F454786

General Info

Members Datasets Scaffolds Average Seq Length
495 250 445 202

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0114396|Ga0501034_0114396_711_1385
Length 224
Sequence VPTCHLPYKSTRINQEITMNAIDTHLADRPFIVGIGGTTRPGSSTESALRTALQYAEDLGAETQLFGGEALSTLDVFSPEVRERSPAQRAIVDAVRRADAVIFASPGYHGGVSGLVKNAIDLLEDLRADERVYLDGMPVGCIVTAAGWQGCNTTLGAMRSIVHALRGWPTPLGVTLNTAGVKLFDAQGQCLDAQVAASLKVLAEQVVNPASVFSRGNKKSELLL

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
3 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
4 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
5 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
6 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
7 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
8 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
9 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
10 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
11 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
12 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
13 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
14 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
15 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
16 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
17 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
18 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
19 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
20 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
21 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
22 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
23 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
24 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
25 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
26 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
27 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
28 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
29 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
30 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
31 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
32 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
33 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
34 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
35 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
36 2643221556 Massilia sp. Root1485 Isolate Unclassified
37 2643221684 Massilia sp. Root133 Isolate Unclassified
38 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
39 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
40 2738541280 Massilia sp. GV090 Isolate Unclassified
41 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
42 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
43 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
44 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
45 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
46 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
47 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
48 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
49 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
50 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
57 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
129 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
245 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
246 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.7
Metatranscriptomes 0
Isolates 10.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 4.44
Nodule 0.4
Rhizoplane 9.7
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 12.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000005 3300003215 Bacteria 492839
2 rootH1_10081268 3300003316 Bacteria 1977
3 rootH1_10085143 3300003316 Bacteria 6840
4 rootH1_10085143 3300003323 Bacteria 2404
5 rootH2_10049627 3300003320 Bacteria 2919
6 rootL2_10070594 3300003322 Bacteria 3410
7 rootL2_10092277 3300003322 Bacteria 6260
8 rootH1_10336900 3300003323 Bacteria 1082
9 Ga0055526_1000028 3300003771 Bacteria 150301
10 Ga0058692_1012941 3300003856 Bacteria 1959
11 Ga0065165_1021464 3300005262 Bacteria 2243
12 Ga0065714_10064925 3300005288 Bacteria 15362
13 Ga0070658_10176175 3300005327 Bacteria 1798
14 Ga0070658_10180636 3300005327 Bacteria 1775
15 Ga0070658_10223758 3300005327 Bacteria 1592
16 Ga0070658_10633234 3300005327 Bacteria 928
17 Ga0070676_10000540 3300005328 Bacteria 18295
18 Ga0068869_100000212 3300005334 Bacteria 30223
19 Ga0068868_100000228 3300005338 Bacteria 38192
20 Ga0070660_100012204 3300005339 Bacteria 6134
21 Ga0070661_100075568 3300005344 Bacteria 2482
22 Ga0070661_100077281 3300005344 Bacteria 2454
23 Ga0070675_100068206 3300005354 Bacteria 2945
24 Ga0070675_100679178 3300005354 Bacteria 937
25 Ga0070674_100000131 3300005356 Bacteria 34327
26 Ga0070673_100000011 3300005364 Bacteria 145332
27 Ga0070673_100115076 3300005364 Bacteria 2236
28 Ga0070673_100503247 3300005364 Bacteria 1096
29 Ga0070659_100017673 3300005366 Bacteria 5371
30 Ga0070678_100000005 3300005456 Bacteria 70019
31 Ga0068867_100000049 3300005459 Bacteria 72604
32 Ga0068867_100094571 3300005459 Bacteria 2273
33 Ga0070672_100034259 3300005543 Bacteria 3853
34 Ga0068855_100008922 3300005563 Bacteria 12121
35 Ga0070664_100871380 3300005564 Bacteria 843
36 Ga0068857_100008750 3300005577 Bacteria 8767
37 Ga0068854_100215119 3300005578 Bacteria 1518
38 Ga0068852_100159432 3300005616 Bacteria 2105
39 Ga0068858_100000310 3300005842 Bacteria 51909
40 Ga0081539_10205639 3300005985 Unclassified 906
41 Ga0075368_10000045 3300006042 Bacteria 29195
42 Ga0075363_100004927 3300006048 Bacteria 5903
43 Ga0075367_10000202 3300006178 Bacteria 19823
44 Ga0097621_100039630 3300006237 Bacteria 3785
45 Ga0075370_10017933 3300006353 Bacteria 3832
46 Ga0075430_100138349 3300006846 Bacteria 2028
47 Ga0068865_100000012 3300006881 Bacteria 145314
48 Ga0079104_1018694 3300006946 Bacteria 1956
49 Ga0105244_10074204 3300009036 Bacteria 1692
50 Ga0105240_10001767 3300009093 Bacteria 36501
51 Ga0105245_10000097 3300009098 Bacteria 84528
52 Ga0105245_10001089 3300009098 Bacteria 24632
53 Ga0105243_10000030 3300009148 Bacteria 190342
54 Ga0105243_10000297 3300009148 Bacteria 55019
55 Ga0105241_10152097 3300009174 Bacteria 1894
56 Ga0105242_10000645 3300009176 Bacteria 27285
57 Ga0105238_10476320 3300009551 Bacteria 1247
58 Ga0105239_10001135 3300010375 Bacteria 36722
59 Ga0105239_10795650 3300010375 Bacteria 1083
60 Ga0105246_10000776 3300011119 Bacteria 18109
61 Ga0157374_10000132 3300013296 Bacteria 68144
62 Ga0157378_10003091 3300013297 Bacteria 14800
63 Ga0157378_10391510 3300013297 Bacteria 1367
64 Ga0157375_10000294 3300013308 Bacteria 45311
65 Ga0157375_10913196 3300013308 Bacteria 1021
66 Ga0157376_10000198 3300014969 Bacteria 41983
67 Ga0182006_1000054 3300015261 Bacteria 174021
68 Ga0182005_1000012 3300015265 Bacteria 396944
69 Ga0163161_10000855 3300017792 Bacteria 23757
70 Ga0213872_10002557 3300021361 Bacteria 10597
71 Ga0209564_1000011 3300025295 Bacteria 822327
72 Ga0209758_1000001 3300025297 Bacteria 1981790
73 Ga0207645_10001624 3300025907 Bacteria 18349
74 Ga0207705_10002643 3300025909 Bacteria 13729
75 Ga0207705_10852468 3300025909 Unclassified 706
76 Ga0207654_10107306 3300025911 Bacteria 1731
77 Ga0207695_10001621 3300025913 Bacteria 36491
78 Ga0207657_10011709 3300025919 Bacteria 8691
79 Ga0207649_10062193 3300025920 Bacteria 2353
80 Ga0207694_10014794 3300025924 Bacteria 5883
81 Ga0207687_10000547 3300025927 Bacteria 25260
82 Ga0207687_10015430 3300025927 Bacteria 5010
83 Ga0207687_10614068 3300025927 Bacteria 917
84 Ga0207686_10000148 3300025934 Bacteria 53751
85 Ga0207709_10000137 3300025935 Bacteria 106203
86 Ga0207709_10000299 3300025935 Bacteria 54506
87 Ga0207669_10000031 3300025937 Bacteria 85825
88 Ga0207704_10000021 3300025938 Bacteria 148508
89 Ga0207689_10000132 3300025942 Bacteria 63321
90 Ga0207667_10001769 3300025949 Bacteria 27197
91 Ga0207651_10000012 3300025960 Bacteria 189928
92 Ga0207677_10000058 3300026023 Bacteria 95751
93 Ga0207678_10223970 3300026067 Bacteria 1610
94 Ga0207648_10000051 3300026089 Bacteria 108363
95 Ga0207648_10012162 3300026089 Bacteria 8063
96 Ga0207648_10228713 3300026089 Bacteria 1654
97 Ga0207674_10014284 3300026116 Bacteria 8775
98 Ga0207683_10000115 3300026121 Bacteria 65630
99 Ga0207698_10120048 3300026142 Bacteria 2223
100 Ga0207698_10516275 3300026142 Bacteria 1165
101 Ga0209281_1002444 3300027111 Bacteria 7450
102 Ga0209371_1000477 3300027312 Bacteria 39251
103 Ga0209983_1008049 3300027665 Bacteria 2155
104 Ga0209813_10000162 3300027866 Bacteria 22312
105 Ga0268256_1000405 3300030500 Bacteria 39251
106 Ga0307513_10001351 3300031456 Bacteria 35442
107 Ga0307408_100394450 3300031548 Bacteria 1187
108 Ga0307412_10013665 3300031911 Bacteria 4769
109 Ga0307411_10169268 3300032005 Bacteria 1646
110 Ga0395899_0201737 3300037312 Bacteria 1386
111 Ga0395899_0274307 3300037312 Bacteria 1149
112 Ga0395900_0010806 3300037418 Bacteria 9338
113 Ga0395900_0052186 3300037418 Bacteria 4209
114 Ga0395900_0061753 3300037418 Bacteria 3852
115 Ga0395900_0159267 3300037418 Bacteria 2303
116 Ga0395900_0171951 3300037418 Bacteria 2205
117 Ga0395900_0775382 3300037418 Bacteria 888
118 Ga0395898_0083933 3300037466 Bacteria 3070
119 Ga0395898_0523845 3300037466 Bacteria 1127
120 Ga0395905_0002220 3300037471 Bacteria 21904
121 Ga0395905_0005531 3300037471 Bacteria 12892
122 Ga0395905_0047819 3300037471 Bacteria 4008
123 Ga0395901_0107440 3300038443 Bacteria 2929
124 Ga0395901_0228186 3300038443 Bacteria 1945
125 Ga0395901_0231141 3300038443 Bacteria 1930
126 Ga0395901_0739702 3300038443 Bacteria 977
127 Ga0436361_0210459 3300039447 Unclassified 1893
128 Ga0436361_0266932 3300039447 Bacteria 57257
129 Ga0436361_0794096 3300039447 Bacteria 3481
130 Ga0436361_0871491 3300039447 Bacteria 4259
131 Ga0451807_0373153 3300041486 Bacteria 880
132 Ga0439458_0020592 3300042157 Bacteria 1524
133 Ga0466965_0021578 3300044683 Bacteria 3101
134 Ga0466966_0028949 3300044684 Bacteria 3606
135 Ga0466966_0209701 3300044684 Bacteria 1177
136 Ga0466961_0046353 3300044693 Bacteria 2781
137 Ga0466963_0022427 3300044694 Bacteria 3999
138 Ga0466963_0156491 3300044694 Bacteria 1585
139 Ga0466964_0008719 3300044706 Bacteria 3813
140 Ga0466971_0027551 3300044719 Bacteria 2545
141 Ga0466971_0095241 3300044719 Bacteria 1365
142 Ga0466957_0000010 3300044842 Bacteria 75391
143 Ga0466960_0193935 3300044901 Bacteria 1107
144 Ga0466959_0144617 3300045049 Bacteria 1678
145 Ga0466959_0228828 3300045049 Bacteria 1287
146 Ga0466967_0019602 3300045976 Bacteria 5445
147 Ga0466967_0417871 3300045976 Bacteria 1307
148 Ga0495617_000300 3300046452 Bacteria 28024
149 Ga0495627_000001 3300046453 Bacteria 1104709
150 Ga0495627_000078 3300046453 Bacteria 119920
151 Ga0495627_000125 3300046453 Bacteria 93485
152 Ga0495627_054672 3300046453 Unclassified 1193
153 Ga0495590_0000782 3300046457 Bacteria 14460
154 Ga0495590_0010971 3300046457 Bacteria 3396
155 Ga0495590_0076821 3300046457 Bacteria 1175
156 Ga0495591_002605 3300046458 Bacteria 9903
157 Ga0495638_0038540 3300046460 Bacteria 3036
158 Ga0495638_0109909 3300046460 Bacteria 1638
159 Ga0495653_0009293 3300046463 Bacteria 8044
160 Ga0495653_0088147 3300046463 Bacteria 2277
161 Ga0495650_0000184 3300046471 Bacteria 136939
162 Ga0495650_0000764 3300046471 Bacteria 39812
163 Ga0495650_0000815 3300046471 Bacteria 37931
164 Ga0495650_0001172 3300046471 Bacteria 28022
165 Ga0495650_0008064 3300046471 Bacteria 6219
166 Ga0495605_0000056 3300046474 Bacteria 155610
167 Ga0495605_0005950 3300046474 Bacteria 7055
168 Ga0495605_0010768 3300046474 Bacteria 5110
169 Ga0495605_0048855 3300046474 Bacteria 2069
170 Ga0495605_0242416 3300046474 Bacteria 773
171 Ga0495584_0000045 3300046491 Bacteria 89514
172 Ga0495584_0000639 3300046491 Bacteria 23311
173 Ga0495584_0003729 3300046491 Bacteria 8307
174 Ga0495584_0004173 3300046491 Bacteria 7799
175 Ga0495584_0005831 3300046491 Bacteria 6488
176 Ga0495584_0039763 3300046491 Bacteria 2376
177 Ga0495584_0078694 3300046491 Bacteria 1659
178 Ga0495585_0005625 3300046492 Bacteria 7870
179 Ga0495585_0071598 3300046492 Bacteria 1889
180 Ga0495594_0112777 3300046499 Bacteria 1533
181 Ga0495596_0000059 3300046500 Bacteria 80270
182 Ga0495596_0003287 3300046500 Bacteria 8251
183 Ga0495596_0004533 3300046500 Bacteria 6751
184 Ga0495596_0006057 3300046500 Bacteria 5635
185 Ga0495607_0000165 3300046501 Bacteria 70372
186 Ga0495607_0000324 3300046501 Bacteria 49450
187 Ga0495607_0003774 3300046501 Bacteria 11455
188 Ga0495607_0009436 3300046501 Bacteria 6607
189 Ga0495583_0000001 3300046506 Bacteria 811973
190 Ga0495583_0000011 3300046506 Bacteria 350215
191 Ga0495583_0000410 3300046506 Bacteria 65130
192 Ga0495583_0006398 3300046506 Bacteria 7709
193 Ga0495583_0011628 3300046506 Bacteria 5043
194 Ga0495606_0000062 3300046507 Bacteria 184841
195 Ga0495606_0001284 3300046507 Bacteria 34796
196 Ga0495606_0002490 3300046507 Bacteria 21296
197 Ga0495606_0003346 3300046507 Bacteria 17100
198 Ga0495606_0088633 3300046507 Bacteria 1907
199 Ga0495606_0104001 3300046507 Bacteria 1724
200 Ga0495606_0164060 3300046507 Bacteria 1294
201 Ga0495610_0000019 3300046512 Bacteria 351524
202 Ga0495610_0002251 3300046512 Bacteria 16320
203 Ga0495610_0005762 3300046512 Bacteria 8718
204 Ga0495616_0000034 3300046513 Bacteria 129394
205 Ga0495616_0002342 3300046513 Bacteria 12633
206 Ga0495616_0006972 3300046513 Bacteria 6803
207 Ga0495616_0012010 3300046513 Bacteria 4932
208 Ga0495616_0012309 3300046513 Bacteria 4859
209 Ga0495616_0015995 3300046513 Bacteria 4159
210 Ga0495616_0084573 3300046513 Bacteria 1512
211 Ga0495616_0098897 3300046513 Bacteria 1370
212 Ga0495620_0000633 3300046515 Bacteria 21895
213 Ga0495631_0003881 3300046518 Bacteria 8083
214 Ga0495631_0005146 3300046518 Bacteria 6893
215 Ga0495631_0007482 3300046518 Bacteria 5552
216 Ga0495631_0020009 3300046518 Bacteria 3132
217 Ga0495631_0104938 3300046518 Bacteria 1216
218 Ga0495632_0000001 3300046519 Bacteria 873295
219 Ga0495632_0000168 3300046519 Bacteria 67340
220 Ga0495632_0000636 3300046519 Bacteria 32294
221 Ga0495632_0001007 3300046519 Bacteria 24440
222 Ga0495632_0007911 3300046519 Bacteria 6609
223 Ga0495632_0012706 3300046519 Bacteria 4840
224 Ga0495632_0199582 3300046519 Bacteria 911
225 Ga0495637_0000412 3300046520 Bacteria 31651
226 Ga0495637_0000850 3300046520 Bacteria 20082
227 Ga0495643_0000020 3300046522 Bacteria 294973
228 Ga0495643_0000361 3300046522 Bacteria 61853
229 Ga0495643_0006851 3300046522 Bacteria 7427
230 Ga0495643_0014913 3300046522 Bacteria 4609
231 Ga0495643_0020207 3300046522 Bacteria 3844
232 Ga0495643_0020998 3300046522 Bacteria 3754
233 Ga0495643_0085939 3300046522 Bacteria 1630
234 Ga0495643_0167564 3300046522 Bacteria 1076
235 Ga0495644_0006314 3300046523 Bacteria 4603
236 Ga0495644_0009545 3300046523 Bacteria 3740
237 Ga0495648_0000300 3300046524 Bacteria 54935
238 Ga0495648_0001274 3300046524 Bacteria 25136
239 Ga0495648_0005102 3300046524 Bacteria 11016
240 Ga0495648_0008850 3300046524 Bacteria 7876
241 Ga0495648_0046958 3300046524 Bacteria 2673
242 Ga0495663_0000002 3300046525 Bacteria 495384
243 Ga0495666_0151144 3300046526 Bacteria 1079
244 Ga0495642_0000061 3300046528 Bacteria 65572
245 Ga0495642_0001122 3300046528 Bacteria 12332
246 Ga0495642_0026790 3300046528 Bacteria 2291
247 Ga0495642_0060524 3300046528 Bacteria 1570
248 Ga0495652_0040928 3300046529 Bacteria 4003
249 Ga0495654_0000706 3300046530 Bacteria 26213
250 Ga0495654_0016984 3300046530 Bacteria 3832
251 Ga0495586_0104531 3300046535 Bacteria 1574
252 Ga0495586_0182737 3300046535 Bacteria 1186
253 Ga0495587_0017735 3300046536 Bacteria 4419
254 Ga0495587_0046383 3300046536 Bacteria 2580
255 Ga0495609_0045725 3300046538 Bacteria 1961
256 Ga0495597_0000919 3300046542 Bacteria 22835
257 Ga0495597_0001459 3300046542 Bacteria 16935
258 Ga0495597_0001644 3300046542 Bacteria 15611
259 Ga0495597_0013358 3300046542 Bacteria 3935
260 Ga0495645_0084624 3300046543 Bacteria 2271
261 Ga0495622_0000006 3300046557 Bacteria 245799
262 Ga0495633_0000312 3300046558 Bacteria 55371
263 Ga0495633_0000413 3300046558 Bacteria 44456
264 Ga0495633_0004923 3300046558 Bacteria 8343
265 Ga0495633_0011869 3300046558 Bacteria 4667
266 Ga0495633_0027138 3300046558 Bacteria 2802
267 Ga0495633_0195564 3300046558 Bacteria 929
268 Ga0495656_0003729 3300046615 Bacteria 5173
269 Ga0495656_0024674 3300046615 Bacteria 2377
270 Ga0495656_0050280 3300046615 Bacteria 1779
271 Ga0495656_0098811 3300046615 Bacteria 1346
272 Ga0495668_0000018 3300046616 Bacteria 417480
273 Ga0495668_0000091 3300046616 Bacteria 144428
274 Ga0495668_0002360 3300046616 Bacteria 15707
275 Ga0495668_0012037 3300046616 Bacteria 5149
276 Ga0495668_0035036 3300046616 Bacteria 2813
277 Ga0495668_0066134 3300046616 Bacteria 1989
278 Ga0495634_0016601 3300046642 Bacteria 5262
279 Ga0495611_0000506 3300046648 Bacteria 23099
280 Ga0495611_0042052 3300046648 Bacteria 2040
281 Ga0495625_0000320 3300046660 Bacteria 73013
282 Ga0495625_0007836 3300046660 Bacteria 9204
283 Ga0495625_0071886 3300046660 Bacteria 2427
284 Ga0495625_0074686 3300046660 Bacteria 2374
285 Ga0495625_0092452 3300046660 Bacteria 2090
286 Ga0495661_0000109 3300046665 Bacteria 97921
287 Ga0495661_0001619 3300046665 Bacteria 18447
288 Ga0495661_0002611 3300046665 Bacteria 13813
289 Ga0495661_0008495 3300046665 Bacteria 7102
290 Ga0495661_0024572 3300046665 Bacteria 3901
291 Ga0495661_0038797 3300046665 Bacteria 2964
292 Ga0495661_0051911 3300046665 Bacteria 2473
293 Ga0495661_0072681 3300046665 Bacteria 2006
294 Ga0495588_0000098 3300046674 Bacteria 166999
295 Ga0495588_0028410 3300046674 Bacteria 2799
296 Ga0495588_0192189 3300046674 Bacteria 1078
297 Ga0495669_0000498 3300046684 Bacteria 18031
298 Ga0495669_0006141 3300046684 Bacteria 5010
299 Ga0495669_0008931 3300046684 Bacteria 4221
300 Ga0495669_0391494 3300046684 Bacteria 673
301 Ga0495670_0001168 3300046691 Bacteria 12753
302 Ga0495670_0195818 3300046691 Bacteria 1069
303 Ga0495670_0245743 3300046691 Unclassified 953
304 Ga0495671_0000016 3300046692 Bacteria 294821
305 Ga0495671_0000159 3300046692 Bacteria 59318
306 Ga0495671_0002797 3300046692 Bacteria 10915
307 Ga0495671_0073193 3300046692 Bacteria 1682
308 Ga0495649_0000067 3300046694 Bacteria 92384
309 Ga0495649_0001755 3300046694 Bacteria 15985
310 Ga0495649_0075186 3300046694 Bacteria 1809
311 Ga0495649_0086486 3300046694 Bacteria 1673
312 Ga0495649_0184257 3300046694 Bacteria 1088
313 Ga0495649_0377273 3300046694 Bacteria 714
314 Ga0495589_0000045 3300046794 Bacteria 123922
315 Ga0495589_0000054 3300046794 Bacteria 111355
316 Ga0495589_0034347 3300046794 Bacteria 2546
317 Ga0495589_0039793 3300046794 Bacteria 2349
318 Ga0495589_0121517 3300046794 Bacteria 1257
319 Ga0495660_0000055 3300046810 Bacteria 134615
320 Ga0495660_0007613 3300046810 Bacteria 6360
321 Ga0495660_0027531 3300046810 Bacteria 3216
322 Ga0495581_0296772 3300047315 Bacteria 945
323 Ga0495672_0000820 3300047320 Bacteria 33401
324 Ga0495672_0005768 3300047320 Bacteria 9739
325 Ga0495672_0101422 3300047320 Bacteria 1560
326 Ga0495680_0012680 3300047322 Bacteria 7401
327 Ga0495683_0001505 3300047323 Bacteria 15121
328 Ga0495683_0014111 3300047323 Bacteria 4163
329 Ga0495683_0070993 3300047323 Unclassified 1709
330 Ga0495683_0084316 3300047323 Bacteria 1546
331 Ga0495683_0087874 3300047323 Bacteria 1509
332 Ga0495687_000012 3300047443 Bacteria 391586
333 Ga0495687_000016 3300047443 Bacteria 359237
334 Ga0495687_000708 3300047443 Bacteria 37141
335 Ga0495687_000843 3300047443 Bacteria 32659
336 Ga0495687_001687 3300047443 Bacteria 19701
337 Ga0495687_037177 3300047443 Bacteria 2171
338 Ga0495675_0012498 3300047444 Bacteria 5344
339 Ga0495677_0000126 3300047445 Bacteria 37137
340 Ga0495677_0000309 3300047445 Bacteria 21155
341 Ga0495677_0001144 3300047445 Bacteria 10598
342 Ga0495679_004846 3300047446 Bacteria 6080
343 Ga0495673_0000263 3300047469 Bacteria 73113
344 Ga0495673_0000841 3300047469 Bacteria 28516
345 Ga0495673_0015856 3300047469 Bacteria 3869
346 Ga0495681_0000063 3300047470 Bacteria 99734
347 Ga0495681_0000208 3300047470 Bacteria 48683
348 Ga0495681_0000802 3300047470 Bacteria 24208
349 Ga0495681_0002840 3300047470 Bacteria 12239
350 Ga0495681_0030263 3300047470 Unclassified 2759
351 Ga0495681_0042281 3300047470 Bacteria 2207
352 Ga0495681_0049687 3300047470 Bacteria 1981
353 Ga0495681_0084934 3300047470 Bacteria 1406
354 Ga0495681_0186731 3300047470 Bacteria 848
355 Ga0495686_0002090 3300047472 Bacteria 19631
356 Ga0495686_0003050 3300047472 Bacteria 14842
357 Ga0495686_0004833 3300047472 Bacteria 10878
358 Ga0495686_0009263 3300047472 Bacteria 7111
359 Ga0495686_0112418 3300047472 Bacteria 1632
360 Ga0495602_0003531 3300048088 Bacteria 16157
361 Ga0495615_0000010 3300048090 Bacteria 70447
362 Ga0495615_0001489 3300048090 Bacteria 3507
363 Ga0495615_0013682 3300048090 Bacteria 1699
364 Ga0495626_0000053 3300048091 Bacteria 155543
365 Ga0495626_0000526 3300048091 Bacteria 38270
366 Ga0495626_0000592 3300048091 Bacteria 35519
367 Ga0495626_0002095 3300048091 Bacteria 14508
368 Ga0495626_0003625 3300048091 Bacteria 9822
369 Ga0495626_0007702 3300048091 Bacteria 5967
370 Ga0495626_0008640 3300048091 Bacteria 5565
371 Ga0495626_0072451 3300048091 Bacteria 1545
372 Ga0495626_0080558 3300048091 Bacteria 1447
373 Ga0496101_0038135 3300048904 Bacteria 3412
374 Ga0496101_0538281 3300048904 Bacteria 923
375 Ga0496102_0009677 3300048905 Bacteria 8290
376 Ga0496102_0011657 3300048905 Bacteria 7587
377 Ga0496102_0172777 3300048905 Bacteria 2034
378 Ga0496102_0502911 3300048905 Bacteria 1134
379 Ga0496107_0581319 3300048910 Bacteria 829
380 Ga0496109_0006189 3300048912 Bacteria 10059
381 Ga0496112_0032981 3300048915 Bacteria 5030
382 Ga0496113_0009275 3300048916 Bacteria 6455
383 Ga0496113_0324180 3300048916 Bacteria 1235
384 Ga0496114_0055824 3300048917 Bacteria 3295
385 Ga0496116_0000093 3300048919 Bacteria 205660
386 Ga0496116_0114719 3300048919 Bacteria 1573
387 Ga0496117_0000117 3300048920 Bacteria 177596
388 Ga0496117_0031309 3300048920 Bacteria 4064
389 Ga0496117_0033516 3300048920 Bacteria 3882
390 Ga0496118_0000025 3300048921 Bacteria 379363
391 Ga0496118_0005210 3300048921 Bacteria 14872
392 Ga0496118_0018407 3300048921 Bacteria 6306
393 Ga0496119_0003770 3300048922 Bacteria 15511
394 Ga0496119_0033489 3300048922 Bacteria 3404
395 Ga0496120_0014459 3300048923 Bacteria 5259
396 Ga0496120_0032521 3300048923 Bacteria 3144
397 Ga0496121_0000226 3300048924 Bacteria 121831
398 Ga0496121_0047844 3300048924 Bacteria 3644
399 Ga0496121_0051601 3300048924 Bacteria 3462
400 Ga0496121_0121422 3300048924 Bacteria 1973
401 Ga0496122_0000572 3300048925 Bacteria 75443
402 Ga0496122_0000702 3300048925 Bacteria 66240
403 Ga0496122_0007295 3300048925 Bacteria 12349
404 Ga0496122_0037305 3300048925 Bacteria 3914
405 Ga0496123_0000584 3300048926 Bacteria 62207
406 Ga0496123_0000914 3300048926 Bacteria 46373
407 Ga0496123_0001331 3300048926 Bacteria 34894
408 Ga0496123_0004173 3300048926 Bacteria 15446
409 Ga0496123_0167474 3300048926 Unclassified 1163
410 Ga0496124_0000374 3300048927 Bacteria 81451
411 Ga0496124_0002349 3300048927 Bacteria 24977
412 Ga0496124_0003374 3300048927 Bacteria 19616
413 Ga0496124_0067972 3300048927 Bacteria 2963
414 Ga0496124_0079706 3300048927 Bacteria 2696
415 Ga0496124_0083416 3300048927 Bacteria 2622
416 Ga0496125_0000373 3300048928 Bacteria 84239
417 Ga0496125_0001849 3300048928 Bacteria 29183
418 Ga0496125_0003220 3300048928 Bacteria 20145
419 Ga0496125_0005926 3300048928 Bacteria 13391
420 Ga0496125_0032373 3300048928 Bacteria 4645
421 Ga0496125_0151495 3300048928 Bacteria 1592
422 Ga0496125_0328423 3300048928 Bacteria 923
423 Ga0496126_0002875 3300048929 Bacteria 22468
424 Ga0496126_0033033 3300048929 Bacteria 4870
425 Ga0496126_0191237 3300048929 Bacteria 1733
426 Ga0496126_0262239 3300048929 Bacteria 1436
427 Ga0495678_000061 3300049459 Bacteria 142649
428 Ga0495678_013375 3300049459 Bacteria 3856
429 Ga0495678_083656 3300049459 Unclassified 1140
430 Ga0495682_0000243 3300049460 Bacteria 43302
431 Ga0501034_0114396 3300049571 Bacteria 2687
432 nmdc:mga03n38_3425_c1 3300050490 Bacteria 5092
433 nmdc:mga06z11_8_c1 3300050494 Bacteria 115826
434 nmdc:mga04h51_8_c1 3300050495 Bacteria 107557
435 nmdc:mga07m45_18517_c1 3300050496 Bacteria 3761
436 nmdc:mga0qj67_128583_c1 3300050509 Bacteria 2050
437 Ga0500644_0000031 3300053088 Bacteria 86737
438 Ga0500651_0353748 3300053093 Bacteria 833
439 Ga0500618_000152 3300053125 Bacteria 57055
440 Ga0500618_000711 3300053125 Bacteria 19286
441 Ga0500618_143246 3300053125 Bacteria 544
442 Ga0500559_0000029 3300053136 Bacteria 117549
443 Ga0500559_0000091 3300053136 Bacteria 72157
444 Ga0500564_000370 3300053138 Bacteria 12769
445 Ga0466962_0190428 3300061719 Bacteria 1001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053125 Ga0500618_143246 Ga0500618_143246_10_519 168
2 3300046694 Ga0495649_0184257 Ga0495649_0184257_452_1048 178
3 3300047472 Ga0495686_0112418 Ga0495686_0112418_937_1488 181
4 iso_pu_bacteria 2524023250 2524612612 181
5 iso_pu_bacteria 2738541275 2738709485 181
6 iso_pu_bacteria 2738541301 2738847910 181
7 iso_pu_bacteria 2738541304 2738863639 181
8 iso_pu_bacteria 2738543022 2739296157 181
9 iso_pu_bacteria 2738543033 2739357835 181
10 iso_pu_bacteria 2928100450 2928102620 181
11 iso_pu_bacteria 2928959182 2928959293 181
12 3300048090 Ga0495615_0000010 Ga0495615_0000010_28007_28585 183
13 3300048925 Ga0496122_0037305 Ga0496122_0037305_2499_3077 183
14 3300048926 Ga0496123_0001331 Ga0496123_0001331_31855_32433 183
15 3300048927 Ga0496124_0067972 Ga0496124_0067972_369_947 183
16 iso_pu_bacteria 2751185897 2753763581 183
17 3300003771 Ga0055526_1000028 Ga0055526_100002829 184
18 3300005577 Ga0068857_100008750 Ga0068857_1000087504 184
19 3300006946 Ga0079104_1018694 Ga0079104_10186942 184
20 3300009036 Ga0105244_10074204 Ga0105244_100742042 184
21 3300015261 Ga0182006_1000054 Ga0182006_100005485 184
22 3300015265 Ga0182005_1000012 Ga0182005_1000012268 184
23 3300025295 Ga0209564_1000011 Ga0209564_1000011476 184
24 3300026116 Ga0207674_10014284 Ga0207674_100142845 184
25 3300027111 Ga0209281_1002444 Ga0209281_10024442 184
26 3300046453 Ga0495627_000001 Ga0495627_000001_15621_16226 184
27 3300046453 Ga0495627_000078 Ga0495627_000078_86458_87012 184
28 3300046460 Ga0495638_0038540 Ga0495638_0038540_752_1357 184
29 3300046471 Ga0495650_0000184 Ga0495650_0000184_36243_36848 184
30 3300046471 Ga0495650_0000815 Ga0495650_0000815_8468_9073 184
31 3300046507 Ga0495606_0000062 Ga0495606_0000062_92483_93088 184
32 3300046522 Ga0495643_0167564 Ga0495643_0167564_383_988 184
33 3300046524 Ga0495648_0005102 Ga0495648_0005102_3373_3927 184
34 3300046524 Ga0495648_0046958 Ga0495648_0046958_1827_2381 184
35 3300046557 Ga0495622_0000006 Ga0495622_0000006_82969_83586 184
36 3300046558 Ga0495633_0000312 Ga0495633_0000312_28667_29221 184
37 3300046558 Ga0495633_0011869 Ga0495633_0011869_894_1499 184
38 3300046558 Ga0495633_0027138 Ga0495633_0027138_651_1205 184
39 3300046615 Ga0495656_0024674 Ga0495656_0024674_1402_2007 184
40 3300046616 Ga0495668_0000018 Ga0495668_0000018_192448_193053 184
41 3300046616 Ga0495668_0000091 Ga0495668_0000091_115788_116393 184
42 3300046616 Ga0495668_0012037 Ga0495668_0012037_4415_5020 184
43 3300046660 Ga0495625_0000320 Ga0495625_0000320_38911_39516 184
44 3300047469 Ga0495673_0015856 Ga0495673_0015856_3278_3832 184
45 3300047470 Ga0495681_0002840 Ga0495681_0002840_1686_2291 184
46 3300047472 Ga0495686_0002090 Ga0495686_0002090_7978_8583 184
47 3300047472 Ga0495686_0004833 Ga0495686_0004833_4513_5118 184
48 3300048090 Ga0495615_0013682 Ga0495615_0013682_920_1525 184
49 3300048919 Ga0496116_0114719 Ga0496116_0114719_162_767 184
50 3300048927 Ga0496124_0079706 Ga0496124_0079706_1792_2397 184
51 3300048928 Ga0496125_0151495 Ga0496125_0151495_735_1340 184
52 3300049459 Ga0495678_013375 Ga0495678_013375_2320_2925 184
53 iso_pu_bacteria 2738541280 2738741323 184
54 iso_pu_bacteria 2818991438 2819555243 184
55 3300005327 Ga0070658_10223758 Ga0070658_102237582 185
56 3300009093 Ga0105240_10001767 Ga0105240_100017676 185
57 3300010375 Ga0105239_10001135 Ga0105239_100011356 185
58 3300025909 Ga0207705_10852468 Ga0207705_108524681 185
59 3300025913 Ga0207695_10001621 Ga0207695_1000162127 185
60 3300027665 Ga0209983_1008049 Ga0209983_10080492 185
61 3300046491 Ga0495584_0078694 Ga0495584_0078694_265_873 185
62 3300046506 Ga0495583_0000011 Ga0495583_0000011_227607_228215 185
63 3300046542 Ga0495597_0001644 Ga0495597_0001644_8734_9342 185
64 3300046692 Ga0495671_0000159 Ga0495671_0000159_14871_15479 185
65 3300047320 Ga0495672_0000820 Ga0495672_0000820_8898_9506 185
66 3300047443 Ga0495687_037177 Ga0495687_037177_872_1480 185
67 3300047469 Ga0495673_0000841 Ga0495673_0000841_1145_1714 185
68 3300048091 Ga0495626_0080558 Ga0495626_0080558_45_653 185
69 3300048920 Ga0496117_0031309 Ga0496117_0031309_907_1473 185
70 3300048920 Ga0496117_0033516 Ga0496117_0033516_2651_3208 185
71 3300048921 Ga0496118_0005210 Ga0496118_0005210_12097_12654 185
72 3300048921 Ga0496118_0018407 Ga0496118_0018407_4776_5342 185
73 3300048924 Ga0496121_0000226 Ga0496121_0000226_13549_14145 185
74 3300048925 Ga0496122_0000702 Ga0496122_0000702_42785_43351 185
75 3300048926 Ga0496123_0000914 Ga0496123_0000914_38974_39540 185
76 3300048927 Ga0496124_0003374 Ga0496124_0003374_4010_4576 185
77 3300048928 Ga0496125_0032373 Ga0496125_0032373_1152_1718 185
78 3300048929 Ga0496126_0002875 Ga0496126_0002875_6864_7430 185
79 3300053093 Ga0500651_0353748 Ga0500651_0353748_226_804 185
80 3300010375 Ga0105239_10795650 Ga0105239_107956502 186
81 3300041486 Ga0451807_0373153 Ga0451807_0373153_137_709 186
82 3300046524 Ga0495648_0000300 Ga0495648_0000300_24484_25059 186
83 3300046692 Ga0495671_0073193 Ga0495671_0073193_1031_1606 186
84 3300047469 Ga0495673_0000263 Ga0495673_0000263_24643_25218 186
85 3300048919 Ga0496116_0000093 Ga0496116_0000093_181725_182342 186
86 3300048925 Ga0496122_0007295 Ga0496122_0007295_2564_3133 186
87 3300048926 Ga0496123_0167474 Ga0496123_0167474_22_591 186
88 3300048927 Ga0496124_0000374 Ga0496124_0000374_12517_13086 186
89 3300048928 Ga0496125_0000373 Ga0496125_0000373_34497_35066 186
90 3300048929 Ga0496126_0191237 Ga0496126_0191237_977_1546 186
91 3300053088 Ga0500644_0000031 Ga0500644_0000031_78328_78903 186
92 3300053125 Ga0500618_000711 Ga0500618_000711_3501_4064 186
93 3300053136 Ga0500559_0000029 Ga0500559_0000029_100988_101557 186
94 3300053138 Ga0500564_000370 Ga0500564_000370_7338_7913 186
95 3300003316 rootH1_10085143 rootH1_100851432 187
96 3300003322 rootL2_10092277 rootL2_100922776 187
97 3300005344 Ga0070661_100077281 Ga0070661_1000772812 187
98 3300005616 Ga0068852_100159432 Ga0068852_1001594323 187
99 3300025920 Ga0207649_10062193 Ga0207649_100621932 187
100 3300026142 Ga0207698_10120048 Ga0207698_101200483 187
101 3300031911 Ga0307412_10013665 Ga0307412_100136654 187
102 3300046506 Ga0495583_0000001 Ga0495583_0000001_480509_481090 187
103 3300046694 Ga0495649_0377273 Ga0495649_0377273_55_660 187
104 3300048905 Ga0496102_0009677 Ga0496102_0009677_5711_6328 187
105 3300048910 Ga0496107_0581319 Ga0496107_0581319_129_737 187
106 3300048917 Ga0496114_0055824 Ga0496114_0055824_1477_2094 187
107 3300048920 Ga0496117_0000117 Ga0496117_0000117_101825_102442 187
108 3300048921 Ga0496118_0000025 Ga0496118_0000025_303830_304447 187
109 3300048922 Ga0496119_0003770 Ga0496119_0003770_3078_3695 187
110 3300048922 Ga0496119_0033489 Ga0496119_0033489_959_1576 187
111 3300048923 Ga0496120_0014459 Ga0496120_0014459_2775_3392 187
112 3300048923 Ga0496120_0032521 Ga0496120_0032521_2279_2896 187
113 3300048924 Ga0496121_0051601 Ga0496121_0051601_415_1032 187
114 3300048928 Ga0496125_0005926 Ga0496125_0005926_4509_5126 187
115 3300048928 Ga0496125_0328423 Ga0496125_0328423_65_682 187
116 3300048929 Ga0496126_0033033 Ga0496126_0033033_681_1298 187
117 3300048929 Ga0496126_0262239 Ga0496126_0262239_82_699 187
118 iso_pu_bacteria 2643221556 2643800656 187
119 iso_pu_bacteria 2643221684 2644470885 187
120 iso_pu_bacteria 8047673197 8047677483 187
121 3300003316 rootH1_10081268 rootH1_100812682 188
122 3300003320 rootH2_10049627 rootH2_100496272 188
123 3300003322 rootL2_10070594 rootL2_100705942 188
124 3300003323 rootH1_10336900 rootH1_103369002 188
125 3300005262 Ga0065165_1021464 Ga0065165_10214642 188
126 3300005288 Ga0065714_10064925 Ga0065714_100649254 188
127 3300005328 Ga0070676_10000540 Ga0070676_100005409 188
128 3300005334 Ga0068869_100000212 Ga0068869_10000021212 188
129 3300005338 Ga0068868_100000228 Ga0068868_10000022825 188
130 3300005364 Ga0070673_100000011 Ga0070673_10000001153 188
131 3300005459 Ga0068867_100000049 Ga0068867_10000004917 188
132 3300005543 Ga0070672_100034259 Ga0070672_1000342592 188
133 3300006846 Ga0075430_100138349 Ga0075430_1001383493 188
134 3300006881 Ga0068865_100000012 Ga0068865_10000001271 188
135 3300009098 Ga0105245_10000097 Ga0105245_1000009731 188
136 3300009148 Ga0105243_10000297 Ga0105243_1000029753 188
137 3300009176 Ga0105242_10000645 Ga0105242_1000064524 188
138 3300011119 Ga0105246_10000776 Ga0105246_100007763 188
139 3300013296 Ga0157374_10000132 Ga0157374_1000013214 188
140 3300013297 Ga0157378_10003091 Ga0157378_100030912 188
141 3300013308 Ga0157375_10000294 Ga0157375_1000029431 188
142 3300014969 Ga0157376_10000198 Ga0157376_1000019817 188
143 3300017792 Ga0163161_10000855 Ga0163161_100008553 188
144 3300021361 Ga0213872_10002557 Ga0213872_100025577 188
145 3300025907 Ga0207645_10001624 Ga0207645_100016249 188
146 3300025927 Ga0207687_10015430 Ga0207687_100154302 188
147 3300025934 Ga0207686_10000148 Ga0207686_100001488 188
148 3300025935 Ga0207709_10000299 Ga0207709_1000029931 188
149 3300025938 Ga0207704_10000021 Ga0207704_1000002153 188
150 3300025942 Ga0207689_10000132 Ga0207689_1000013252 188
151 3300025960 Ga0207651_10000012 Ga0207651_1000001269 188
152 3300026023 Ga0207677_10000058 Ga0207677_1000005869 188
153 3300026067 Ga0207678_10223970 Ga0207678_102239702 188
154 3300026089 Ga0207648_10000051 Ga0207648_1000005140 188
155 3300031548 Ga0307408_100394450 Ga0307408_1003944502 188
156 3300032005 Ga0307411_10169268 Ga0307411_101692683 188
157 3300037418 Ga0395900_0159267 Ga0395900_0159267_1278_1904 188
158 3300037418 Ga0395900_0775382 Ga0395900_0775382_85_750 188
159 3300037471 Ga0395905_0002220 Ga0395905_0002220_12197_12823 188
160 3300039447 Ga0436361_0210459 Ga0436361_0210459_1279_1845 188
161 3300039447 Ga0436361_0266932 Ga0436361_0266932_22034_22600 188
162 3300044684 Ga0466966_0209701 Ga0466966_0209701_335_955 188
163 3300044694 Ga0466963_0022427 Ga0466963_0022427_205_831 188
164 3300044694 Ga0466963_0156491 Ga0466963_0156491_638_1258 188
165 3300044706 Ga0466964_0008719 Ga0466964_0008719_1981_2601 188
166 3300044719 Ga0466971_0027551 Ga0466971_0027551_1275_1895 188
167 3300044901 Ga0466960_0193935 Ga0466960_0193935_349_999 188
168 3300045049 Ga0466959_0228828 Ga0466959_0228828_328_948 188
169 3300045976 Ga0466967_0019602 Ga0466967_0019602_1077_1703 188
170 3300045976 Ga0466967_0417871 Ga0466967_0417871_530_1150 188
171 3300046452 Ga0495617_000300 Ga0495617_000300_14776_15390 188
172 3300046453 Ga0495627_054672 Ga0495627_054672_30_644 188
173 3300046457 Ga0495590_0000782 Ga0495590_0000782_1805_2431 188
174 3300046457 Ga0495590_0010971 Ga0495590_0010971_662_1282 188
175 3300046458 Ga0495591_002605 Ga0495591_002605_2101_2715 188
176 3300046460 Ga0495638_0109909 Ga0495638_0109909_1004_1618 188
177 3300046463 Ga0495653_0009293 Ga0495653_0009293_2422_3048 188
178 3300046463 Ga0495653_0088147 Ga0495653_0088147_758_1384 188
179 3300046471 Ga0495650_0001172 Ga0495650_0001172_14613_15227 188
180 3300046474 Ga0495605_0000056 Ga0495605_0000056_64825_65445 188
181 3300046474 Ga0495605_0005950 Ga0495605_0005950_2831_3445 188
182 3300046474 Ga0495605_0048855 Ga0495605_0048855_1261_1875 188
183 3300046474 Ga0495605_0242416 Ga0495605_0242416_42_668 188
184 3300046491 Ga0495584_0000045 Ga0495584_0000045_51639_52259 188
185 3300046491 Ga0495584_0000639 Ga0495584_0000639_8754_9368 188
186 3300046491 Ga0495584_0003729 Ga0495584_0003729_6491_7105 188
187 3300046491 Ga0495584_0005831 Ga0495584_0005831_413_1039 188
188 3300046499 Ga0495594_0112777 Ga0495594_0112777_16_642 188
189 3300046501 Ga0495607_0000165 Ga0495607_0000165_66384_67043 188
190 3300046501 Ga0495607_0000324 Ga0495607_0000324_45465_46085 188
191 3300046501 Ga0495607_0003774 Ga0495607_0003774_9436_10062 188
192 3300046501 Ga0495607_0009436 Ga0495607_0009436_3319_3933 188
193 3300046507 Ga0495606_0001284 Ga0495606_0001284_24636_25250 188
194 3300046507 Ga0495606_0002490 Ga0495606_0002490_17395_18054 188
195 3300046507 Ga0495606_0003346 Ga0495606_0003346_16173_16787 188
196 3300046507 Ga0495606_0088633 Ga0495606_0088633_1263_1889 188
197 3300046507 Ga0495606_0164060 Ga0495606_0164060_119_778 188
198 3300046512 Ga0495610_0002251 Ga0495610_0002251_14113_14727 188
199 3300046513 Ga0495616_0015995 Ga0495616_0015995_1748_2374 188
200 3300046513 Ga0495616_0098897 Ga0495616_0098897_216_830 188
201 3300046515 Ga0495620_0000633 Ga0495620_0000633_6751_7365 188
202 3300046519 Ga0495632_0007911 Ga0495632_0007911_1914_2528 188
203 3300046519 Ga0495632_0012706 Ga0495632_0012706_3372_3986 188
204 3300046520 Ga0495637_0000412 Ga0495637_0000412_14160_14774 188
205 3300046522 Ga0495643_0000361 Ga0495643_0000361_7980_8600 188
206 3300046522 Ga0495643_0014913 Ga0495643_0014913_2403_3017 188
207 3300046522 Ga0495643_0020207 Ga0495643_0020207_1289_1918 188
208 3300046522 Ga0495643_0020998 Ga0495643_0020998_995_1615 188
209 3300046522 Ga0495643_0085939 Ga0495643_0085939_339_965 188
210 3300046524 Ga0495648_0001274 Ga0495648_0001274_14321_14941 188
211 3300046524 Ga0495648_0008850 Ga0495648_0008850_267_881 188
212 3300046526 Ga0495666_0151144 Ga0495666_0151144_33_659 188
213 3300046528 Ga0495642_0001122 Ga0495642_0001122_8274_8903 188
214 3300046528 Ga0495642_0026790 Ga0495642_0026790_1268_1894 188
215 3300046529 Ga0495652_0040928 Ga0495652_0040928_891_1517 188
216 3300046530 Ga0495654_0000706 Ga0495654_0000706_14562_15176 188
217 3300046535 Ga0495586_0182737 Ga0495586_0182737_550_1176 188
218 3300046536 Ga0495587_0017735 Ga0495587_0017735_3333_3959 188
219 3300046536 Ga0495587_0046383 Ga0495587_0046383_490_1116 188
220 3300046542 Ga0495597_0001459 Ga0495597_0001459_9248_9862 188
221 3300046543 Ga0495645_0084624 Ga0495645_0084624_96_755 188
222 3300046615 Ga0495656_0050280 Ga0495656_0050280_617_1237 188
223 3300046615 Ga0495656_0098811 Ga0495656_0098811_245_871 188
224 3300046642 Ga0495634_0016601 Ga0495634_0016601_143_769 188
225 3300046660 Ga0495625_0007836 Ga0495625_0007836_3714_4328 188
226 3300046660 Ga0495625_0071886 Ga0495625_0071886_720_1349 188
227 3300046660 Ga0495625_0074686 Ga0495625_0074686_1611_2225 188
228 3300046665 Ga0495661_0001619 Ga0495661_0001619_10081_10701 188
229 3300046665 Ga0495661_0038797 Ga0495661_0038797_1379_1999 188
230 3300046665 Ga0495661_0051911 Ga0495661_0051911_1825_2445 188
231 3300046674 Ga0495588_0000098 Ga0495588_0000098_106010_106639 188
232 3300046674 Ga0495588_0028410 Ga0495588_0028410_649_1275 188
233 3300046691 Ga0495670_0245743 Ga0495670_0245743_160_774 188
234 3300046692 Ga0495671_0002797 Ga0495671_0002797_3588_4202 188
235 3300046694 Ga0495649_0000067 Ga0495649_0000067_14153_14767 188
236 3300046694 Ga0495649_0075186 Ga0495649_0075186_969_1589 188
237 3300046694 Ga0495649_0086486 Ga0495649_0086486_518_1132 188
238 3300046794 Ga0495589_0000054 Ga0495589_0000054_26641_27261 188
239 3300046810 Ga0495660_0000055 Ga0495660_0000055_89974_90594 188
240 3300046810 Ga0495660_0027531 Ga0495660_0027531_22_681 188
241 3300047315 Ga0495581_0296772 Ga0495581_0296772_125_751 188
242 3300047320 Ga0495672_0005768 Ga0495672_0005768_2628_3242 188
243 3300047322 Ga0495680_0012680 Ga0495680_0012680_935_1561 188
244 3300047323 Ga0495683_0014111 Ga0495683_0014111_547_1173 188
245 3300047323 Ga0495683_0070993 Ga0495683_0070993_41_655 188
246 3300047323 Ga0495683_0084316 Ga0495683_0084316_178_798 188
247 3300047443 Ga0495687_000012 Ga0495687_000012_171708_172337 188
248 3300047443 Ga0495687_000016 Ga0495687_000016_222717_223376 188
249 3300047443 Ga0495687_000708 Ga0495687_000708_1394_2020 188
250 3300047443 Ga0495687_000843 Ga0495687_000843_7687_8307 188
251 3300047443 Ga0495687_001687 Ga0495687_001687_1394_2020 188
252 3300047444 Ga0495675_0012498 Ga0495675_0012498_3938_4564 188
253 3300047445 Ga0495677_0000126 Ga0495677_0000126_1390_2016 188
254 3300047445 Ga0495677_0001144 Ga0495677_0001144_797_1417 188
255 3300047470 Ga0495681_0000802 Ga0495681_0000802_19615_20229 188
256 3300047470 Ga0495681_0030263 Ga0495681_0030263_20_634 188
257 3300047470 Ga0495681_0084934 Ga0495681_0084934_532_1146 188
258 3300047472 Ga0495686_0003050 Ga0495686_0003050_7993_8607 188
259 3300048088 Ga0495602_0003531 Ga0495602_0003531_4282_4908 188
260 3300048090 Ga0495615_0001489 Ga0495615_0001489_2807_3466 188
261 3300048091 Ga0495626_0000053 Ga0495626_0000053_64950_65570 188
262 3300048091 Ga0495626_0000526 Ga0495626_0000526_35819_36445 188
263 3300048905 Ga0496102_0502911 Ga0496102_0502911_294_953 188
264 3300048924 Ga0496121_0121422 Ga0496121_0121422_1048_1674 188
265 3300048926 Ga0496123_0004173 Ga0496123_0004173_2313_2972 188
266 3300048927 Ga0496124_0083416 Ga0496124_0083416_1412_2032 188
267 3300048928 Ga0496125_0003220 Ga0496125_0003220_14562_15176 188
268 3300049459 Ga0495678_083656 Ga0495678_083656_160_774 188
269 3300049571 Ga0501034_0114396 Ga0501034_0114396_711_1385 188
270 3300050509 nmdc:mga0qj67_128583_c1 nmdc:mga0qj67_128583_c1_479_1093 188
271 iso_pu_bacteria 2599185169 2599412746 188
272 iso_pu_bacteria 2600255254 2601525754 188
273 iso_pu_bacteria 2600255255 2601528050 188
274 iso_pu_bacteria 2600255280 2601614884 188
275 iso_pu_bacteria 2600255281 2601620191 188
276 iso_pu_bacteria 2600255287 2601645975 188
277 iso_pu_bacteria 2600255288 2601648593 188
278 iso_pu_bacteria 2600255289 2601652939 188
279 iso_pu_bacteria 2600255290 2601658944 188
280 iso_pu_bacteria 2600255291 2601666035 188
281 iso_pu_bacteria 2600255298 2601698932 188
282 iso_pu_bacteria 2600255299 2601703904 188
283 iso_pu_bacteria 2600255300 2601705590 188
284 iso_pu_bacteria 2600255301 2601711179 188
285 iso_pu_bacteria 2600255302 2601716193 188
286 iso_pu_bacteria 2600255303 2601723838 188
287 iso_pu_bacteria 2600255304 2601726599 188
288 iso_pu_bacteria 2600255305 2601731139 188
289 iso_pu_bacteria 2600255306 2601736155 188
290 iso_pu_bacteria 2600255307 2601743506 188
291 iso_pu_bacteria 2600255309 2601754136 188
292 iso_pu_bacteria 2600255392 2602021238 188
293 iso_pu_bacteria 2602042052 2603658909 188
294 iso_pu_bacteria 2602042053 2603663697 188
295 iso_pu_bacteria 2602042103 2603838537 188
296 iso_pu_bacteria 2602042104 2603844209 188
297 iso_pu_bacteria 2602042105 2603848688 188
298 iso_pu_bacteria 2602042106 2603853761 188
299 iso_pu_bacteria 2602042110 2603871813 188
300 iso_pu_bacteria 2602042111 2603879290 188
301 iso_pu_bacteria 2603880178 2606049001 188
302 iso_pu_bacteria 2603880184 2606068123 188
303 iso_pu_bacteria 2603880202 2606146679 188
304 iso_pu_bacteria 2603880211 2606176406 188
305 iso_pu_bacteria 2675903046 2676409651 188
306 iso_pu_bacteria 2984559226 2984563247 188
307 iso_pu_bacteria 2984595703 2984595983 188
308 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005125 189
309 3300003856 Ga0058692_1012941 Ga0058692_10129412 189
310 3300005327 Ga0070658_10176175 Ga0070658_101761752 189
311 3300005327 Ga0070658_10180636 Ga0070658_101806362 189
312 3300005327 Ga0070658_10633234 Ga0070658_106332341 189
313 3300005339 Ga0070660_100012204 Ga0070660_1000122043 189
314 3300005344 Ga0070661_100075568 Ga0070661_1000755683 189
315 3300005354 Ga0070675_100068206 Ga0070675_1000682062 189
316 3300005354 Ga0070675_100679178 Ga0070675_1006791781 189
317 3300005356 Ga0070674_100000131 Ga0070674_10000013127 189
318 3300005364 Ga0070673_100115076 Ga0070673_1001150762 189
319 3300005364 Ga0070673_100503247 Ga0070673_1005032472 189
320 3300005366 Ga0070659_100017673 Ga0070659_1000176732 189
321 3300005456 Ga0070678_100000005 Ga0070678_10000000513 189
322 3300005459 Ga0068867_100094571 Ga0068867_1000945712 189
323 3300005563 Ga0068855_100008922 Ga0068855_1000089225 189
324 3300005564 Ga0070664_100871380 Ga0070664_1008713802 189
325 3300005578 Ga0068854_100215119 Ga0068854_1002151192 189
326 3300005842 Ga0068858_100000310 Ga0068858_10000031022 189
327 3300005985 Ga0081539_10205639 Ga0081539_102056391 189
328 3300006042 Ga0075368_10000045 Ga0075368_100000452 189
329 3300006048 Ga0075363_100004927 Ga0075363_1000049274 189
330 3300006178 Ga0075367_10000202 Ga0075367_1000020219 189
331 3300006237 Ga0097621_100039630 Ga0097621_1000396303 189
332 3300006353 Ga0075370_10017933 Ga0075370_100179332 189
333 3300009098 Ga0105245_10001089 Ga0105245_1000108917 189
334 3300009148 Ga0105243_10000030 Ga0105243_1000003056 189
335 3300009174 Ga0105241_10152097 Ga0105241_101520972 189
336 3300009551 Ga0105238_10476320 Ga0105238_104763202 189
337 3300013297 Ga0157378_10391510 Ga0157378_103915102 189
338 3300013308 Ga0157375_10913196 Ga0157375_109131962 189
339 3300025297 Ga0209758_1000001 Ga0209758_1000001125 189
340 3300025909 Ga0207705_10002643 Ga0207705_100026435 189
341 3300025911 Ga0207654_10107306 Ga0207654_101073062 189
342 3300025919 Ga0207657_10011709 Ga0207657_100117093 189
343 3300025924 Ga0207694_10014794 Ga0207694_100147942 189
344 3300025927 Ga0207687_10000547 Ga0207687_100005474 189
345 3300025927 Ga0207687_10614068 Ga0207687_106140682 189
346 3300025935 Ga0207709_10000137 Ga0207709_1000013756 189
347 3300025937 Ga0207669_10000031 Ga0207669_1000003169 189
348 3300025949 Ga0207667_10001769 Ga0207667_100017697 189
349 3300026089 Ga0207648_10012162 Ga0207648_100121624 189
350 3300026089 Ga0207648_10228713 Ga0207648_102287132 189
351 3300026121 Ga0207683_10000115 Ga0207683_1000011516 189
352 3300026142 Ga0207698_10516275 Ga0207698_105162751 189
353 3300027312 Ga0209371_1000477 Ga0209371_100047733 189
354 3300027866 Ga0209813_10000162 Ga0209813_1000016216 189
355 3300030500 Ga0268256_1000405 Ga0268256_100040533 189
356 3300031456 Ga0307513_10001351 Ga0307513_1000135125 189
357 3300037312 Ga0395899_0201737 Ga0395899_0201737_166_798 189
358 3300037312 Ga0395899_0274307 Ga0395899_0274307_317_949 189
359 3300037418 Ga0395900_0010806 Ga0395900_0010806_2717_3349 189
360 3300037418 Ga0395900_0052186 Ga0395900_0052186_831_1463 189
361 3300037418 Ga0395900_0061753 Ga0395900_0061753_658_1290 189
362 3300037418 Ga0395900_0171951 Ga0395900_0171951_877_1509 189
363 3300037466 Ga0395898_0083933 Ga0395898_0083933_2248_2880 189
364 3300037466 Ga0395898_0523845 Ga0395898_0523845_206_838 189
365 3300037471 Ga0395905_0005531 Ga0395905_0005531_11701_12333 189
366 3300037471 Ga0395905_0047819 Ga0395905_0047819_2615_3247 189
367 3300038443 Ga0395901_0107440 Ga0395901_0107440_1454_2086 189
368 3300038443 Ga0395901_0228186 Ga0395901_0228186_936_1568 189
369 3300038443 Ga0395901_0231141 Ga0395901_0231141_739_1371 189
370 3300038443 Ga0395901_0739702 Ga0395901_0739702_47_679 189
371 3300039447 Ga0436361_0794096 Ga0436361_0794096_494_1090 189
372 3300039447 Ga0436361_0871491 Ga0436361_0871491_2394_2990 189
373 3300042157 Ga0439458_0020592 Ga0439458_0020592_719_1351 189
374 3300044683 Ga0466965_0021578 Ga0466965_0021578_1765_2391 189
375 3300044684 Ga0466966_0028949 Ga0466966_0028949_2066_2707 189
376 3300044693 Ga0466961_0046353 Ga0466961_0046353_703_1356 189
377 3300044719 Ga0466971_0095241 Ga0466971_0095241_369_1022 189
378 3300044842 Ga0466957_0000010 Ga0466957_0000010_46371_47024 189
379 3300045049 Ga0466959_0144617 Ga0466959_0144617_473_1126 189
380 3300046453 Ga0495627_000125 Ga0495627_000125_25910_26497 189
381 3300046457 Ga0495590_0076821 Ga0495590_0076821_183_809 189
382 3300046471 Ga0495650_0000764 Ga0495650_0000764_12846_13433 189
383 3300046471 Ga0495650_0008064 Ga0495650_0008064_5263_5892 189
384 3300046474 Ga0495605_0010768 Ga0495605_0010768_4137_4769 189
385 3300046491 Ga0495584_0004173 Ga0495584_0004173_5097_5741 189
386 3300046491 Ga0495584_0039763 Ga0495584_0039763_316_918 189
387 3300046492 Ga0495585_0005625 Ga0495585_0005625_879_1511 189
388 3300046492 Ga0495585_0071598 Ga0495585_0071598_966_1610 189
389 3300046500 Ga0495596_0000059 Ga0495596_0000059_38976_39599 189
390 3300046500 Ga0495596_0003287 Ga0495596_0003287_7057_7683 189
391 3300046500 Ga0495596_0004533 Ga0495596_0004533_4102_4728 189
392 3300046500 Ga0495596_0006057 Ga0495596_0006057_4409_5011 189
393 3300046506 Ga0495583_0000410 Ga0495583_0000410_4300_4944 189
394 3300046506 Ga0495583_0006398 Ga0495583_0006398_150_776 189
395 3300046506 Ga0495583_0011628 Ga0495583_0011628_3802_4428 189
396 3300046507 Ga0495606_0104001 Ga0495606_0104001_118_720 189
397 3300046512 Ga0495610_0000019 Ga0495610_0000019_85602_86189 189
398 3300046512 Ga0495610_0005762 Ga0495610_0005762_3582_4184 189
399 3300046513 Ga0495616_0000034 Ga0495616_0000034_69126_69761 189
400 3300046513 Ga0495616_0002342 Ga0495616_0002342_5634_6260 189
401 3300046513 Ga0495616_0006972 Ga0495616_0006972_3690_4313 189
402 3300046513 Ga0495616_0012010 Ga0495616_0012010_659_1291 189
403 3300046513 Ga0495616_0012309 Ga0495616_0012309_640_1284 189
404 3300046513 Ga0495616_0084573 Ga0495616_0084573_404_1006 189
405 3300046518 Ga0495631_0003881 Ga0495631_0003881_3576_4211 189
406 3300046518 Ga0495631_0005146 Ga0495631_0005146_5606_6232 189
407 3300046518 Ga0495631_0007482 Ga0495631_0007482_622_1266 189
408 3300046518 Ga0495631_0020009 Ga0495631_0020009_1791_2414 189
409 3300046518 Ga0495631_0104938 Ga0495631_0104938_579_1178 189
410 3300046519 Ga0495632_0000001 Ga0495632_0000001_123977_124579 189
411 3300046519 Ga0495632_0000168 Ga0495632_0000168_10639_11283 189
412 3300046519 Ga0495632_0000636 Ga0495632_0000636_1180_1815 189
413 3300046519 Ga0495632_0001007 Ga0495632_0001007_4334_4978 189
414 3300046519 Ga0495632_0199582 Ga0495632_0199582_180_812 189
415 3300046520 Ga0495637_0000850 Ga0495637_0000850_5530_6132 189
416 3300046522 Ga0495643_0000020 Ga0495643_0000020_108738_109340 189
417 3300046522 Ga0495643_0006851 Ga0495643_0006851_1546_2178 189
418 3300046523 Ga0495644_0006314 Ga0495644_0006314_2566_3210 189
419 3300046523 Ga0495644_0009545 Ga0495644_0009545_1281_1907 189
420 3300046525 Ga0495663_0000002 Ga0495663_0000002_122307_122909 189
421 3300046528 Ga0495642_0000061 Ga0495642_0000061_8617_9252 189
422 3300046528 Ga0495642_0060524 Ga0495642_0060524_237_881 189
423 3300046530 Ga0495654_0016984 Ga0495654_0016984_2886_3521 189
424 3300046535 Ga0495586_0104531 Ga0495586_0104531_765_1400 189
425 3300046538 Ga0495609_0045725 Ga0495609_0045725_212_847 189
426 3300046542 Ga0495597_0000919 Ga0495597_0000919_8657_9289 189
427 3300046542 Ga0495597_0013358 Ga0495597_0013358_2070_2702 189
428 3300046558 Ga0495633_0000413 Ga0495633_0000413_23563_24165 189
429 3300046558 Ga0495633_0004923 Ga0495633_0004923_221_844 189
430 3300046558 Ga0495633_0195564 Ga0495633_0195564_33_620 189
431 3300046615 Ga0495656_0003729 Ga0495656_0003729_3741_4364 189
432 3300046616 Ga0495668_0002360 Ga0495668_0002360_646_1278 189
433 3300046616 Ga0495668_0035036 Ga0495668_0035036_29_673 189
434 3300046616 Ga0495668_0066134 Ga0495668_0066134_746_1372 189
435 3300046648 Ga0495611_0000506 Ga0495611_0000506_18404_19048 189
436 3300046648 Ga0495611_0042052 Ga0495611_0042052_650_1282 189
437 3300046660 Ga0495625_0092452 Ga0495625_0092452_352_954 189
438 3300046665 Ga0495661_0000109 Ga0495661_0000109_63675_64307 189
439 3300046665 Ga0495661_0002611 Ga0495661_0002611_140_784 189
440 3300046665 Ga0495661_0008495 Ga0495661_0008495_3646_4278 189
441 3300046665 Ga0495661_0024572 Ga0495661_0024572_1662_2285 189
442 3300046665 Ga0495661_0072681 Ga0495661_0072681_1241_1873 189
443 3300046674 Ga0495588_0192189 Ga0495588_0192189_193_834 189
444 3300046684 Ga0495669_0000498 Ga0495669_0000498_12866_13489 189
445 3300046684 Ga0495669_0006141 Ga0495669_0006141_1951_2592 189
446 3300046684 Ga0495669_0008931 Ga0495669_0008931_1297_1932 189
447 3300046684 Ga0495669_0391494 Ga0495669_0391494_24_650 189
448 3300046691 Ga0495670_0001168 Ga0495670_0001168_8073_8696 189
449 3300046691 Ga0495670_0195818 Ga0495670_0195818_96_731 189
450 3300046692 Ga0495671_0000016 Ga0495671_0000016_108738_109340 189
451 3300046694 Ga0495649_0001755 Ga0495649_0001755_9178_9810 189
452 3300046794 Ga0495589_0000045 Ga0495589_0000045_14366_14998 189
453 3300046794 Ga0495589_0034347 Ga0495589_0034347_766_1392 189
454 3300046794 Ga0495589_0039793 Ga0495589_0039793_13_657 189
455 3300046794 Ga0495589_0121517 Ga0495589_0121517_490_1122 189
456 3300046810 Ga0495660_0007613 Ga0495660_0007613_4031_4675 189
457 3300047320 Ga0495672_0101422 Ga0495672_0101422_393_1025 189
458 3300047323 Ga0495683_0001505 Ga0495683_0001505_3186_3830 189
459 3300047323 Ga0495683_0087874 Ga0495683_0087874_258_884 189
460 3300047445 Ga0495677_0000309 Ga0495677_0000309_16335_16979 189
461 3300047446 Ga0495679_004846 Ga0495679_004846_4203_4802 189
462 3300047470 Ga0495681_0000063 Ga0495681_0000063_67040_67627 189
463 3300047470 Ga0495681_0000208 Ga0495681_0000208_12759_13361 189
464 3300047470 Ga0495681_0042281 Ga0495681_0042281_280_903 189
465 3300047470 Ga0495681_0049687 Ga0495681_0049687_1061_1693 189
466 3300047470 Ga0495681_0186731 Ga0495681_0186731_52_678 189
467 3300047472 Ga0495686_0009263 Ga0495686_0009263_42_644 189
468 3300048091 Ga0495626_0000592 Ga0495626_0000592_295_927 189
469 3300048091 Ga0495626_0002095 Ga0495626_0002095_9800_10402 189
470 3300048091 Ga0495626_0003625 Ga0495626_0003625_4692_5324 189
471 3300048091 Ga0495626_0007702 Ga0495626_0007702_190_822 189
472 3300048091 Ga0495626_0008640 Ga0495626_0008640_1270_1902 189
473 3300048091 Ga0495626_0072451 Ga0495626_0072451_461_1087 189
474 3300048904 Ga0496101_0038135 Ga0496101_0038135_2388_3020 189
475 3300048904 Ga0496101_0538281 Ga0496101_0538281_49_684 189
476 3300048905 Ga0496102_0011657 Ga0496102_0011657_4279_4911 189
477 3300048905 Ga0496102_0172777 Ga0496102_0172777_875_1504 189
478 3300048912 Ga0496109_0006189 Ga0496109_0006189_4627_5259 189
479 3300048915 Ga0496112_0032981 Ga0496112_0032981_545_1177 189
480 3300048916 Ga0496113_0009275 Ga0496113_0009275_4056_4688 189
481 3300048916 Ga0496113_0324180 Ga0496113_0324180_364_996 189
482 3300048924 Ga0496121_0047844 Ga0496121_0047844_1129_1716 189
483 3300048925 Ga0496122_0000572 Ga0496122_0000572_4612_5244 189
484 3300048926 Ga0496123_0000584 Ga0496123_0000584_47956_48588 189
485 3300048927 Ga0496124_0002349 Ga0496124_0002349_16572_17159 189
486 3300048928 Ga0496125_0001849 Ga0496125_0001849_24332_24964 189
487 3300049459 Ga0495678_000061 Ga0495678_000061_8451_9077 189
488 3300049460 Ga0495682_0000243 Ga0495682_0000243_36831_37457 189
489 3300050490 nmdc:mga03n38_3425_c1 nmdc:mga03n38_3425_c1_3460_4062 189
490 3300050494 nmdc:mga06z11_8_c1 nmdc:mga06z11_8_c1_18524_19126 189
491 3300050495 nmdc:mga04h51_8_c1 nmdc:mga04h51_8_c1_33101_33703 189
492 3300050496 nmdc:mga07m45_18517_c1 nmdc:mga07m45_18517_c1_1109_1711 189
493 3300053125 Ga0500618_000152 Ga0500618_000152_7140_7739 189
494 3300053136 Ga0500559_0000091 Ga0500559_0000091_41061_41660 189
495 3300061719 Ga0466962_0190428 Ga0466962_0190428_228_860 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

30

180

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q62-assembly1.cif.gz_D crystal structure of arsh from sinorhizobium meliloti 0.903 1 185
7bx9-assembly1.cif.gz_A purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis 0.8966 7 184
2q62-assembly2.cif.gz_F crystal structure of arsh from sinorhizobium meliloti 0.8846 1 185
2fzv-assembly1.cif.gz_D crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.8792 2 185
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8788 6 187
ID Description Score Start End Superfamily
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8831 1 187 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8771 7 187 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8713 2 186 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8622 7 187 3.40.50.360
af_Q2G0L7_1_184_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.85 6 186 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A239F0S3-F1-model_v4 FMN reductase 0.9915 3 186 GO:0005829
GO:0010181
GO:0016491
AF-A0A1G7PRJ4-F1-model_v4 FMN reductase 0.9915 4 184 GO:0005829
GO:0010181
GO:0052873
AF-A0A2N3DG65-F1-model_v4 NADPH-dependent FMN reductase 0.9896 6 182 GO:0005829
GO:0010181
GO:0016491
AF-A0A7T8ACE9-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9882 1 186 GO:0005829
GO:0010181
GO:0016491
AF-A0A4R6FFD0-F1-model_v4 FMN reductase 0.9866 1 188 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.11 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map