0105239_12865004
735 Ga0105246_11047063
736 Ga0105246_11197564
737 Ga0105246_11385310
738 Ga0157373_10005740
739 Ga0157373_10109165
740 Ga0157378_10850368
741 Ga0157378_10965019
742 Ga0157378_12198226
743 Ga0163162_10225139
744 Ga0163162_11065555
745 Ga0163162_11161280
746 Ga0157372_10390310
747 Ga0157372_10879732
748 Ga0157372_12371613
749 Ga0157372_12542915
750 Ga0157375_10038676
751 Ga0157375_10472306
752 Ga0157375_11199587
753 Ga0163163_10000465
754 Ga0163163_10071683
755 Ga0163163_10382087
756 Ga0163163_11141114
757 Ga0163163_12356579
758 Ga0163163_12394173
759 Ga0157380_10280953
760 Ga0157380_12191032
761 Ga0157380_12960713
762 Ga0157377_10184206
763 Ga0157379_10167793
764 Ga0182007_10259229
765 Ga0207653_10005858
766 Ga0207710_10000563
767 Ga0207710_10193574
768 Ga0207710_10460376
769 Ga0207680_10599401
770 Ga0207647_10054933
771 Ga0207647_10372031
772 Ga0207645_10549295
773 Ga0207643_10054064
774 Ga0207643_10792205
775 Ga0207654_10053903
776 Ga0207654_10434622
777 Ga0207654_10930853
778 Ga0207654_11045979
779 Ga0207707_10005841
780 Ga0207695_10100888
781 Ga0207671_10001814
782 Ga0207671_10339362
783 Ga0207662_10088599
784 Ga0207662_10652606
785 Ga0207657_10606248
786 Ga0207652_10838869
787 Ga0207681_10047753
788 Ga0207694_10189806
789 Ga0207694_10339942
790 Ga0207650_10000156
791 Ga0207650_10120347
792 Ga0207650_10998666
793 Ga0207659_10105581
794 Ga0207659_10481609
795 Ga0207659_11210693
796 Ga0207687_10868040
797 Ga0207644_10475113
798 Ga0207690_10073952
799 Ga0207690_10823190
800 Ga0207706_10486741
801 Ga0207706_11155997
802 Ga0207686_10235241
803 Ga0207709_10115956
804 Ga0207709_11192450
805 Ga0207709_11535339
806 Ga0207665_10039103
807 Ga0207665_10207150
808 Ga0207665_11166869
809 Ga0207711_10033707
810 Ga0207711_10081776
811 Ga0207711_10371092
812 Ga0207689_10210294
813 Ga0207689_10574568
814 Ga0207689_10835008
815 Ga0207679_10438822
816 Ga0207679_11879460
817 Ga0207667_10700149
818 Ga0207667_10896971
819 Ga0207651_10486227
820 Ga0207651_10742707
821 Ga0207712_10734245
822 Ga0207640_10083948
823 Ga0207640_11052609
824 Ga0207677_10585292
825 Ga0207703_10040173
826 Ga0207703_10045389
827 Ga0207703_10134753
828 Ga0207703_10847299
829 Ga0207703_10850369
830 Ga0207703_11032028
831 Ga0207703_12109853
832 Ga0207639_10713723
833 Ga0207639_10820084
834 Ga0207639_10989067
835 Ga0207708_10024121
836 Ga0207708_10345716
837 Ga0207708_10979208
838 Ga0207702_10449150
839 Ga0207641_10984422
840 Ga0207641_11138441
841 Ga0207641_12275953
842 Ga0207648_10119700
843 Ga0207648_10213492
844 Ga0207648_11072757
845 Ga0207648_11860998
846 Ga0207676_10172126
847 Ga0207676_10247509
848 Ga0207676_10597247
849 Ga0207676_10607948
850 Ga0207676_11312475
851 Ga0207674_10024472
852 Ga0207674_10117920
853 Ga0207674_10263505
854 Ga0207674_10586509
855 Ga0207674_10680223
856 Ga0207675_100147504
857 Ga0207675_100787576
858 Ga0207675_101144497
859 Ga0207675_101264908
860 Ga0207698_10330778
861 Ga0207698_10352952
862 Ga0207698_11211099
863 Ga0207698_11370221
864 Ga0207428_10003819
865 Ga0268265_10156790
866 Ga0268265_11340140
867 Ga0268265_11850475
868 Ga0268265_11932709
869 Ga0268264_10075759
870 Ga0268264_10222229
871 Ga0268264_10669912
872 Ga0307408_100003938
873 Ga0307408_100275501
874 Ga0307405_10004763
875 Ga0307413_10112242
876 Ga0307406_10056123
877 Ga0307407_11017081
878 Ga0307412_10077745
879 Ga0307414_10001159
880 Ga0307411_10029299
881 Ga0307415_100040643
882 Ga0307415_101081591
883 Ga0307507_10391525
884 Ga0395898_0430274
885 Ga0395898_0972496
886 Ga0395898_1543574
887 Ga0395901_0471784
888 Ga0395901_0732701
889 Ga0242422_00500
890 Ga0242420_004461
891 Ga0439448_0046530
892 Ga0439455_0113749
893 Ga0439458_0007486
894 Ga0439459_0209707
895 Ga0495643_0245997
896 Ga0496102_0651816
897 Ga0496106_0116524
898 Ga0496106_0117794
899 Ga0496108_0234264
900 Ga0496109_0860223
901 Ga0496109_1313569
902 Ga0496110_0919916
903 Ga0496112_0279771
904 Ga0496112_1814533
905 Ga0496113_0523767
906 Ga0496113_1123042
907 Ga0501292_010425
908 Ga0501292_028397
909 Ga0501298_026459
910 Ga0501298_040557
911 Ga0501299_025442
912 Ga0501303_012581
913 Ga0501303_020259
914 Ga0501198_007272
915 Ga0501199_004548
916 Ga0501202_012489
917 Ga0501202_032584
918 Ga0501206_006374
919 Ga0501207_065958
920 Ga0501208_101507
921 Ga0501209_014087
922 Ga0501209_033210
923 Ga0501210_012230
924 Ga0501216_016729
925 Ga0501217_003896
926 Ga0501217_005830
927 Ga0501217_052777
928 Ga0501223_004286
929 Ga0501224_009159
930 Ga0501224_018642
931 Ga0501227_001899
932 Ga0501227_003302
933 Ga0501227_013756
934 Ga0501228_073404
935 Ga0501230_059733
936 Ga0501233_000236
937 Ga0501233_033931
938 Ga0501235_014434
939 Ga0501235_084454
940 Ga0501238_030521
941 Ga0501238_050717
942 Ga0501239_016906
943 Ga0501240_000903
944 Ga0501243_003158
945 Ga0501243_009757
946 Ga0501247_012454
947 Ga0501249_019256
948 Ga0501250_029687
949 Ga0501253_059977
950 Ga0501255_022807
951 Ga0501256_006291
952 Ga0501256_015877
953 Ga0501257_013742
954 Ga0501257_038580
955 Ga0501259_050424
956 Ga0501260_010467
957 Ga0501260_017702
958 Ga0501261_076849
959 Ga0501219_021433
960 Ga0501221_005872
961 Ga0501221_071833
962 Ga0501225_0000779
963 Ga0501225_0018107
964 Ga0501229_008722
965 Ga0501234_001206
966 Ga0501234_014669
967 Ga0501245_007413
968 Ga0501245_015546
969 Ga0501245_033410
970 Ga0501263_012125
971 Ga0501271_060789
972 Ga0501273_006788
973 Ga0501273_047716
974 Ga0501273_077098
975 Ga0501283_063327
976 Ga0501283_068656
977 Ga0501204_017849
978 Ga0501212_086395
979 Ga0501226_000853
980 nmdc:mga08y16_132893_c1
981 nmdc:mga08y16_4844_c1
982 nmdc:mga0n895_410903_c1
983 nmdc:mga0n895_451241_c1
984 nmdc:mga0n895_509488_c1
985 nmdc:mga0a205_103815_c2
986 nmdc:mga0a205_152470_c1
987 nmdc:mga0a205_23201_c1
988 nmdc:mga0a205_377320_c1
989 nmdc:mga0a205_390344_c1
990 nmdc:mga0a205_42796_c1
991 nmdc:mga0a205_830736_c1
992 nmdc:mga0a205_84368_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dxr-assembly1.cif.gz_H photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex) 0.7754 6 82
5o64-assembly1.cif.gz_H from macrocrystals to microcrystals: a strategy for membrane protein serial crystallography 0.7633 6 82
3t6d-assembly1.cif.gz_H crystal structure of the reaction centre from blastochloris viridis strain dsm 133 (atcc 19567) substrain-08 0.7616 6 82
4ac5-assembly1.cif.gz_H lipidic sponge phase crystal structure of the bl. viridis reaction centre solved using serial femtosecond crystallography 0.7554 6 81
5b5n-assembly2.cif.gz_t crystal structure of the ba-substituted lh1-rc complex from tch. tepidum 0.7515 9 82
ID Description Score Start End Superfamily
af_A0A075B6I7_20_105_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8208 26 41 2.60.40.10
1l9jH02 Alpha Beta;Alpha-Beta Complex;Photosynthetic Reaction Center; Chain H, domain 2;Photosynthetic Reaction Center, subunit H, domain 2 0.7955 6 82 3.90.50.10
1dxrH02 Alpha Beta;Alpha-Beta Complex;Photosynthetic Reaction Center; Chain H, domain 2;Photosynthetic Reaction Center, subunit H, domain 2 0.7754 6 82 3.90.50.10
1pm3A00 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.7286 6 83 2.30.30.240
1pm3B00 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.7124 1 83 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A841B0V1-F1-model_v4 PRC-barrel domain-containing protein 0.9094 7 41
AF-A0A1Q4ABF2-F1-model_v4 CBS domain-containing protein 0.854 10 84 GO:0015095
GO:0016020
AF-A0A7V9I8W1-F1-model_v4 Magnesium transporter 0.84 7 86 GO:0015095
GO:0016020
AF-A0A6I2WXB1-F1-model_v4 Magnesium transporter 0.821 9 81
AF-A0A7X6R0J6-F1-model_v4 Magnesium transporter 0.8107 7 83 GO:0015095
GO:0016020

Map