F454685

General Info

Members Datasets Scaffolds Average Seq Length
495 246 990 183

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100885493|Ga0070675_1008854931
Length 204
Sequence MPRSAGRRARRLGRGQTSWVIPMTESFQPTLLLSMPQLQDPNFARSVVLLCDYMPDGAFGLVLNRPTDLPASTMVKLEPAIADGNSLPLCIGGPVEPDRGWILLADPPDEPEYRTVCDGLYLSTSPVLLRRVLSTSPPPRARVLAGYAGWGPGQLDTELAQSAWLIGKIELDLVFDTEPERMWETAIRRLGADPSSLQTSHGVH

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
170 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
171 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
172 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
222 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 4.44
Rhizosphere 91.31
Stem 0
Stem Tuber 0
Unclassified 14.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100885493 3300005354 Bacteria 818
2 MRS1b_contig_858271 2162886011 Bacteria 1152
3 Ga0058863_11515144 3300004799 Bacteria 2797
4 Ga0065704_10292551 3300005289 Bacteria 890
5 Ga0065712_10008978 3300005290 Bacteria 3604
6 Ga0065712_10069511 3300005290 Bacteria 7167
7 Ga0065712_10080620 3300005290 Bacteria 3087
8 Ga0065715_10146239 3300005293 Bacteria 1785
9 Ga0065715_10187152 3300005293 Bacteria 1435
10 Ga0065707_10182605 3300005295 Unclassified 1409
11 Ga0065707_10222964 3300005295 Bacteria 1218
12 Ga0070676_10004041 3300005328 Bacteria 7705
13 Ga0070676_10498116 3300005328 Bacteria 864
14 Ga0070676_10521175 3300005328 Bacteria 847
15 Ga0070683_100005602 3300005329 Bacteria 10491
16 Ga0070683_100007344 3300005329 Bacteria 9310
17 Ga0070670_100036339 3300005331 Bacteria 4239
18 Ga0070670_100079171 3300005331 Unclassified 2824
19 Ga0070670_100081126 3300005331 Unclassified 2787
20 Ga0070670_100132151 3300005331 Bacteria 2156
21 Ga0070677_10183930 3300005333 Bacteria 997
22 Ga0068869_100031312 3300005334 Bacteria 3741
23 Ga0068869_100376399 3300005334 Bacteria 1163
24 Ga0070666_10186485 3300005335 Bacteria 1456
25 Ga0070689_100015268 3300005340 Bacteria 5597
26 Ga0070691_10029669 3300005341 Bacteria 2559
27 Ga0070687_100010197 3300005343 Bacteria 4052
28 Ga0070661_100287490 3300005344 Bacteria 1277
29 Ga0070661_100800601 3300005344 Unclassified 773
30 Ga0070692_10017978 3300005345 Bacteria 3391
31 Ga0070669_100017129 3300005353 Bacteria 5170
32 Ga0070669_100117959 3300005353 Unclassified 2021
33 Ga0070669_100260581 3300005353 Bacteria 1383
34 Ga0070675_100070000 3300005354 Unclassified 2907
35 Ga0070675_100200500 3300005354 Bacteria 1732
36 Ga0070671_100137615 3300005355 Bacteria 2059
37 Ga0070671_100174157 3300005355 Bacteria 1820
38 Ga0070674_100207791 3300005356 Unclassified 1516
39 Ga0070674_100515800 3300005356 Bacteria 998
40 Ga0070673_100001720 3300005364 Bacteria 13007
41 Ga0070688_100064298 3300005365 Bacteria 2328
42 Ga0070688_100943264 3300005365 Unclassified 683
43 Ga0070659_100389710 3300005366 Bacteria 1175
44 Ga0070659_100687244 3300005366 Unclassified 884
45 Ga0070667_100356335 3300005367 Bacteria 1325
46 Ga0070667_100592872 3300005367 Bacteria 1021
47 Ga0070713_100025497 3300005436 Bacteria 4623
48 Ga0070713_100349134 3300005436 Bacteria 1372
49 Ga0070701_10035202 3300005438 Bacteria 2514
50 Ga0070711_100585656 3300005439 Unclassified 929
51 Ga0070711_100718653 3300005439 Unclassified 842
52 Ga0070705_100046278 3300005440 Bacteria 2507
53 Ga0070700_100009835 3300005441 Bacteria 5260
54 Ga0070700_100131401 3300005441 Bacteria 1690
55 Ga0070700_100525753 3300005441 Unclassified 915
56 Ga0070694_100038668 3300005444 Bacteria 3171
57 Ga0070663_100083705 3300005455 Bacteria 2350
58 Ga0070678_100061169 3300005456 Bacteria 2775
59 Ga0070678_100547513 3300005456 Bacteria 1027
60 Ga0070662_100131639 3300005457 Bacteria 1929
61 Ga0070681_10156095 3300005458 Bacteria 2207
62 Ga0068867_100231367 3300005459 Unclassified 1494
63 Ga0068867_100235023 3300005459 Unclassified 1483
64 Ga0070685_10202280 3300005466 Bacteria 1292
65 Ga0070699_100022782 3300005518 Bacteria 5397
66 Ga0070699_100238889 3300005518 Unclassified 1621
67 Ga0070684_100000403 3300005535 Bacteria 29597
68 Ga0070684_100057407 3300005535 Bacteria 3399
69 Ga0068853_100249622 3300005539 Bacteria 1628
70 Ga0070672_100038780 3300005543 Bacteria 3643
71 Ga0070672_100349593 3300005543 Bacteria 1260
72 Ga0070672_100473918 3300005543 Bacteria 1080
73 Ga0070672_101237992 3300005543 Unclassified 665
74 Ga0070686_100753465 3300005544 Bacteria 781
75 Ga0070695_100047747 3300005545 Bacteria 2736
76 Ga0070696_100079243 3300005546 Bacteria 2324
77 Ga0070693_100004546 3300005547 Bacteria 6577
78 Ga0070693_100037874 3300005547 Bacteria 2692
79 Ga0070665_100352968 3300005548 Bacteria 1476
80 Ga0070704_100046694 3300005549 Bacteria 3023
81 Ga0070704_101480003 3300005549 Bacteria 624
82 Ga0070664_100031406 3300005564 Bacteria 4437
83 Ga0070664_100137587 3300005564 Bacteria 2149
84 Ga0070664_100660554 3300005564 Unclassified 972
85 Ga0070664_100679681 3300005564 Unclassified 958
86 Ga0070664_100800789 3300005564 Bacteria 881
87 Ga0070664_100934055 3300005564 Unclassified 814
88 Ga0068857_100056930 3300005577 Unclassified 3470
89 Ga0068857_100092177 3300005577 Bacteria 2712
90 Ga0068854_100040693 3300005578 Bacteria 3280
91 Ga0068854_100450028 3300005578 Bacteria 1075
92 Ga0068854_100886446 3300005578 Bacteria 783
93 Ga0070702_100571034 3300005615 Bacteria 843
94 Ga0068852_100155937 3300005616 Bacteria 2127
95 Ga0068852_100183809 3300005616 Bacteria 1967
96 Ga0068859_100290990 3300005617 Bacteria 1726
97 Ga0068864_100121246 3300005618 Bacteria 2338
98 Ga0068861_100429716 3300005719 Bacteria 1179
99 Ga0068861_100916392 3300005719 Bacteria 831
100 Ga0068851_10249097 3300005834 Unclassified 1007
101 Ga0068870_10181345 3300005840 Bacteria 1264
102 Ga0068863_100278238 3300005841 Unclassified 1621
103 Ga0068858_100357025 3300005842 Bacteria 1400
104 Ga0068860_100236111 3300005843 Bacteria 1777
105 Ga0068862_100048612 3300005844 Bacteria 3621
106 Ga0068862_100408244 3300005844 Bacteria 1272
107 Ga0068862_100521739 3300005844 Bacteria 1130
108 Ga0075365_10008716 3300006038 Bacteria 5779
109 Ga0075368_10005556 3300006042 Bacteria 4346
110 Ga0075363_100443610 3300006048 Unclassified 766
111 Ga0075364_10005299 3300006051 Bacteria 7485
112 Ga0075364_10010877 3300006051 Bacteria 5514
113 Ga0075364_10011841 3300006051 Bacteria 5311
114 Ga0075362_10001868 3300006177 Bacteria 6897
115 Ga0075367_10025349 3300006178 Bacteria 3353
116 Ga0075367_10054727 3300006178 Bacteria 2366
117 Ga0075367_10104338 3300006178 Bacteria 1735
118 Ga0075366_10002978 3300006195 Bacteria 8822
119 Ga0075370_10165359 3300006353 Bacteria 1299
120 Ga0075428_100002609 3300006844 Bacteria 19611
121 Ga0075428_100011568 3300006844 Bacteria 9817
122 Ga0075428_100012248 3300006844 Bacteria 9536
123 Ga0075428_100024737 3300006844 Bacteria 6644
124 Ga0075428_100037133 3300006844 Bacteria 5365
125 Ga0075428_100779114 3300006844 Bacteria 1017
126 Ga0075430_100002613 3300006846 Bacteria 15044
127 Ga0075430_100010285 3300006846 Bacteria 7919
128 Ga0075430_100050014 3300006846 Bacteria 3526
129 Ga0075431_100020826 3300006847 Bacteria 6701
130 Ga0075431_100042853 3300006847 Bacteria 4669
131 Ga0075431_100044353 3300006847 Bacteria 4587
132 Ga0075431_100059061 3300006847 Bacteria 3958
133 Ga0075431_100060743 3300006847 Bacteria 3900
134 Ga0075431_100071202 3300006847 Bacteria 3587
135 Ga0075431_100082705 3300006847 Unclassified 3315
136 Ga0075431_100100737 3300006847 Bacteria 2981
137 Ga0075431_100125621 3300006847 Bacteria 2647
138 Ga0075431_100827485 3300006847 Bacteria 898
139 Ga0075433_10080797 3300006852 Bacteria 2866
140 Ga0075433_10128500 3300006852 Bacteria 2251
141 Ga0075433_10391133 3300006852 Bacteria 1227
142 Ga0075434_100034898 3300006871 Bacteria 4971
143 Ga0075434_100275562 3300006871 Bacteria 1701
144 Ga0075434_100421901 3300006871 Bacteria 1355
145 Ga0075434_100995736 3300006871 Bacteria 852
146 Ga0075429_100000565 3300006880 Bacteria 28385
147 Ga0075429_100029966 3300006880 Bacteria 4726
148 Ga0075429_100069249 3300006880 Bacteria 3072
149 Ga0075429_100324998 3300006880 Bacteria 1346
150 Ga0068865_100560435 3300006881 Bacteria 961
151 Ga0097620_100290972 3300006931 Bacteria 1726
152 Ga0075435_100000582 3300007076 Bacteria 22326
153 Ga0075435_100899828 3300007076 Bacteria 772
154 Ga0105240_10049126 3300009093 Bacteria 5327
155 Ga0111539_10000392 3300009094 Bacteria 54288
156 Ga0111539_10109345 3300009094 Bacteria 3244
157 Ga0111539_10112666 3300009094 Bacteria 3191
158 Ga0111539_10561257 3300009094 Bacteria 1330
159 Ga0111539_11475646 3300009094 Bacteria 789
160 Ga0105245_10116044 3300009098 Bacteria 2496
161 Ga0114129_10000181 3300009147 Bacteria 70013
162 Ga0114129_10002928 3300009147 Bacteria 23878
163 Ga0114129_10009596 3300009147 Bacteria 13805
164 Ga0114129_10010003 3300009147 Bacteria 13518
165 Ga0114129_10092676 3300009147 Bacteria 4185
166 Ga0114129_10099464 3300009147 Bacteria 4026
167 Ga0114129_10258364 3300009147 Unclassified 2336
168 Ga0114129_11309877 3300009147 Bacteria 897
169 Ga0114129_12166412 3300009147 Bacteria 669
170 Ga0105243_10063342 3300009148 Bacteria 2963
171 Ga0105241_10013172 3300009174 Bacteria 6065
172 Ga0105242_10178107 3300009176 Bacteria 1874
173 Ga0105248_10074302 3300009177 Bacteria 3821
174 Ga0105248_10112099 3300009177 Unclassified 3077
175 Ga0105238_10269127 3300009551 Bacteria 1684
176 Ga0105249_10165331 3300009553 Bacteria 2141
177 Ga0105249_10236521 3300009553 Bacteria 1804
178 Ga0105249_10244101 3300009553 Unclassified 1777
179 Ga0105249_10996858 3300009553 Unclassified 906
180 Ga0105239_10046662 3300010375 Bacteria 4747
181 Ga0105246_10101338 3300011119 Bacteria 2097
182 Ga0157370_10715263 3300013104 Bacteria 914
183 Ga0157369_10132528 3300013105 Bacteria 2640
184 Ga0157369_10319865 3300013105 Bacteria 1613
185 Ga0157374_10085803 3300013296 Bacteria 2994
186 Ga0163162_10260386 3300013306 Bacteria 1866
187 Ga0163162_11054925 3300013306 Unclassified 920
188 Ga0157372_10178116 3300013307 Bacteria 2461
189 Ga0157372_10238023 3300013307 Bacteria 2112
190 Ga0163163_10056944 3300014325 Bacteria 3864
191 Ga0163163_10487633 3300014325 Bacteria 1294
192 Ga0163163_11011455 3300014325 Unclassified 894
193 Ga0157380_10042879 3300014326 Bacteria 3540
194 Ga0157380_10584589 3300014326 Bacteria 1102
195 Ga0157376_10348300 3300014969 Bacteria 1417
196 Ga0207697_10240866 3300025315 Unclassified 799
197 Ga0207682_10162872 3300025893 Bacteria 1011
198 Ga0207642_10130844 3300025899 Bacteria 1309
199 Ga0207688_10031347 3300025901 Unclassified 2935
200 Ga0207647_10098869 3300025904 Bacteria 1733
201 Ga0207645_10015390 3300025907 Bacteria 5084
202 Ga0207684_10876747 3300025910 Unclassified 755
203 Ga0207654_10010248 3300025911 Bacteria 4770
204 Ga0207695_10195745 3300025913 Bacteria 1937
205 Ga0207662_10001822 3300025918 Bacteria 10466
206 Ga0207649_10079542 3300025920 Bacteria 2118
207 Ga0207649_10876185 3300025920 Bacteria 703
208 Ga0207681_10093080 3300025923 Unclassified 2156
209 Ga0207681_10197066 3300025923 Bacteria 1544
210 Ga0207650_10003668 3300025925 Bacteria 10503
211 Ga0207650_10009068 3300025925 Bacteria 6800
212 Ga0207650_10213522 3300025925 Bacteria 1550
213 Ga0207659_10236492 3300025926 Bacteria 1476
214 Ga0207659_10331226 3300025926 Bacteria 1259
215 Ga0207700_10034667 3300025928 Bacteria 3626
216 Ga0207644_10085386 3300025931 Bacteria 2341
217 Ga0207644_10126693 3300025931 Bacteria 1950
218 Ga0207690_10372208 3300025932 Bacteria 1133
219 Ga0207690_10712636 3300025932 Bacteria 825
220 Ga0207706_10033936 3300025933 Bacteria 4542
221 Ga0207706_10117446 3300025933 Bacteria 2340
222 Ga0207686_10464337 3300025934 Bacteria 976
223 Ga0207709_10026793 3300025935 Bacteria 3314
224 Ga0207670_10053505 3300025936 Bacteria 2720
225 Ga0207669_10188850 3300025937 Unclassified 1484
226 Ga0207669_10282219 3300025937 Bacteria 1253
227 Ga0207669_10566582 3300025937 Unclassified 919
228 Ga0207704_10338451 3300025938 Bacteria 1167
229 Ga0207691_10005877 3300025940 Bacteria 11855
230 Ga0207691_10123440 3300025940 Unclassified 2292
231 Ga0207711_10008843 3300025941 Bacteria 8419
232 Ga0207689_10019440 3300025942 Bacteria 5726
233 Ga0207689_10335542 3300025942 Bacteria 1255
234 Ga0207661_10003446 3300025944 Bacteria 10979
235 Ga0207661_10039223 3300025944 Bacteria 3716
236 Ga0207679_10036328 3300025945 Bacteria 3494
237 Ga0207679_10189832 3300025945 Bacteria 1707
238 Ga0207679_10458649 3300025945 Bacteria 1131
239 Ga0207651_10246743 3300025960 Bacteria 1458
240 Ga0207712_10852938 3300025961 Bacteria 803
241 Ga0207640_10132300 3300025981 Bacteria 1805
242 Ga0207640_10455611 3300025981 Unclassified 1055
243 Ga0207658_10747555 3300025986 Bacteria 885
244 Ga0207703_10638668 3300026035 Bacteria 1009
245 Ga0207678_10107932 3300026067 Bacteria 2375
246 Ga0207678_10289423 3300026067 Bacteria 1407
247 Ga0207708_10003636 3300026075 Bacteria 11370
248 Ga0207708_10603126 3300026075 Bacteria 930
249 Ga0207708_10629509 3300026075 Unclassified 911
250 Ga0207641_10343345 3300026088 Unclassified 1421
251 Ga0207641_11138926 3300026088 Unclassified 779
252 Ga0207648_10007184 3300026089 Bacteria 10980
253 Ga0207648_10152369 3300026089 Bacteria 2040
254 Ga0207676_10032604 3300026095 Bacteria 3928
255 Ga0207676_11497107 3300026095 Bacteria 672
256 Ga0207674_10026294 3300026116 Bacteria 6186
257 Ga0207674_10111274 3300026116 Bacteria 2713
258 Ga0207675_100023081 3300026118 Bacteria 5785
259 Ga0207683_10059458 3300026121 Bacteria 3357
260 Ga0207683_10238738 3300026121 Bacteria 1658
261 Ga0207698_10090222 3300026142 Bacteria 2506
262 Ga0207698_10215521 3300026142 Bacteria 1731
263 Ga0209813_10161916 3300027866 Unclassified 808
264 Ga0207428_10000925 3300027907 Bacteria 32815
265 Ga0207428_10108110 3300027907 Bacteria 2142
266 Ga0207428_10155582 3300027907 Bacteria 1739
267 Ga0268265_10426807 3300028380 Bacteria 1232
268 Ga0268265_10473865 3300028380 Unclassified 1174
269 Ga0307408_100005564 3300031548 Bacteria 8420
270 Ga0307408_100270339 3300031548 Bacteria 1411
271 Ga0307408_100350058 3300031548 Bacteria 1253
272 Ga0307408_100759593 3300031548 Bacteria 876
273 Ga0307405_10017551 3300031731 Bacteria 3930
274 Ga0307405_10088215 3300031731 Bacteria 2046
275 Ga0307405_10919193 3300031731 Unclassified 741
276 Ga0307413_10092491 3300031824 Unclassified 1974
277 Ga0307413_10096075 3300031824 Bacteria 1944
278 Ga0307413_10804696 3300031824 Bacteria 790
279 Ga0307410_10349630 3300031852 Unclassified 1181
280 Ga0307406_10298790 3300031901 Bacteria 1236
281 Ga0307406_10333161 3300031901 Bacteria 1179
282 Ga0307406_10423922 3300031901 Bacteria 1061
283 Ga0307412_10113554 3300031911 Bacteria 1938
284 Ga0307412_10173610 3300031911 Bacteria 1614
285 Ga0307412_10208717 3300031911 Bacteria 1489
286 Ga0307412_10263799 3300031911 Bacteria 1344
287 Ga0307412_10386437 3300031911 Bacteria 1135
288 Ga0307409_100369260 3300031995 Bacteria 1360
289 Ga0307409_100599604 3300031995 Bacteria 1088
290 Ga0307416_100001475 3300032002 Bacteria 12811
291 Ga0307416_100076330 3300032002 Bacteria 2808
292 Ga0307416_100151161 3300032002 Bacteria 2129
293 Ga0307416_100278033 3300032002 Bacteria 1649
294 Ga0307416_100560129 3300032002 Bacteria 1217
295 Ga0307416_100859049 3300032002 Bacteria 1006
296 Ga0307416_100871528 3300032002 Bacteria 999
297 Ga0307416_101001421 3300032002 Bacteria 939
298 Ga0307414_10384651 3300032004 Bacteria 1214
299 Ga0307411_10013540 3300032005 Bacteria 4504
300 Ga0307411_10063842 3300032005 Bacteria 2463
301 Ga0307411_10106035 3300032005 Bacteria 1999
302 Ga0307411_11077582 3300032005 Unclassified 723
303 Ga0307415_100341021 3300032126 Bacteria 1258
304 Ga0307415_100567237 3300032126 Bacteria 1004
305 Ga0307415_100996883 3300032126 Bacteria 778
306 Ga0307415_101188798 3300032126 Bacteria 718
307 Ga0373926_0111132 3300035083 Bacteria 1029
308 Ga0373952_0016752 3300035092 Unclassified 1495
309 Ga0373945_0126008 3300035116 Bacteria 1022
310 Ga0373960_0148756 3300035121 Bacteria 798
311 Ga0373943_0103217 3300035170 Bacteria 1494
312 Ga0373961_0074645 3300035241 Bacteria 1055
313 Ga0373931_0020925 3300035691 Bacteria 3277
314 Ga0373931_0703657 3300035691 Bacteria 667
315 Ga0373947_0049496 3300035725 Bacteria 2524
316 Ga0373937_0045368 3300036401 Bacteria 4016
317 Ga0395905_0790223 3300037471 Bacteria 852
318 Ga0436365_0932060 3300039437 Bacteria 2545
319 Ga0439439_0138885 3300041406 Unclassified 685
320 Ga0439461_0014857 3300041410 Bacteria 1486
321 Ga0451807_2534927 3300041486 Bacteria 830
322 Ga0439433_0053422 3300041999 Bacteria 955
323 Ga0439443_004489 3300042003 Unclassified 1820
324 Ga0439445_0016513 3300042004 Bacteria 1816
325 Ga0439450_005967 3300042008 Bacteria 2170
326 Ga0439450_068720 3300042008 Bacteria 867
327 Ga0439462_0090947 3300042015 Bacteria 837
328 Ga0439446_0019040 3300042156 Bacteria 1928
329 Ga0439434_0115565 3300042435 Bacteria 872
330 Ga0439434_0171561 3300042435 Bacteria 724
331 Ga0439435_0018111 3300042436 Bacteria 1789
332 Ga0439435_0166905 3300042436 Bacteria 713
333 Ga0451577_0030045 3300042876 Bacteria 4910
334 Ga0451576_0473348 3300045051 Unclassified 1316
335 Ga0466967_0201402 3300045976 Bacteria 1886
336 Ga0466967_0846319 3300045976 Bacteria 909
337 Ga0495586_0098277 3300046535 Bacteria 1623
338 Ga0495677_0145234 3300047445 Unclassified 912
339 Ga0495684_0128651 3300047471 Bacteria 1904
340 Ga0496102_0918436 3300048905 Bacteria 797
341 Ga0496104_0010848 3300048907 Bacteria 8148
342 Ga0496104_1219047 3300048907 Bacteria 656
343 Ga0496105_0325356 3300048908 Bacteria 1231
344 Ga0496106_0121950 3300048909 Unclassified 2038
345 Ga0496107_0553704 3300048910 Bacteria 852
346 Ga0496108_0026135 3300048911 Bacteria 4815
347 Ga0496108_0078180 3300048911 Bacteria 2800
348 Ga0496109_0002337 3300048912 Bacteria 15810
349 Ga0496109_0331935 3300048912 Bacteria 1436
350 Ga0496109_0544471 3300048912 Bacteria 1095
351 Ga0496110_0002227 3300048913 Bacteria 14491
352 Ga0496110_0043036 3300048913 Bacteria 3943
353 Ga0496111_0051209 3300048914 Bacteria 2981
354 Ga0496112_0001195 3300048915 Bacteria 19467
355 Ga0496112_0259365 3300048915 Bacteria 1688
356 Ga0496112_0512726 3300048915 Bacteria 1134
357 Ga0496112_0748770 3300048915 Unclassified 903
358 Ga0496112_0966568 3300048915 Unclassified 772
359 Ga0496113_0310554 3300048916 Bacteria 1263
360 Ga0496113_0369556 3300048916 Bacteria 1151
361 Ga0501300_028063 3300049523 Bacteria 828
362 Ga0501031_0170537 3300049568 Bacteria 1422
363 Ga0501031_0228326 3300049568 Bacteria 1212
364 Ga0501034_0072824 3300049571 Bacteria 3444
365 Ga0501034_0109095 3300049571 Bacteria 2759
366 Ga0501036_0253896 3300049572 Bacteria 1473
367 Ga0501036_0690808 3300049572 Unclassified 843
368 Ga0501038_0190430 3300049574 Bacteria 1651
369 Ga0501038_0208571 3300049574 Bacteria 1564
370 Ga0501039_0011048 3300049575 Bacteria 6882
371 Ga0501039_0074531 3300049575 Bacteria 2638
372 Ga0501039_0201026 3300049575 Bacteria 1567
373 Ga0501040_0006057 3300049576 Bacteria 7835
374 Ga0501040_0100173 3300049576 Bacteria 2020
375 Ga0501040_0172642 3300049576 Bacteria 1531
376 Ga0501040_0202677 3300049576 Bacteria 1409
377 Ga0501041_0078786 3300049577 Bacteria 2028
378 Ga0501042_0009654 3300049578 Bacteria 6443
379 Ga0501042_0320437 3300049578 Bacteria 1120
380 Ga0501043_0221444 3300049579 Bacteria 1464
381 Ga0501043_0436275 3300049579 Bacteria 986
382 Ga0501046_0143151 3300049580 Bacteria 1808
383 Ga0501046_0184143 3300049580 Bacteria 1560
384 Ga0501047_0217556 3300049581 Bacteria 1767
385 Ga0501048_0007756 3300049582 Bacteria 8136
386 Ga0501048_0492369 3300049582 Unclassified 879
387 Ga0501067_0055028 3300049583 Bacteria 2205
388 Ga0501068_0126255 3300049584 Bacteria 1598
389 Ga0501068_0418941 3300049584 Bacteria 865
390 Ga0501069_0044901 3300049585 Bacteria 2447
391 Ga0501069_0404992 3300049585 Unclassified 807
392 Ga0501069_0632548 3300049585 Unclassified 643
393 Ga0501071_0009092 3300049587 Bacteria 6597
394 Ga0501071_0044770 3300049587 Bacteria 3175
395 Ga0501071_0226388 3300049587 Bacteria 1408
396 Ga0501071_0506608 3300049587 Bacteria 926
397 Ga0501072_0016533 3300049588 Bacteria 5668
398 Ga0501072_0026015 3300049588 Bacteria 4560
399 Ga0501072_0230412 3300049588 Bacteria 1476
400 Ga0501072_0350063 3300049588 Bacteria 1173
401 Ga0501074_0107537 3300049590 Bacteria 1997
402 Ga0501074_0273214 3300049590 Bacteria 1202
403 Ga0501075_0071440 3300049591 Bacteria 2623
404 Ga0501075_0157189 3300049591 Bacteria 1733
405 Ga0501075_0186490 3300049591 Bacteria 1582
406 Ga0501075_0346100 3300049591 Bacteria 1133
407 Ga0501075_0554592 3300049591 Unclassified 877
408 Ga0501076_0054354 3300049592 Bacteria 3173
409 Ga0501076_0088108 3300049592 Bacteria 2495
410 Ga0501076_0243271 3300049592 Bacteria 1472
411 Ga0501077_0026842 3300049593 Bacteria 3656
412 Ga0501077_0090914 3300049593 Bacteria 1934
413 Ga0501077_0538898 3300049593 Unclassified 749
414 Ga0501198_014284 3300049649 Bacteria 1209
415 Ga0501079_0211041 3300049741 Bacteria 1516
416 Ga0501079_0420151 3300049741 Unclassified 1049
417 Ga0501079_1150592 3300049741 Bacteria 611
418 Ga0501080_0129148 3300049742 Bacteria 2340
419 Ga0501080_0440239 3300049742 Bacteria 1169
420 Ga0501080_0461683 3300049742 Bacteria 1137
421 Ga0501080_0591960 3300049742 Bacteria 985
422 Ga0501081_0065490 3300049743 Bacteria 2526
423 Ga0501081_0079942 3300049743 Bacteria 2287
424 Ga0501081_0121878 3300049743 Bacteria 1858
425 Ga0501081_0510034 3300049743 Bacteria 897
426 Ga0501081_1116998 3300049743 Bacteria 597
427 Ga0501083_0443188 3300049744 Bacteria 845
428 Ga0501268_018940 3300049765 Bacteria 1162
429 Ga0501270_086944 3300049767 Bacteria 631
430 Ga0501035_0076263 3300049822 Bacteria 2965
431 Ga0501035_0378628 3300049822 Bacteria 1181
432 Ga0501045_0008677 3300049824 Bacteria 7087
433 Ga0501045_0060065 3300049824 Bacteria 2786
434 Ga0501045_0110634 3300049824 Bacteria 2037
435 Ga0501045_0187051 3300049824 Unclassified 1543
436 Ga0501045_0193746 3300049824 Bacteria 1515
437 nmdc:mga00v17_26518_c1 3300050491 Bacteria 3378
438 nmdc:mga00v17_36270_c1 3300050491 Bacteria 2938
439 nmdc:mga06z11_128830_c1 3300050494 Bacteria 1419
440 nmdc:mga06z11_41967_c1 3300050494 Bacteria 2292
441 nmdc:mga04h51_325839_c1 3300050495 Unclassified 631
442 nmdc:mga05p37_13625_c2 3300050507 Bacteria 8765
443 nmdc:mga05p37_1541_c1 3300050507 Bacteria 26778
444 nmdc:mga05p37_1830306_c1 3300050507 Unclassified 584
445 nmdc:mga05p37_214321_c1 3300050507 Unclassified 2326
446 nmdc:mga05p37_2518_c1 3300050507 Bacteria 21290
447 nmdc:mga05p37_270692_c1 3300050507 Bacteria 2030
448 nmdc:mga05p37_390139_c1 3300050507 Bacteria 1629
449 nmdc:mga05p37_461608_c1 3300050507 Bacteria 1467
450 nmdc:mga09592_1149747_c1 3300050508 Unclassified 643
451 nmdc:mga09592_122125_c1 3300050508 Bacteria 2238
452 nmdc:mga09592_138976_c1 3300050508 Bacteria 2093
453 nmdc:mga09592_19626_c1 3300050508 Bacteria 5551
454 nmdc:mga0qj67_21977_c1 3300050509 Bacteria 4896
455 nmdc:mga0qj67_31365_c1 3300050509 Bacteria 4140
456 nmdc:mga0qj67_331944_c1 3300050509 Bacteria 1231
457 nmdc:mga06r32_113603_c1 3300050510 Bacteria 2666
458 nmdc:mga06r32_169245_c1 3300050510 Unclassified 2168
459 nmdc:mga06r32_27375_c1 3300050510 Bacteria 5325
460 nmdc:mga06r32_281293_c1 3300050510 Bacteria 1651
461 nmdc:mga06r32_582797_c1 3300050510 Archaea 1091
462 nmdc:mga06r32_74772_c1 3300050510 Bacteria 3285
463 nmdc:mga06r32_765334_c1 3300050510 Bacteria 928
464 nmdc:mga06r32_795215_c1 3300050510 Bacteria 907
465 nmdc:mga08y16_1069171_c1 3300050511 Bacteria 783
466 nmdc:mga08y16_1223425_c1 3300050511 Bacteria 721
467 nmdc:mga08y16_45515_c1 3300050511 Bacteria 4598
468 nmdc:mga08y16_75_c1 3300050511 Bacteria 82530
469 nmdc:mga08y16_92130_c1 3300050511 Bacteria 3158
470 nmdc:mga0n895_17960_c1 3300050512 Bacteria 6536
471 nmdc:mga0n895_3583_c1 3300050512 Bacteria 12550
472 nmdc:mga0n895_50327_c1 3300050512 Bacteria 4084
473 nmdc:mga0n895_521994_c1 3300050512 Bacteria 1195
474 nmdc:mga0rr50_339585_c1 3300050513 Bacteria 1262
475 nmdc:mga0a205_112468_c1 3300050515 Bacteria 2622
476 nmdc:mga0a205_39866_c1 3300050515 Bacteria 2258
477 nmdc:mga0a205_567041_c1 3300050515 Bacteria 990
478 nmdc:mga0sz30_379722_c1 3300050516 Bacteria 632
479 Ga0495601_0270650 3300053077 Bacteria 1108
480 Ga0495619_0580337 3300053085 Unclassified 768
481 Ga0500628_093432 3300053129 Unclassified 787
482 Ga0501084_0023477 3300054114 Bacteria 5146
483 Ga0501084_0060701 3300054114 Bacteria 3165
484 Ga0501084_0703177 3300054114 Unclassified 852
485 Ga0590071_001644 3300059421 Bacteria 5829
486 Ga0590071_018553 3300059421 Bacteria 1635
487 Ga0590074_000871 3300059423 Bacteria 4690
488 Ga0590075_000325 3300059424 Bacteria 13243
489 Ga0590077_000418 3300059426 Bacteria 11885
490 Ga0590077_033274 3300059426 Bacteria 1131
491 Ga0501082_0160684 3300060353 Bacteria 1952
492 Ga0501082_0194599 3300060353 Bacteria 1764
493 Ga0501082_0343421 3300060353 Bacteria 1301
494 Ga0501082_0663870 3300060353 Bacteria 912
495 Ga0530510_0017554 3300061734 Bacteria 5071
496 Ga0070675_100885493
497 MRS1b_contig_858271
498 Ga0058863_11515144
499 Ga0065704_10292551
500 Ga0065712_10008978
501 Ga0065712_10069511
502 Ga0065712_10080620
503 Ga0065715_10146239
504 Ga0065715_10187152
505 Ga0065707_10182605
506 Ga0065707_10222964
507 Ga0070676_10004041
508 Ga0070676_10498116
509 Ga0070676_10521175
510 Ga0070683_100005602
511 Ga0070683_100007344
512 Ga0070670_100036339
513 Ga0070670_100079171
514 Ga0070670_100081126
515 Ga0070670_100132151
516 Ga0070677_10183930
517 Ga0068869_100031312
518 Ga0068869_100376399
519 Ga0070666_10186485
520 Ga0070689_100015268
521 Ga0070691_10029669
522 Ga0070687_100010197
523 Ga0070661_100287490
524 Ga0070661_100800601
525 Ga0070692_10017978
526 Ga0070669_100017129
527 Ga0070669_100117959
528 Ga0070669_100260581
529 Ga0070675_100070000
530 Ga0070675_100200500
531 Ga0070671_100137615
532 Ga0070671_100174157
533 Ga0070674_100207791
534 Ga0070674_100515800
535 Ga0070673_100001720
536 Ga0070688_100064298
537 Ga0070688_100943264
538 Ga0070659_100389710
539 Ga0070659_100687244
540 Ga0070667_100356335
541 Ga0070667_100592872
542 Ga0070713_100025497
543 Ga0070713_100349134
544 Ga0070701_10035202
545 Ga0070711_100585656
546 Ga0070711_100718653
547 Ga0070705_100046278
548 Ga0070700_100009835
549 Ga0070700_100131401
550 Ga0070700_100525753
551 Ga0070694_100038668
552 Ga0070663_100083705
553 Ga0070678_100061169
554 Ga0070678_100547513
555 Ga0070662_100131639
556 Ga0070681_10156095
557 Ga0068867_100231367
558 Ga0068867_100235023
559 Ga0070685_10202280
560 Ga0070699_100022782
561 Ga0070699_100238889
562 Ga0070684_100000403
563 Ga0070684_100057407
564 Ga0068853_100249622
565 Ga0070672_100038780
566 Ga0070672_100349593
567 Ga0070672_100473918
568 Ga0070672_101237992
569 Ga0070686_100753465
570 Ga0070695_100047747
571 Ga0070696_100079243
572 Ga0070693_100004546
573 Ga0070693_100037874
574 Ga0070665_100352968
575 Ga0070704_100046694
576 Ga0070704_101480003
577 Ga0070664_100031406
578 Ga0070664_100137587
579 Ga0070664_100660554
580 Ga0070664_100679681
581 Ga0070664_100800789
582 Ga0070664_100934055
583 Ga0068857_100056930
584 Ga0068857_100092177
585 Ga0068854_100040693
586 Ga0068854_100450028
587 Ga0068854_100886446
588 Ga0070702_100571034
589 Ga0068852_100155937
590 Ga0068852_100183809
591 Ga0068859_100290990
592 Ga0068864_100121246
593 Ga0068861_100429716
594 Ga0068861_100916392
595 Ga0068851_10249097
596 Ga0068870_10181345
597 Ga0068863_100278238
598 Ga0068858_100357025
599 Ga0068860_100236111
600 Ga0068862_100048612
601 Ga0068862_100408244
602 Ga0068862_100521739
603 Ga0075365_10008716
604 Ga0075368_10005556
605 Ga0075363_100443610
606 Ga0075364_10005299
607 Ga0075364_10010877
608 Ga0075364_10011841
609 Ga0075362_10001868
610 Ga0075367_10025349
611 Ga0075367_10054727
612 Ga0075367_10104338
613 Ga0075366_10002978
614 Ga0075370_10165359
615 Ga0075428_100002609
616 Ga0075428_100011568
617 Ga0075428_100012248
618 Ga0075428_100024737
619 Ga0075428_100037133
620 Ga0075428_100779114
621 Ga0075430_100002613
622 Ga0075430_100010285
623 Ga0075430_100050014
624 Ga0075431_100020826
625 Ga0075431_100042853
626 Ga0075431_100044353
627 Ga0075431_100059061
628 Ga0075431_100060743
629 Ga0075431_100071202
630 Ga0075431_100082705
631 Ga0075431_100100737
632 Ga0075431_100125621
633 Ga0075431_100827485
634 Ga0075433_10080797
635 Ga0075433_10128500
636 Ga0075433_10391133
637 Ga0075434_100034898
638 Ga0075434_100275562
639 Ga0075434_100421901
640 Ga0075434_100995736
641 Ga0075429_100000565
642 Ga0075429_100029966
643 Ga0075429_100069249
644 Ga0075429_100324998
645 Ga0068865_100560435
646 Ga0097620_100290972
647 Ga0075435_100000582
648 Ga0075435_100899828
649 Ga0105240_10049126
650 Ga0111539_10000392
651 Ga0111539_10109345
652 Ga0111539_10112666
653 Ga0111539_10561257
654 Ga0111539_11475646
655 Ga0105245_10116044
656 Ga0114129_10000181
657 Ga0114129_10002928
658 Ga0114129_10009596
659 Ga0114129_10010003
660 Ga0114129_10092676
661 Ga0114129_10099464
662 Ga0114129_10258364
663 Ga0114129_11309877
664 Ga0114129_12166412
665 Ga0105243_10063342
666 Ga0105241_10013172
667 Ga0105242_10178107
668 Ga0105248_10074302
669 Ga0105248_10112099
670 Ga0105238_10269127
671 Ga0105249_10165331
672 Ga0105249_10236521
673 Ga0105249_10244101
674 Ga0105249_10996858
675 Ga0105239_10046662
676 Ga0105246_10101338
677 Ga0157370_10715263
678 Ga0157369_10132528
679 Ga0157369_10319865
680 Ga0157374_10085803
681 Ga0163162_10260386
682 Ga0163162_11054925
683 Ga0157372_10178116
684 Ga0157372_10238023
685 Ga0163163_10056944
686 Ga0163163_10487633
687 Ga0163163_11011455
688 Ga0157380_10042879
689 Ga0157380_10584589
690 Ga0157376_10348300
691 Ga0207697_10240866
692 Ga0207682_10162872
693 Ga0207642_10130844
694 Ga0207688_10031347
695 Ga0207647_10098869
696 Ga0207645_10015390
697 Ga0207684_10876747
698 Ga0207654_10010248
699 Ga0207695_10195745
700 Ga0207662_10001822
701 Ga0207649_10079542
702 Ga0207649_10876185
703 Ga0207681_10093080
704 Ga0207681_10197066
705 Ga0207650_10003668
706 Ga0207650_10009068
707 Ga0207650_10213522
708 Ga0207659_10236492
709 Ga0207659_10331226
710 Ga0207700_10034667
711 Ga0207644_10085386
712 Ga0207644_10126693
713 Ga0207690_10372208
714 Ga0207690_10712636
715 Ga0207706_10033936
716 Ga0207706_10117446
717 Ga0207686_10464337
718 Ga0207709_10026793
719 Ga0207670_10053505
720 Ga0207669_10188850
721 Ga0207669_10282219
722 Ga0207669_10566582
723 Ga0207704_10338451
724 Ga0207691_10005877
725 Ga0207691_10123440
726 Ga0207711_10008843
727 Ga0207689_10019440
728 Ga0207689_10335542
729 Ga0207661_10003446
730 Ga0207661_10039223
731 Ga0207679_10036328
732 Ga0207679_10189832
733 Ga0207679_10458649
734 Ga0207651_10246743
735 Ga0207712_10852938
736 Ga0207640_10132300
737 Ga0207640_10455611
738 Ga0207658_10747555
739 Ga0207703_10638668
740 Ga0207678_10107932
741 Ga0207678_10289423
742 Ga0207708_10003636
743 Ga0207708_10603126
744 Ga0207708_10629509
745 Ga0207641_10343345
746 Ga0207641_11138926
747 Ga0207648_10007184
748 Ga0207648_10152369
749 Ga0207676_10032604
750 Ga0207676_11497107
751 Ga0207674_10026294
752 Ga0207674_10111274
753 Ga0207675_100023081
754 Ga0207683_10059458
755 Ga0207683_10238738
756 Ga0207698_10090222
757 Ga0207698_10215521
758 Ga0209813_10161916
759 Ga0207428_10000925
760 Ga0207428_10108110
761 Ga0207428_10155582
762 Ga0268265_10426807
763 Ga0268265_10473865
764 Ga0307408_100005564
765 Ga0307408_100270339
766 Ga0307408_100350058
767 Ga0307408_100759593
768 Ga0307405_10017551
769 Ga0307405_10088215
770 Ga0307405_10919193
771 Ga0307413_10092491
772 Ga0307413_10096075
773 Ga0307413_10804696
774 Ga0307410_10349630
775 Ga0307406_10298790
776 Ga0307406_10333161
777 Ga0307406_10423922
778 Ga0307412_10113554
779 Ga0307412_10173610
780 Ga0307412_10208717
781 Ga0307412_10263799
782 Ga0307412_10386437
783 Ga0307409_100369260
784 Ga0307409_100599604
785 Ga0307416_100001475
786 Ga0307416_100076330
787 Ga0307416_100151161
788 Ga0307416_100278033
789 Ga0307416_100560129
790 Ga0307416_100859049
791 Ga0307416_100871528
792 Ga0307416_101001421
793 Ga0307414_10384651
794 Ga0307411_10013540
795 Ga0307411_10063842
796 Ga0307411_10106035
797 Ga0307411_11077582
798 Ga0307415_100341021
799 Ga0307415_100567237
800 Ga0307415_100996883
801 Ga0307415_101188798
802 Ga0373926_0111132
803 Ga0373952_0016752
804 Ga0373945_0126008
805 Ga0373960_0148756
806 Ga0373943_0103217
807 Ga0373961_0074645
808 Ga0373931_0020925
809 Ga0373931_0703657
810 Ga0373947_0049496
811 Ga0373937_0045368
812 Ga0395905_0790223
813 Ga0436365_0932060
814 Ga0439439_0138885
815 Ga0439461_0014857
816 Ga0451807_2534927
817 Ga0439433_0053422
818 Ga0439443_004489
819 Ga0439445_0016513
820 Ga0439450_005967
821 Ga0439450_068720
822 Ga0439462_0090947
823 Ga0439446_0019040
824 Ga0439434_0115565
825 Ga0439434_0171561
826 Ga0439435_0018111
827 Ga0439435_0166905
828 Ga0451577_0030045
829 Ga0451576_0473348
830 Ga0466967_0201402
831 Ga0466967_0846319
832 Ga0495586_0098277
833 Ga0495677_0145234
834 Ga0495684_0128651
835 Ga0496102_0918436
836 Ga0496104_0010848
837 Ga0496104_1219047
838 Ga0496105_0325356
839 Ga0496106_0121950
840 Ga0496107_0553704
841 Ga0496108_0026135
842 Ga0496108_0078180
843 Ga0496109_0002337
844 Ga0496109_0331935
845 Ga0496109_0544471
846 Ga0496110_0002227
847 Ga0496110_0043036
848 Ga0496111_0051209
849 Ga0496112_0001195
850 Ga0496112_0259365
851 Ga0496112_0512726
852 Ga0496112_0748770
853 Ga0496112_0966568
854 Ga0496113_0310554
855 Ga0496113_0369556
856 Ga0501300_028063
857 Ga0501031_0170537
858 Ga0501031_0228326
859 Ga0501034_0072824
860 Ga0501034_0109095
861 Ga0501036_0253896
862 Ga0501036_0690808
863 Ga0501038_0190430
864 Ga0501038_0208571
865 Ga0501039_0011048
866 Ga0501039_0074531
867 Ga0501039_0201026
868 Ga0501040_0006057
869 Ga0501040_0100173
870 Ga0501040_0172642
871 Ga0501040_0202677
872 Ga0501041_0078786
873 Ga0501042_0009654
874 Ga0501042_0320437
875 Ga0501043_0221444
876 Ga0501043_0436275
877 Ga0501046_0143151
878 Ga0501046_0184143
879 Ga0501047_0217556
880 Ga0501048_0007756
881 Ga0501048_0492369
882 Ga0501067_0055028
883 Ga0501068_0126255
884 Ga0501068_0418941
885 Ga0501069_0044901
886 Ga0501069_0404992
887 Ga0501069_0632548
888 Ga0501071_0009092
889 Ga0501071_0044770
890 Ga0501071_0226388
891 Ga0501071_0506608
892 Ga0501072_0016533
893 Ga0501072_0026015
894 Ga0501072_0230412
895 Ga0501072_0350063
896 Ga0501074_0107537
897 Ga0501074_0273214
898 Ga0501075_0071440
899 Ga0501075_0157189
900 Ga0501075_0186490
901 Ga0501075_0346100
902 Ga0501075_0554592
903 Ga0501076_0054354
904 Ga0501076_0088108
905 Ga0501076_0243271
906 Ga0501077_0026842
907 Ga0501077_0090914
908 Ga0501077_0538898
909 Ga0501198_014284
910 Ga0501079_0211041
911 Ga0501079_0420151
912 Ga0501079_1150592
913 Ga0501080_0129148
914 Ga0501080_0440239
915 Ga0501080_0461683
916 Ga0501080_0591960
917 Ga0501081_0065490
918 Ga0501081_0079942
919 Ga0501081_0121878
920 Ga0501081_0510034
921 Ga0501081_1116998
922 Ga0501083_0443188
923 Ga0501268_018940
924 Ga0501270_086944
925 Ga0501035_0076263
926 Ga0501035_0378628
927 Ga0501045_0008677
928 Ga0501045_0060065
929 Ga0501045_0110634
930 Ga0501045_0187051
931 Ga0501045_0193746
932 nmdc:mga00v17_26518_c1
933 nmdc:mga00v17_36270_c1
934 nmdc:mga06z11_128830_c1
935 nmdc:mga06z11_41967_c1
936 nmdc:mga04h51_325839_c1
937 nmdc:mga05p37_13625_c2
938 nmdc:mga05p37_1541_c1
939 nmdc:mga05p37_1830306_c1
940 nmdc:mga05p37_214321_c1
941 nmdc:mga05p37_2518_c1
942 nmdc:mga05p37_270692_c1
943 nmdc:mga05p37_390139_c1
944 nmdc:mga05p37_461608_c1
945 nmdc:mga09592_1149747_c1
946 nmdc:mga09592_122125_c1
947 nmdc:mga09592_138976_c1
948 nmdc:mga09592_19626_c1
949 nmdc:mga0qj67_21977_c1
950 nmdc:mga0qj67_31365_c1
951 nmdc:mga0qj67_331944_c1
952 nmdc:mga06r32_113603_c1
953 nmdc:mga06r32_169245_c1
954 nmdc:mga06r32_27375_c1
955 nmdc:mga06r32_281293_c1
956 nmdc:mga06r32_582797_c1
957 nmdc:mga06r32_74772_c1
958 nmdc:mga06r32_765334_c1
959 nmdc:mga06r32_795215_c1
960 nmdc:mga08y16_1069171_c1
961 nmdc:mga08y16_1223425_c1
962 nmdc:mga08y16_45515_c1
963 nmdc:mga08y16_75_c1
964 nmdc:mga08y16_92130_c1
965 nmdc:mga0n895_17960_c1
966 nmdc:mga0n895_3583_c1
967 nmdc:mga0n895_50327_c1
968 nmdc:mga0n895_521994_c1
969 nmdc:mga0rr50_339585_c1
970 nmdc:mga0a205_112468_c1
971 nmdc:mga0a205_39866_c1
972 nmdc:mga0a205_567041_c1
973 nmdc:mga0sz30_379722_c1
974 Ga0495601_0270650
975 Ga0495619_0580337
976 Ga0500628_093432
977 Ga0501084_0023477
978 Ga0501084_0060701
979 Ga0501084_0703177
980 Ga0590071_001644
981 Ga0590071_018553
982 Ga0590074_000871
983 Ga0590075_000325
984 Ga0590077_000418
985 Ga0590077_033274
986 Ga0501082_0160684
987 Ga0501082_0194599
988 Ga0501082_0343421
989 Ga0501082_0663870
990 Ga0530510_0017554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02622

DUF179

Uncharacterized ACR, COG1678

36

191

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.8919 8 171
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.8763 8 172
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.835 8 171
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.796 8 172
2hrx-assembly1.cif.gz_A x-ray crystal structure of protein dip2367 from corynebacterium diphtheriae. northeast structural genomics consortium target cdr13. 0.7275 6 177
ID Description Score Start End Superfamily
2aj2A01 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.9363 6 172 3.40.1740.10
2ew0A00 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.8822 8 171 3.40.1740.10
af_P0A8W5_4_171_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8683 6 164 3.40.50.1000
2ew0A00 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.8302 8 171 3.40.1740.10
af_P0A8W5_4_171_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8206 6 164 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1F2TQS6-F1-model_v4 UPF0301 protein A3G21_05680 0.9522 1 182 GO:0005829
AF-A0A2E4FL54-F1-model_v4 UPF0301 protein CL482_04985 0.9472 6 182 GO:0005829
AF-A0A3N5YJ13-F1-model_v4 UPF0301 protein EHM24_22535 0.9363 1 182 GO:0005829
AF-A0A3N5YJ13-F1-model_v4 UPF0301 protein EHM24_22535 0.9313 1 182 GO:0005829
AF-A0A2H5ZKE5-F1-model_v4 UPF0301 protein HRbin30_01275 0.9312 6 182 GO:0005829

Map