F454806

General Info

Members Datasets Scaffolds Average Seq Length
495 209 990 241

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_079409|Ga0500645_079409_14_841
Length 275
Sequence MIRKNSLFKDSSRANSSRAVTPQMRVTHDSATYVVTLKRTVSARRFTLRVRNATRDVVLTIPRRASITDARDFAEKHAAWIGERLQKLPQPVPFEHGGIIPLRGIAHIILHKPDARGTVWIEAHTPHNADGPLLALCVAGRKEHVARRVVDYLRAQAMADLKVAVKVHAAQINMTPSKIAIRDSKTRWGSCSAAGALNFSWRIILAPAFVLDYLAAHEVAHLVHLNHSEKFWTLTRRLYRDTDKAEAWLNACGAQLHQYGKPATYDAASVEASSL

Samples

Sample ID Description Type Environment
1 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
207 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
208 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
209 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.29
Nodule 0
Rhizoplane 0.4
Rhizosphere 89.49
Stem 0
Stem Tuber 0
Unclassified 3.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500645_079409 3300053730 Bacteria 937
2 MBSR1b_contig_10277987 2162886012 Unclassified 935
3 JGI24741J21665_1000945 3300001915 Bacteria 8779
4 JGI24741J21665_1007819 3300001915 Bacteria 2052
5 JGI24740J21852_10002505 3300001979 Bacteria 8297
6 JGI24739J22299_10003332 3300001989 Bacteria 6123
7 JGI24739J22299_10003778 3300001989 Bacteria 5778
8 JGI24737J22298_10001044 3300001990 Bacteria 9778
9 Ga0065712_10281641 3300005290 Unclassified 894
10 Ga0070658_10002784 3300005327 Bacteria 14531
11 Ga0070658_10047975 3300005327 Bacteria 3457
12 Ga0070658_10064300 3300005327 Bacteria 2992
13 Ga0070658_10100326 3300005327 Bacteria 2393
14 Ga0070658_10134146 3300005327 Bacteria 2065
15 Ga0070658_10188055 3300005327 Bacteria 1740
16 Ga0070658_10518528 3300005327 Bacteria 1030
17 Ga0070676_10024836 3300005328 Bacteria 3381
18 Ga0070676_10224828 3300005328 Bacteria 1241
19 Ga0070683_100009270 3300005329 Bacteria 8409
20 Ga0070683_100180238 3300005329 Bacteria 2005
21 Ga0070670_100000657 3300005331 Bacteria 26873
22 Ga0070670_100003277 3300005331 Bacteria 13391
23 Ga0070670_100015957 3300005331 Bacteria 6446
24 Ga0070670_100104214 3300005331 Bacteria 2443
25 Ga0070677_10001877 3300005333 Bacteria 6648
26 Ga0070677_10004635 3300005333 Bacteria 4497
27 Ga0070677_10025564 3300005333 Bacteria 2205
28 Ga0070666_10041117 3300005335 Bacteria 3088
29 Ga0070680_100000468 3300005336 Bacteria 27588
30 Ga0070680_100000917 3300005336 Bacteria 20846
31 Ga0070680_100020220 3300005336 Bacteria 5282
32 Ga0070680_100034908 3300005336 Bacteria 4057
33 Ga0070680_100041635 3300005336 Bacteria 3724
34 Ga0070680_100051630 3300005336 Bacteria 3355
35 Ga0068868_100305198 3300005338 Bacteria 1353
36 Ga0068868_100342176 3300005338 Bacteria 1279
37 Ga0070660_100201800 3300005339 Bacteria 1613
38 Ga0070660_100305675 3300005339 Bacteria 1304
39 Ga0070689_100029845 3300005340 Bacteria 4133
40 Ga0070691_10019036 3300005341 Bacteria 3165
41 Ga0070661_100013322 3300005344 Bacteria 5772
42 Ga0070661_100260421 3300005344 Unclassified 1341
43 Ga0070661_100316317 3300005344 Bacteria 1218
44 Ga0070692_10002153 3300005345 Bacteria 7546
45 Ga0070692_10006558 3300005345 Bacteria 5061
46 Ga0070692_10008008 3300005345 Bacteria 4689
47 Ga0070668_100132571 3300005347 Bacteria 2001
48 Ga0070669_100004075 3300005353 Bacteria 10581
49 Ga0070669_100052606 3300005353 Bacteria 2980
50 Ga0070669_100244718 3300005353 Bacteria 1426
51 Ga0070669_100455160 3300005353 Bacteria 1055
52 Ga0070675_100000529 3300005354 Bacteria 26091
53 Ga0070675_100013820 3300005354 Bacteria 6356
54 Ga0070675_100400206 3300005354 Bacteria 1225
55 Ga0070671_100000620 3300005355 Bacteria 25349
56 Ga0070671_100013594 3300005355 Bacteria 6566
57 Ga0070671_100034936 3300005355 Bacteria 4163
58 Ga0070671_100097442 3300005355 Bacteria 2466
59 Ga0070674_100023253 3300005356 Bacteria 4009
60 Ga0070674_100321143 3300005356 Bacteria 1241
61 Ga0070673_100000890 3300005364 Bacteria 16848
62 Ga0070659_100047037 3300005366 Bacteria 3383
63 Ga0070659_100197373 3300005366 Bacteria 1655
64 Ga0070659_100505615 3300005366 Bacteria 1030
65 Ga0070667_100013175 3300005367 Bacteria 6834
66 Ga0070667_100087532 3300005367 Bacteria 2673
67 Ga0070667_100616722 3300005367 Bacteria 1000
68 Ga0070714_100458088 3300005435 Bacteria 1212
69 Ga0070714_100745656 3300005435 Bacteria 946
70 Ga0070714_101034709 3300005435 Unclassified 799
71 Ga0070663_100023175 3300005455 Bacteria 4158
72 Ga0070663_100350470 3300005455 Bacteria 1195
73 Ga0070662_100002188 3300005457 Bacteria 11980
74 Ga0070662_100040569 3300005457 Bacteria 3315
75 Ga0070662_100115215 3300005457 Bacteria 2053
76 Ga0070662_100259710 3300005457 Bacteria 1399
77 Ga0070662_100389801 3300005457 Bacteria 1148
78 Ga0070662_100397387 3300005457 Bacteria 1137
79 Ga0070662_100420053 3300005457 Bacteria 1106
80 Ga0070662_100816546 3300005457 Bacteria 793
81 Ga0070681_10029588 3300005458 Bacteria 5500
82 Ga0070681_10063515 3300005458 Bacteria 3664
83 Ga0068867_100084195 3300005459 Bacteria 2402
84 Ga0070706_100300850 3300005467 Bacteria 1497
85 Ga0070707_100046460 3300005468 Bacteria 4156
86 Ga0070698_100001072 3300005471 Bacteria 30058
87 Ga0070699_100088697 3300005518 Bacteria 2702
88 Ga0070679_100010351 3300005530 Bacteria 8843
89 Ga0070679_100315707 3300005530 Bacteria 1512
90 Ga0070679_100352317 3300005530 Unclassified 1420
91 Ga0070684_100005925 3300005535 Bacteria 9411
92 Ga0068853_100221980 3300005539 Bacteria 1726
93 Ga0070672_100002052 3300005543 Bacteria 12698
94 Ga0070693_100314864 3300005547 Bacteria 1060
95 Ga0070665_100006408 3300005548 Bacteria 11980
96 Ga0070665_100015136 3300005548 Bacteria 7743
97 Ga0070665_100036616 3300005548 Bacteria 4935
98 Ga0070665_100112339 3300005548 Bacteria 2727
99 Ga0070704_100625559 3300005549 Bacteria 948
100 Ga0068855_100012862 3300005563 Bacteria 10097
101 Ga0068855_100021299 3300005563 Bacteria 7773
102 Ga0068855_100036974 3300005563 Bacteria 5809
103 Ga0068855_100041276 3300005563 Bacteria 5469
104 Ga0068855_100046358 3300005563 Bacteria 5139
105 Ga0070664_100006233 3300005564 Bacteria 9632
106 Ga0070664_100017003 3300005564 Bacteria 5970
107 Ga0070664_100200627 3300005564 Bacteria 1780
108 Ga0068857_100042980 3300005577 Bacteria 4009
109 Ga0068857_100048387 3300005577 Bacteria 3775
110 Ga0068854_100332742 3300005578 Bacteria 1238
111 Ga0068856_100029815 3300005614 Bacteria 5331
112 Ga0068856_100291201 3300005614 Bacteria 1650
113 Ga0068852_100020023 3300005616 Bacteria 5313
114 Ga0068852_100154760 3300005616 Bacteria 2135
115 Ga0068852_100214338 3300005616 Bacteria 1828
116 Ga0068852_100282478 3300005616 Bacteria 1601
117 Ga0068864_100029799 3300005618 Bacteria 4625
118 Ga0068861_100003591 3300005719 Bacteria 10329
119 Ga0068870_10237170 3300005840 Bacteria 1124
120 Ga0068858_100532937 3300005842 Bacteria 1136
121 Ga0068860_100020638 3300005843 Bacteria 6382
122 Ga0068862_100027405 3300005844 Bacteria 4796
123 Ga0081455_10004726 3300005937 Bacteria 15138
124 Ga0081455_10013638 3300005937 Bacteria 8005
125 Ga0081539_10001293 3300005985 Bacteria 43956
126 Ga0081539_10012018 3300005985 Bacteria 6740
127 Ga0081539_10038087 3300005985 Bacteria 2854
128 Ga0075365_10072156 3300006038 Bacteria 2325
129 Ga0075365_10073279 3300006038 Bacteria 2308
130 Ga0075368_10016881 3300006042 Bacteria 2725
131 Ga0075363_100069900 3300006048 Bacteria 1906
132 Ga0075363_100198681 3300006048 Unclassified 1145
133 Ga0075364_10334572 3300006051 Bacteria 1032
134 Ga0070712_100486118 3300006175 Unclassified 1033
135 Ga0075362_10001671 3300006177 Bacteria 7192
136 Ga0075362_10009014 3300006177 Bacteria 3839
137 Ga0075362_10048017 3300006177 Bacteria 1903
138 Ga0075362_10246303 3300006177 Bacteria 878
139 Ga0075367_10014014 3300006178 Bacteria 4331
140 Ga0075367_10031353 3300006178 Bacteria 3052
141 Ga0075369_10000126 3300006186 Bacteria 21261
142 Ga0075369_10014615 3300006186 Bacteria 3140
143 Ga0075369_10027846 3300006186 Bacteria 2365
144 Ga0075369_10115916 3300006186 Bacteria 1210
145 Ga0075366_10151674 3300006195 Bacteria 1403
146 Ga0097621_100151074 3300006237 Bacteria 1992
147 Ga0075370_10032915 3300006353 Bacteria 2901
148 Ga0075430_100025036 3300006846 Bacteria 5078
149 Ga0099795_10060414 3300007788 Bacteria 1405
150 Ga0105240_10005805 3300009093 Bacteria 18309
151 Ga0105243_10236575 3300009148 Bacteria 1623
152 Ga0105248_10090724 3300009177 Bacteria 3441
153 Ga0105248_10455609 3300009177 Bacteria 1442
154 Ga0105238_10487020 3300009551 Bacteria 1233
155 Ga0105249_10437102 3300009553 Bacteria 1345
156 Ga0157373_10010065 3300013100 Bacteria 6968
157 Ga0157373_10035961 3300013100 Bacteria 3555
158 Ga0157373_10371965 3300013100 Bacteria 1021
159 Ga0157371_10015102 3300013102 Bacteria 5805
160 Ga0157371_10206341 3300013102 Bacteria 1409
161 Ga0157370_10132550 3300013104 Bacteria 2324
162 Ga0157370_10191758 3300013104 Bacteria 1897
163 Ga0157369_10039449 3300013105 Bacteria 5160
164 Ga0157369_10215652 3300013105 Bacteria 2010
165 Ga0157369_10268268 3300013105 Bacteria 1779
166 Ga0157378_10205061 3300013297 Bacteria 1867
167 Ga0163162_10017647 3300013306 Bacteria 6982
168 Ga0157372_10008404 3300013307 Bacteria 10966
169 Ga0157372_10496750 3300013307 Bacteria 1423
170 Ga0157375_10019912 3300013308 Bacteria 6118
171 Ga0157380_10636938 3300014326 Bacteria 1061
172 Ga0163161_10001079 3300017792 Bacteria 20654
173 Ga0213872_10035496 3300021361 Bacteria 2280
174 Ga0213872_10123305 3300021361 Bacteria 1145
175 Ga0213874_10023105 3300021377 Bacteria 1731
176 Ga0213871_10012287 3300021441 Bacteria 1986
177 Ga0207682_10000811 3300025893 Bacteria 14470
178 Ga0207682_10066792 3300025893 Bacteria 1516
179 Ga0207688_10011779 3300025901 Bacteria 4757
180 Ga0207688_10144280 3300025901 Bacteria 1403
181 Ga0207688_10166728 3300025901 Bacteria 1308
182 Ga0207680_10029044 3300025903 Bacteria 3101
183 Ga0207645_10039495 3300025907 Bacteria 3024
184 Ga0207645_10101587 3300025907 Bacteria 1856
185 Ga0207705_10002175 3300025909 Bacteria 15159
186 Ga0207705_10054176 3300025909 Bacteria 2891
187 Ga0207705_10060589 3300025909 Bacteria 2734
188 Ga0207705_10120965 3300025909 Bacteria 1943
189 Ga0207705_10208363 3300025909 Bacteria 1482
190 Ga0207705_10321939 3300025909 Unclassified 1188
191 Ga0207684_10490662 3300025910 Bacteria 1053
192 Ga0207707_10002628 3300025912 Bacteria 16085
193 Ga0207707_10209515 3300025912 Bacteria 1698
194 Ga0207695_10035031 3300025913 Bacteria 5449
195 Ga0207660_10000024 3300025917 Bacteria 71220
196 Ga0207660_10012452 3300025917 Bacteria 5566
197 Ga0207660_10042978 3300025917 Bacteria 3174
198 Ga0207657_10010583 3300025919 Bacteria 9197
199 Ga0207657_10028259 3300025919 Bacteria 5119
200 Ga0207657_10205397 3300025919 Bacteria 1583
201 Ga0207657_10362182 3300025919 Bacteria 1143
202 Ga0207649_10016551 3300025920 Bacteria 4161
203 Ga0207652_10009519 3300025921 Bacteria 7814
204 Ga0207652_10034069 3300025921 Bacteria 4290
205 Ga0207652_10134646 3300025921 Bacteria 2206
206 Ga0207652_10272925 3300025921 Bacteria 1525
207 Ga0207646_10338204 3300025922 Bacteria 1360
208 Ga0207681_10003745 3300025923 Bacteria 9452
209 Ga0207681_10008452 3300025923 Bacteria 6292
210 Ga0207681_10267665 3300025923 Bacteria 1340
211 Ga0207681_10505472 3300025923 Bacteria 990
212 Ga0207650_10009357 3300025925 Bacteria 6697
213 Ga0207650_10009710 3300025925 Bacteria 6580
214 Ga0207659_10000784 3300025926 Bacteria 18775
215 Ga0207659_10001878 3300025926 Bacteria 12439
216 Ga0207659_10108724 3300025926 Bacteria 2104
217 Ga0207664_10096734 3300025929 Bacteria 2431
218 Ga0207664_10226688 3300025929 Bacteria 1623
219 Ga0207644_10008627 3300025931 Bacteria 6668
220 Ga0207644_10037317 3300025931 Bacteria 3418
221 Ga0207644_10038026 3300025931 Bacteria 3388
222 Ga0207690_10001369 3300025932 Bacteria 15299
223 Ga0207690_10204145 3300025932 Bacteria 1503
224 Ga0207690_10220231 3300025932 Bacteria 1452
225 Ga0207706_10005197 3300025933 Bacteria 12144
226 Ga0207706_10007849 3300025933 Bacteria 9849
227 Ga0207706_10010255 3300025933 Bacteria 8568
228 Ga0207706_10010795 3300025933 Bacteria 8335
229 Ga0207706_10091080 3300025933 Bacteria 2681
230 Ga0207706_10146766 3300025933 Bacteria 2075
231 Ga0207706_10682037 3300025933 Bacteria 879
232 Ga0207709_10156087 3300025935 Bacteria 1586
233 Ga0207670_10128316 3300025936 Bacteria 1854
234 Ga0207669_10100982 3300025937 Bacteria 1907
235 Ga0207669_10361333 3300025937 Bacteria 1125
236 Ga0207669_10398019 3300025937 Bacteria 1078
237 Ga0207704_10029446 3300025938 Bacteria 3062
238 Ga0207691_10027087 3300025940 Bacteria 5378
239 Ga0207691_10277329 3300025940 Bacteria 1443
240 Ga0207711_10000413 3300025941 Bacteria 45274
241 Ga0207711_10354246 3300025941 Bacteria 1359
242 Ga0207661_10240234 3300025944 Bacteria 1607
243 Ga0207679_10003801 3300025945 Bacteria 9357
244 Ga0207679_10117363 3300025945 Bacteria 2112
245 Ga0207679_10266707 3300025945 Bacteria 1463
246 Ga0207667_10083816 3300025949 Bacteria 3301
247 Ga0207667_10165781 3300025949 Bacteria 2271
248 Ga0207667_10206854 3300025949 Bacteria 2012
249 Ga0207667_10290595 3300025949 Bacteria 1670
250 Ga0207667_10329437 3300025949 Bacteria 1559
251 Ga0207667_10499580 3300025949 Unclassified 1234
252 Ga0207651_10000602 3300025960 Bacteria 15164
253 Ga0207668_10020817 3300025972 Bacteria 4175
254 Ga0207668_10106690 3300025972 Bacteria 2093
255 Ga0207668_10495996 3300025972 Bacteria 1050
256 Ga0207640_10004054 3300025981 Bacteria 7914
257 Ga0207640_10251998 3300025981 Bacteria 1371
258 Ga0207658_10006732 3300025986 Bacteria 7821
259 Ga0207658_10012610 3300025986 Bacteria 5772
260 Ga0207658_10360947 3300025986 Bacteria 1267
261 Ga0207658_10468747 3300025986 Bacteria 1117
262 Ga0207677_10190526 3300026023 Bacteria 1622
263 Ga0207703_10538636 3300026035 Bacteria 1100
264 Ga0207639_10030482 3300026041 Bacteria 3955
265 Ga0207639_10365127 3300026041 Bacteria 1293
266 Ga0207678_10008649 3300026067 Bacteria 8972
267 Ga0207678_10093787 3300026067 Bacteria 2564
268 Ga0207641_10031476 3300026088 Bacteria 4400
269 Ga0207641_10070414 3300026088 Bacteria 3005
270 Ga0207648_10098209 3300026089 Bacteria 2564
271 Ga0207674_10013085 3300026116 Bacteria 9236
272 Ga0207674_10022169 3300026116 Bacteria 6826
273 Ga0207674_10228457 3300026116 Bacteria 1809
274 Ga0207675_100011776 3300026118 Bacteria 8175
275 Ga0207675_100677437 3300026118 Bacteria 1039
276 Ga0207683_10113936 3300026121 Bacteria 2422
277 Ga0207683_10605030 3300026121 Bacteria 1015
278 Ga0207698_10002051 3300026142 Bacteria 11883
279 Ga0207698_10017488 3300026142 Bacteria 4866
280 Ga0207698_10048995 3300026142 Bacteria 3212
281 Ga0207698_10054127 3300026142 Bacteria 3086
282 Ga0207698_10118821 3300026142 Bacteria 2233
283 Ga0207698_10184958 3300026142 Bacteria 1850
284 Ga0207698_10364240 3300026142 Bacteria 1370
285 Ga0207698_10369855 3300026142 Bacteria 1360
286 Ga0268266_10006479 3300028379 Bacteria 10715
287 Ga0268266_10007034 3300028379 Bacteria 10215
288 Ga0268266_10014582 3300028379 Bacteria 6754
289 Ga0268266_10039548 3300028379 Bacteria 4017
290 Ga0268265_10115265 3300028380 Bacteria 2202
291 Ga0268265_10371380 3300028380 Bacteria 1313
292 Ga0268264_10373683 3300028381 Bacteria 1363
293 Ga0265334_10007446 3300028573 Bacteria 4696
294 Ga0265330_10017312 3300031235 Bacteria 3320
295 Ga0265330_10060600 3300031235 Bacteria 1647
296 Ga0265332_10052759 3300031238 Bacteria 1746
297 Ga0265328_10000009 3300031239 Bacteria 179784
298 Ga0265328_10007208 3300031239 Bacteria 4650
299 Ga0265328_10008864 3300031239 Bacteria 4126
300 Ga0265328_10064821 3300031239 Bacteria 1342
301 Ga0265325_10037382 3300031241 Bacteria 2566
302 Ga0265340_10039678 3300031247 Bacteria 2321
303 Ga0265340_10049730 3300031247 Bacteria 2035
304 Ga0265331_10010626 3300031250 Bacteria 5082
305 Ga0265327_10000620 3300031251 Bacteria 58447
306 Ga0265327_10036530 3300031251 Bacteria 2699
307 Ga0265327_10068556 3300031251 Bacteria 1784
308 Ga0265316_10037966 3300031344 Bacteria 3883
309 Ga0307513_10511685 3300031456 Bacteria 917
310 Ga0307408_100129318 3300031548 Bacteria 1968
311 Ga0307408_100188998 3300031548 Bacteria 1658
312 Ga0307408_100209248 3300031548 Bacteria 1584
313 Ga0307408_100247358 3300031548 Bacteria 1469
314 Ga0307408_100289596 3300031548 Bacteria 1367
315 Ga0265314_10026807 3300031711 Bacteria 4324
316 Ga0307405_10016238 3300031731 Bacteria 4054
317 Ga0307405_10158212 3300031731 Bacteria 1601
318 Ga0307405_10316959 3300031731 Bacteria 1189
319 Ga0307405_10538113 3300031731 Bacteria 943
320 Ga0307405_10585166 3300031731 Bacteria 908
321 Ga0307405_10737351 3300031731 Bacteria 819
322 Ga0307413_10002347 3300031824 Bacteria 7682
323 Ga0307413_10009080 3300031824 Bacteria 4736
324 Ga0307413_10016879 3300031824 Bacteria 3788
325 Ga0307413_10088005 3300031824 Bacteria 2014
326 Ga0307413_10095257 3300031824 Bacteria 1951
327 Ga0307413_10102260 3300031824 Bacteria 1896
328 Ga0307413_10252809 3300031824 Unclassified 1308
329 Ga0307413_10514411 3300031824 Bacteria 964
330 Ga0307413_10547789 3300031824 Unclassified 938
331 Ga0307410_10001153 3300031852 Bacteria 11617
332 Ga0307410_10002542 3300031852 Bacteria 8832
333 Ga0307410_10016264 3300031852 Bacteria 4432
334 Ga0307410_10025301 3300031852 Bacteria 3722
335 Ga0307410_10053248 3300031852 Bacteria 2738
336 Ga0307410_10056667 3300031852 Bacteria 2666
337 Ga0307410_10060037 3300031852 Bacteria 2598
338 Ga0307410_10104741 3300031852 Bacteria 2035
339 Ga0307410_10132546 3300031852 Unclassified 1832
340 Ga0307410_10254311 3300031852 Bacteria 1367
341 Ga0307410_10264242 3300031852 Bacteria 1343
342 Ga0307410_10279730 3300031852 Bacteria 1309
343 Ga0307410_10428401 3300031852 Bacteria 1074
344 Ga0307406_10041386 3300031901 Bacteria 2871
345 Ga0307406_10180241 3300031901 Bacteria 1537
346 Ga0307406_10261895 3300031901 Bacteria 1309
347 Ga0307406_10315581 3300031901 Bacteria 1207
348 Ga0307407_10016972 3300031903 Bacteria 3640
349 Ga0307407_10019563 3300031903 Bacteria 3450
350 Ga0307407_10037455 3300031903 Bacteria 2680
351 Ga0307407_10066119 3300031903 Bacteria 2131
352 Ga0307407_10157238 3300031903 Bacteria 1484
353 Ga0307407_10290973 3300031903 Bacteria 1135
354 Ga0307412_10059803 3300031911 Bacteria 2555
355 Ga0307412_10077460 3300031911 Bacteria 2287
356 Ga0307412_10263314 3300031911 Bacteria 1345
357 Ga0307412_10290037 3300031911 Bacteria 1288
358 Ga0307409_100012103 3300031995 Bacteria 5479
359 Ga0307409_100026052 3300031995 Bacteria 4117
360 Ga0307409_100030321 3300031995 Bacteria 3883
361 Ga0307409_100059587 3300031995 Bacteria 2971
362 Ga0307409_100089791 3300031995 Bacteria 2513
363 Ga0307409_100106243 3300031995 Bacteria 2342
364 Ga0307409_100119099 3300031995 Bacteria 2231
365 Ga0307409_100144236 3300031995 Bacteria 2056
366 Ga0307409_100387697 3300031995 Bacteria 1330
367 Ga0307409_100404061 3300031995 Bacteria 1305
368 Ga0307416_100053804 3300032002 Bacteria 3232
369 Ga0307416_100061015 3300032002 Bacteria 3075
370 Ga0307416_100079205 3300032002 Bacteria 2768
371 Ga0307416_100299039 3300032002 Bacteria 1598
372 Ga0307416_100425612 3300032002 Bacteria 1373
373 Ga0307416_100533146 3300032002 Unclassified 1244
374 Ga0307414_10011892 3300032004 Bacteria 5127
375 Ga0307414_10011948 3300032004 Bacteria 5118
376 Ga0307414_10038644 3300032004 Bacteria 3207
377 Ga0307414_10252475 3300032004 Bacteria 1467
378 Ga0307414_10303873 3300032004 Bacteria 1351
379 Ga0307414_10500725 3300032004 Bacteria 1075
380 Ga0307414_10501078 3300032004 Bacteria 1074
381 Ga0307414_10964977 3300032004 Bacteria 784
382 Ga0307411_10017405 3300032005 Bacteria 4094
383 Ga0307411_10025650 3300032005 Bacteria 3535
384 Ga0307411_10056348 3300032005 Bacteria 2590
385 Ga0307411_10133242 3300032005 Bacteria 1819
386 Ga0307411_10136887 3300032005 Bacteria 1800
387 Ga0307411_10138255 3300032005 Bacteria 1792
388 Ga0307411_10207093 3300032005 Bacteria 1511
389 Ga0307411_10209981 3300032005 Unclassified 1502
390 Ga0307411_10284121 3300032005 Bacteria 1318
391 Ga0307415_100000171 3300032126 Bacteria 28816
392 Ga0307415_100015026 3300032126 Bacteria 4572
393 Ga0307415_100351252 3300032126 Bacteria 1241
394 Ga0307415_100394447 3300032126 Bacteria 1179
395 Ga0307415_100555504 3300032126 Bacteria 1014
396 Ga0307415_100627332 3300032126 Bacteria 960
397 Ga0373947_0077364 3300035725 Bacteria 2052
398 Ga0395899_0022786 3300037312 Bacteria 4745
399 Ga0395899_0069434 3300037312 Bacteria 2580
400 Ga0395899_0095855 3300037312 Bacteria 2146
401 Ga0395900_0014278 3300037418 Bacteria 8107
402 Ga0395900_0031660 3300037418 Bacteria 5436
403 Ga0395900_0147497 3300037418 Bacteria 2405
404 Ga0395900_0912149 3300037418 Unclassified 801
405 Ga0395898_0025316 3300037466 Bacteria 5981
406 Ga0395898_0050476 3300037466 Bacteria 4070
407 Ga0395898_0118576 3300037466 Bacteria 2535
408 Ga0395905_0024772 3300037471 Bacteria 5662
409 Ga0395905_0148033 3300037471 Bacteria 2209
410 Ga0395905_0271654 3300037471 Bacteria 1581
411 Ga0395905_0368365 3300037471 Bacteria 1330
412 Ga0395901_0025966 3300038443 Bacteria 6014
413 Ga0395901_0341257 3300038443 Bacteria 1547
414 Ga0395901_0693450 3300038443 Bacteria 1017
415 Ga0395901_0906229 3300038443 Bacteria 863
416 Ga0436360_0025123 3300039438 Bacteria 1090
417 Ga0436360_0150887 3300039438 Bacteria 8910
418 Ga0436360_0267241 3300039438 Bacteria 2978
419 Ga0436360_0332766 3300039438 Bacteria 1190
420 Ga0436360_0413189 3300039438 Bacteria 2108
421 Ga0436360_0794856 3300039438 Bacteria 3476
422 Ga0436360_0871595 3300039438 Bacteria 709
423 Ga0436361_0014516 3300039447 Bacteria 2078
424 Ga0436361_0216612 3300039447 Bacteria 1973
425 Ga0436361_0473707 3300039447 Bacteria 3085
426 Ga0436361_0496876 3300039447 Bacteria 2938
427 Ga0436361_0993467 3300039447 Bacteria 1637
428 Ga0436361_1122970 3300039447 Bacteria 1815
429 Ga0436362_0083198 3300039453 Bacteria 1045
430 Ga0436362_0636059 3300039453 Bacteria 2098
431 Ga0439448_0038811 3300042005 Bacteria 1534
432 Ga0439432_022786 3300042006 Bacteria 2067
433 Ga0439449_0064784 3300042007 Bacteria 1348
434 Ga0466963_0008324 3300044694 Bacteria 6212
435 Ga0466963_0059240 3300044694 Bacteria 2555
436 Ga0466963_0078434 3300044694 Bacteria 2233
437 Ga0466963_0091409 3300044694 Bacteria 2073
438 Ga0466963_0173975 3300044694 Bacteria 1502
439 Ga0466957_0000746 3300044842 Bacteria 16595
440 Ga0466957_0055131 3300044842 Bacteria 2429
441 Ga0466959_0023769 3300045049 Bacteria 4537
442 Ga0466958_0000875 3300045836 Bacteria 13436
443 Ga0466958_0013259 3300045836 Bacteria 4691
444 Ga0466958_0344655 3300045836 Bacteria 959
445 Ga0466958_0511483 3300045836 Bacteria 779
446 Ga0466967_0002184 3300045976 Bacteria 12037
447 Ga0466967_0132392 3300045976 Bacteria 2316
448 Ga0495585_0010968 3300046492 Bacteria 5384
449 Ga0495644_0133240 3300046523 Bacteria 947
450 Ga0495598_0003434 3300046537 Bacteria 3366
451 Ga0495621_0003738 3300046539 Bacteria 4217
452 Ga0495633_0007853 3300046558 Bacteria 6088
453 Ga0495669_0001697 3300046684 Bacteria 9017
454 Ga0495669_0002754 3300046684 Bacteria 7214
455 Ga0495670_0017811 3300046691 Bacteria 3498
456 Ga0495677_0002932 3300047445 Bacteria 6637
457 Ga0495681_0114508 3300047470 Bacteria 1164
458 Ga0496109_0657536 3300048912 Bacteria 985
459 Ga0496112_0319575 3300048915 Bacteria 1497
460 Ga0496126_0084408 3300048929 Bacteria 2801
461 Ga0501037_0061349 3300049573 Bacteria 2742
462 Ga0501038_0000010 3300049574 Bacteria 182652
463 Ga0501046_0227785 3300049580 Bacteria 1378
464 Ga0501047_0169094 3300049581 Bacteria 2055
465 Ga0501074_0475453 3300049590 Bacteria 886
466 Ga0501045_0430974 3300049824 Unclassified 981
467 nmdc:mga03683_19023_c1 3300050489 Bacteria 2618
468 nmdc:mga03683_30944_c1 3300050489 Bacteria 2144
469 nmdc:mga03683_615_c1 3300050489 Bacteria 10205
470 nmdc:mga03683_9034_c1 3300050489 Bacteria 3527
471 nmdc:mga03n38_103304_c1 3300050490 Bacteria 1377
472 nmdc:mga03n38_47501_c1 3300050490 Bacteria 1900
473 nmdc:mga00v17_234070_c1 3300050491 Bacteria 1190
474 nmdc:mga0yw44_114741_c1 3300050492 Unclassified 1729
475 nmdc:mga0yw44_120298_c1 3300050492 Bacteria 1691
476 nmdc:mga0yw44_91238_c1 3300050492 Bacteria 1926
477 nmdc:mga0k408_68227_c1 3300050493 Bacteria 2074
478 nmdc:mga06z11_11683_c1 3300050494 Bacteria 3793
479 nmdc:mga06z11_142598_c1 3300050494 Bacteria 1355
480 nmdc:mga06z11_382032_c1 3300050494 Bacteria 846
481 nmdc:mga06z11_74040_c1 3300050494 Bacteria 1810
482 nmdc:mga06z11_78351_c1 3300050494 Bacteria 1766
483 nmdc:mga04h51_44173_c1 3300050495 Bacteria 1468
484 nmdc:mga07m45_28642_c1 3300050496 Bacteria 3074
485 nmdc:mga07m45_29359_c1 3300050496 Bacteria 3040
486 nmdc:mga0sz30_113_c1 3300050516 Bacteria 30611
487 nmdc:mga0sz30_5851_c1 3300050516 Bacteria 4532
488 nmdc:mga0sz30_99426_c1 3300050516 Bacteria 1270
489 Ga0500641_0001680 3300053096 Bacteria 7872
490 Ga0500642_0014255 3300053130 Bacteria 2951
491 Ga0500616_0009758 3300053153 Bacteria 5799
492 Ga0500620_122242 3300053155 Bacteria 912
493 Ga0500552_000299 3300053733 Bacteria 4509
494 2891089694 2891088606 Bacteria 4762464
495 8002062983 8002060224 Bacteria 4026565
496 Ga0500645_079409
497 MBSR1b_contig_10277987
498 JGI24741J21665_1000945
499 JGI24741J21665_1007819
500 JGI24740J21852_10002505
501 JGI24739J22299_10003332
502 JGI24739J22299_10003778
503 JGI24737J22298_10001044
504 Ga0065712_10281641
505 Ga0070658_10002784
506 Ga0070658_10047975
507 Ga0070658_10064300
508 Ga0070658_10100326
509 Ga0070658_10134146
510 Ga0070658_10188055
511 Ga0070658_10518528
512 Ga0070676_10024836
513 Ga0070676_10224828
514 Ga0070683_100009270
515 Ga0070683_100180238
516 Ga0070670_100000657
517 Ga0070670_100003277
518 Ga0070670_100015957
519 Ga0070670_100104214
520 Ga0070677_10001877
521 Ga0070677_10004635
522 Ga0070677_10025564
523 Ga0070666_10041117
524 Ga0070680_100000468
525 Ga0070680_100000917
526 Ga0070680_100020220
527 Ga0070680_100034908
528 Ga0070680_100041635
529 Ga0070680_100051630
530 Ga0068868_100305198
531 Ga0068868_100342176
532 Ga0070660_100201800
533 Ga0070660_100305675
534 Ga0070689_100029845
535 Ga0070691_10019036
536 Ga0070661_100013322
537 Ga0070661_100260421
538 Ga0070661_100316317
539 Ga0070692_10002153
540 Ga0070692_10006558
541 Ga0070692_10008008
542 Ga0070668_100132571
543 Ga0070669_100004075
544 Ga0070669_100052606
545 Ga0070669_100244718
546 Ga0070669_100455160
547 Ga0070675_100000529
548 Ga0070675_100013820
549 Ga0070675_100400206
550 Ga0070671_100000620
551 Ga0070671_100013594
552 Ga0070671_100034936
553 Ga0070671_100097442
554 Ga0070674_100023253
555 Ga0070674_100321143
556 Ga0070673_100000890
557 Ga0070659_100047037
558 Ga0070659_100197373
559 Ga0070659_100505615
560 Ga0070667_100013175
561 Ga0070667_100087532
562 Ga0070667_100616722
563 Ga0070714_100458088
564 Ga0070714_100745656
565 Ga0070714_101034709
566 Ga0070663_100023175
567 Ga0070663_100350470
568 Ga0070662_100002188
569 Ga0070662_100040569
570 Ga0070662_100115215
571 Ga0070662_100259710
572 Ga0070662_100389801
573 Ga0070662_100397387
574 Ga0070662_100420053
575 Ga0070662_100816546
576 Ga0070681_10029588
577 Ga0070681_10063515
578 Ga0068867_100084195
579 Ga0070706_100300850
580 Ga0070707_100046460
581 Ga0070698_100001072
582 Ga0070699_100088697
583 Ga0070679_100010351
584 Ga0070679_100315707
585 Ga0070679_100352317
586 Ga0070684_100005925
587 Ga0068853_100221980
588 Ga0070672_100002052
589 Ga0070693_100314864
590 Ga0070665_100006408
591 Ga0070665_100015136
592 Ga0070665_100036616
593 Ga0070665_100112339
594 Ga0070704_100625559
595 Ga0068855_100012862
596 Ga0068855_100021299
597 Ga0068855_100036974
598 Ga0068855_100041276
599 Ga0068855_100046358
600 Ga0070664_100006233
601 Ga0070664_100017003
602 Ga0070664_100200627
603 Ga0068857_100042980
604 Ga0068857_100048387
605 Ga0068854_100332742
606 Ga0068856_100029815
607 Ga0068856_100291201
608 Ga0068852_100020023
609 Ga0068852_100154760
610 Ga0068852_100214338
611 Ga0068852_100282478
612 Ga0068864_100029799
613 Ga0068861_100003591
614 Ga0068870_10237170
615 Ga0068858_100532937
616 Ga0068860_100020638
617 Ga0068862_100027405
618 Ga0081455_10004726
619 Ga0081455_10013638
620 Ga0081539_10001293
621 Ga0081539_10012018
622 Ga0081539_10038087
623 Ga0075365_10072156
624 Ga0075365_10073279
625 Ga0075368_10016881
626 Ga0075363_100069900
627 Ga0075363_100198681
628 Ga0075364_10334572
629 Ga0070712_100486118
630 Ga0075362_10001671
631 Ga0075362_10009014
632 Ga0075362_10048017
633 Ga0075362_10246303
634 Ga0075367_10014014
635 Ga0075367_10031353
636 Ga0075369_10000126
637 Ga0075369_10014615
638 Ga0075369_10027846
639 Ga0075369_10115916
640 Ga0075366_10151674
641 Ga0097621_100151074
642 Ga0075370_10032915
643 Ga0075430_100025036
644 Ga0099795_10060414
645 Ga0105240_10005805
646 Ga0105243_10236575
647 Ga0105248_10090724
648 Ga0105248_10455609
649 Ga0105238_10487020
650 Ga0105249_10437102
651 Ga0157373_10010065
652 Ga0157373_10035961
653 Ga0157373_10371965
654 Ga0157371_10015102
655 Ga0157371_10206341
656 Ga0157370_10132550
657 Ga0157370_10191758
658 Ga0157369_10039449
659 Ga0157369_10215652
660 Ga0157369_10268268
661 Ga0157378_10205061
662 Ga0163162_10017647
663 Ga0157372_10008404
664 Ga0157372_10496750
665 Ga0157375_10019912
666 Ga0157380_10636938
667 Ga0163161_10001079
668 Ga0213872_10035496
669 Ga0213872_10123305
670 Ga0213874_10023105
671 Ga0213871_10012287
672 Ga0207682_10000811
673 Ga0207682_10066792
674 Ga0207688_10011779
675 Ga0207688_10144280
676 Ga0207688_10166728
677 Ga0207680_10029044
678 Ga0207645_10039495
679 Ga0207645_10101587
680 Ga0207705_10002175
681 Ga0207705_10054176
682 Ga0207705_10060589
683 Ga0207705_10120965
684 Ga0207705_10208363
685 Ga0207705_10321939
686 Ga0207684_10490662
687 Ga0207707_10002628
688 Ga0207707_10209515
689 Ga0207695_10035031
690 Ga0207660_10000024
691 Ga0207660_10012452
692 Ga0207660_10042978
693 Ga0207657_10010583
694 Ga0207657_10028259
695 Ga0207657_10205397
696 Ga0207657_10362182
697 Ga0207649_10016551
698 Ga0207652_10009519
699 Ga0207652_10034069
700 Ga0207652_10134646
701 Ga0207652_10272925
702 Ga0207646_10338204
703 Ga0207681_10003745
704 Ga0207681_10008452
705 Ga0207681_10267665
706 Ga0207681_10505472
707 Ga0207650_10009357
708 Ga0207650_10009710
709 Ga0207659_10000784
710 Ga0207659_10001878
711 Ga0207659_10108724
712 Ga0207664_10096734
713 Ga0207664_10226688
714 Ga0207644_10008627
715 Ga0207644_10037317
716 Ga0207644_10038026
717 Ga0207690_10001369
718 Ga0207690_10204145
719 Ga0207690_10220231
720 Ga0207706_10005197
721 Ga0207706_10007849
722 Ga0207706_10010255
723 Ga0207706_10010795
724 Ga0207706_10091080
725 Ga0207706_10146766
726 Ga0207706_10682037
727 Ga0207709_10156087
728 Ga0207670_10128316
729 Ga0207669_10100982
730 Ga0207669_10361333
731 Ga0207669_10398019
732 Ga0207704_10029446
733 Ga0207691_10027087
734 Ga0207691_10277329
735 Ga0207711_10000413
736 Ga0207711_10354246
737 Ga0207661_10240234
738 Ga0207679_10003801
739 Ga0207679_10117363
740 Ga0207679_10266707
741 Ga0207667_10083816
742 Ga0207667_10165781
743 Ga0207667_10206854
744 Ga0207667_10290595
745 Ga0207667_10329437
746 Ga0207667_10499580
747 Ga0207651_10000602
748 Ga0207668_10020817
749 Ga0207668_10106690
750 Ga0207668_10495996
751 Ga0207640_10004054
752 Ga0207640_10251998
753 Ga0207658_10006732
754 Ga0207658_10012610
755 Ga0207658_10360947
756 Ga0207658_10468747
757 Ga0207677_10190526
758 Ga0207703_10538636
759 Ga0207639_10030482
760 Ga0207639_10365127
761 Ga0207678_10008649
762 Ga0207678_10093787
763 Ga0207641_10031476
764 Ga0207641_10070414
765 Ga0207648_10098209
766 Ga0207674_10013085
767 Ga0207674_10022169
768 Ga0207674_10228457
769 Ga0207675_100011776
770 Ga0207675_100677437
771 Ga0207683_10113936
772 Ga0207683_10605030
773 Ga0207698_10002051
774 Ga0207698_10017488
775 Ga0207698_10048995
776 Ga0207698_10054127
777 Ga0207698_10118821
778 Ga0207698_10184958
779 Ga0207698_10364240
780 Ga0207698_10369855
781 Ga0268266_10006479
782 Ga0268266_10007034
783 Ga0268266_10014582
784 Ga0268266_10039548
785 Ga0268265_10115265
786 Ga0268265_10371380
787 Ga0268264_10373683
788 Ga0265334_10007446
789 Ga0265330_10017312
790 Ga0265330_10060600
791 Ga0265332_10052759
792 Ga0265328_10000009
793 Ga0265328_10007208
794 Ga0265328_10008864
795 Ga0265328_10064821
796 Ga0265325_10037382
797 Ga0265340_10039678
798 Ga0265340_10049730
799 Ga0265331_10010626
800 Ga0265327_10000620
801 Ga0265327_10036530
802 Ga0265327_10068556
803 Ga0265316_10037966
804 Ga0307513_10511685
805 Ga0307408_100129318
806 Ga0307408_100188998
807 Ga0307408_100209248
808 Ga0307408_100247358
809 Ga0307408_100289596
810 Ga0265314_10026807
811 Ga0307405_10016238
812 Ga0307405_10158212
813 Ga0307405_10316959
814 Ga0307405_10538113
815 Ga0307405_10585166
816 Ga0307405_10737351
817 Ga0307413_10002347
818 Ga0307413_10009080
819 Ga0307413_10016879
820 Ga0307413_10088005
821 Ga0307413_10095257
822 Ga0307413_10102260
823 Ga0307413_10252809
824 Ga0307413_10514411
825 Ga0307413_10547789
826 Ga0307410_10001153
827 Ga0307410_10002542
828 Ga0307410_10016264
829 Ga0307410_10025301
830 Ga0307410_10053248
831 Ga0307410_10056667
832 Ga0307410_10060037
833 Ga0307410_10104741
834 Ga0307410_10132546
835 Ga0307410_10254311
836 Ga0307410_10264242
837 Ga0307410_10279730
838 Ga0307410_10428401
839 Ga0307406_10041386
840 Ga0307406_10180241
841 Ga0307406_10261895
842 Ga0307406_10315581
843 Ga0307407_10016972
844 Ga0307407_10019563
845 Ga0307407_10037455
846 Ga0307407_10066119
847 Ga0307407_10157238
848 Ga0307407_10290973
849 Ga0307412_10059803
850 Ga0307412_10077460
851 Ga0307412_10263314
852 Ga0307412_10290037
853 Ga0307409_100012103
854 Ga0307409_100026052
855 Ga0307409_100030321
856 Ga0307409_100059587
857 Ga0307409_100089791
858 Ga0307409_100106243
859 Ga0307409_100119099
860 Ga0307409_100144236
861 Ga0307409_100387697
862 Ga0307409_100404061
863 Ga0307416_100053804
864 Ga0307416_100061015
865 Ga0307416_100079205
866 Ga0307416_100299039
867 Ga0307416_100425612
868 Ga0307416_100533146
869 Ga0307414_10011892
870 Ga0307414_10011948
871 Ga0307414_10038644
872 Ga0307414_10252475
873 Ga0307414_10303873
874 Ga0307414_10500725
875 Ga0307414_10501078
876 Ga0307414_10964977
877 Ga0307411_10017405
878 Ga0307411_10025650
879 Ga0307411_10056348
880 Ga0307411_10133242
881 Ga0307411_10136887
882 Ga0307411_10138255
883 Ga0307411_10207093
884 Ga0307411_10209981
885 Ga0307411_10284121
886 Ga0307415_100000171
887 Ga0307415_100015026
888 Ga0307415_100351252
889 Ga0307415_100394447
890 Ga0307415_100555504
891 Ga0307415_100627332
892 Ga0373947_0077364
893 Ga0395899_0022786
894 Ga0395899_0069434
895 Ga0395899_0095855
896 Ga0395900_0014278
897 Ga0395900_0031660
898 Ga0395900_0147497
899 Ga0395900_0912149
900 Ga0395898_0025316
901 Ga0395898_0050476
902 Ga0395898_0118576
903 Ga0395905_0024772
904 Ga0395905_0148033
905 Ga0395905_0271654
906 Ga0395905_0368365
907 Ga0395901_0025966
908 Ga0395901_0341257
909 Ga0395901_0693450
910 Ga0395901_0906229
911 Ga0436360_0025123
912 Ga0436360_0150887
913 Ga0436360_0267241
914 Ga0436360_0332766
915 Ga0436360_0413189
916 Ga0436360_0794856
917 Ga0436360_0871595
918 Ga0436361_0014516
919 Ga0436361_0216612
920 Ga0436361_0473707
921 Ga0436361_0496876
922 Ga0436361_0993467
923 Ga0436361_1122970
924 Ga0436362_0083198
925 Ga0436362_0636059
926 Ga0439448_0038811
927 Ga0439432_022786
928 Ga0439449_0064784
929 Ga0466963_0008324
930 Ga0466963_0059240
931 Ga0466963_0078434
932 Ga0466963_0091409
933 Ga0466963_0173975
934 Ga0466957_0000746
935 Ga0466957_0055131
936 Ga0466959_0023769
937 Ga0466958_0000875
938 Ga0466958_0013259
939 Ga0466958_0344655
940 Ga0466958_0511483
941 Ga0466967_0002184
942 Ga0466967_0132392
943 Ga0495585_0010968
944 Ga0495644_0133240
945 Ga0495598_0003434
946 Ga0495621_0003738
947 Ga0495633_0007853
948 Ga0495669_0001697
949 Ga0495669_0002754
950 Ga0495670_0017811
951 Ga0495677_0002932
952 Ga0495681_0114508
953 Ga0496109_0657536
954 Ga0496112_0319575
955 Ga0496126_0084408
956 Ga0501037_0061349
957 Ga0501038_0000010
958 Ga0501046_0227785
959 Ga0501047_0169094
960 Ga0501074_0475453
961 Ga0501045_0430974
962 nmdc:mga03683_19023_c1
963 nmdc:mga03683_30944_c1
964 nmdc:mga03683_615_c1
965 nmdc:mga03683_9034_c1
966 nmdc:mga03n38_103304_c1
967 nmdc:mga03n38_47501_c1
968 nmdc:mga00v17_234070_c1
969 nmdc:mga0yw44_114741_c1
970 nmdc:mga0yw44_120298_c1
971 nmdc:mga0yw44_91238_c1
972 nmdc:mga0k408_68227_c1
973 nmdc:mga06z11_11683_c1
974 nmdc:mga06z11_142598_c1
975 nmdc:mga06z11_382032_c1
976 nmdc:mga06z11_74040_c1
977 nmdc:mga06z11_78351_c1
978 nmdc:mga04h51_44173_c1
979 nmdc:mga07m45_28642_c1
980 nmdc:mga07m45_29359_c1
981 nmdc:mga0sz30_113_c1
982 nmdc:mga0sz30_5851_c1
983 nmdc:mga0sz30_99426_c1
984 Ga0500641_0001680
985 Ga0500642_0014255
986 Ga0500616_0009758
987 Ga0500620_122242
988 Ga0500552_000299
989 2891089694
990 8002062983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01863

YgjP-like

YgjP-like, metallopeptidase domain

44

252

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7935 105 205
5ln5-assembly1.cif.gz_A crystal structure of the wss1 e203q mutant from s. pombe 0.773 101 185
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7608 105 205
6elu-assembly1.cif.gz_A structure of serum resistance associated protein from t. b. rhodesiense 0.7524 152 185
5jig-assembly1.cif.gz_A crytsal structure of wss1 from s. pombe 0.7442 101 185
ID Description Score Start End Superfamily
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7935 105 205 3.30.2010.10
af_P42597_68_160_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7835 123 196 3.30.2010.10
af_Q5AEH7_26_215_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7784 95 185 3.40.390.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7608 105 205 3.30.2010.10
af_A0A1D6LI78_20_121_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7379 101 173 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A357LDI9-F1-model_v4 M48 family peptidase 0.9761 83 202
AF-A0A3C0TTA3-F1-model_v4 M48 family peptidase 0.9738 74 204
AF-A0A6G7YPP7-F1-model_v4 M48 family metallopeptidase 0.9734 2 205
AF-A0A4D7C5H6-F1-model_v4 M48 family metallopeptidase 0.9718 48 207
AF-A0A7H0G757-F1-model_v4 deleted 0.97 81 200

Map