F454579

General Info

Members Datasets Scaffolds Average Seq Length
494 229 988 287

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000106|Ga0213875_1000010671
Length 319
Sequence MLIGAHVSPAGGLPKAIERGTEKRCQAIQIFNQSPRQWRPTAYGEDDFAAFRDAMKPSPIKAVLIHAVYLLNCASEDREIRDKSRASLIHSLTVGAGIGAAGVVLHPGSAAGRRAGEPNRRGPTPSGSHRRDGEVAAAIKRAGRVIAQALGETQGCPLHLEDTAGAGGTLGRSFAELAELLDAAGGDTRLGVCLDSCHLLASGYDIRTAPGLTATLDDFGKEVGIRRLRSLHLNDSRTPLGSNRDRHANIGEGELGESGCATFLSEPRFDELPCVLETPGPERQGPTAEEIALCLTLRKRGQASRKRAATRARTSRAKA

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 11.13
Rhizosphere 79.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000106 3300021388 Bacteria 95400
2 Ga0070683_100051247 3300005329 Bacteria 3821
3 Ga0070683_100170204 3300005329 Bacteria 2068
4 Ga0070690_100142567 3300005330 Bacteria 1627
5 Ga0070680_100305679 3300005336 Bacteria 1349
6 Ga0070682_100210046 3300005337 Bacteria 1379
7 Ga0070692_10003344 3300005345 Bacteria 6487
8 Ga0070668_100096925 3300005347 Bacteria 2332
9 Ga0070669_100005455 3300005353 Bacteria 9178
10 Ga0070659_100000013 3300005366 Bacteria 178795
11 Ga0070659_100132160 3300005366 Bacteria 2027
12 Ga0070709_10064986 3300005434 Bacteria 2334
13 Ga0070714_100000355 3300005435 Bacteria 34369
14 Ga0070714_100008926 3300005435 Bacteria 7844
15 Ga0070714_100011637 3300005435 Bacteria 6986
16 Ga0070714_100039548 3300005435 Bacteria 3971
17 Ga0070714_100131431 3300005435 Bacteria 2238
18 Ga0070714_100151515 3300005435 Bacteria 2090
19 Ga0070714_100175858 3300005435 Bacteria 1945
20 Ga0070714_100207289 3300005435 Bacteria 1796
21 Ga0070714_100257962 3300005435 Bacteria 1614
22 Ga0070714_100433183 3300005435 Bacteria 1247
23 Ga0070713_100024879 3300005436 Bacteria 4672
24 Ga0070713_100152286 3300005436 Bacteria 2058
25 Ga0070713_100285035 3300005436 Bacteria 1516
26 Ga0070710_10000015 3300005437 Bacteria 103891
27 Ga0070710_10064828 3300005437 Bacteria 2091
28 Ga0070711_100003862 3300005439 Bacteria 8796
29 Ga0070711_100360957 3300005439 Bacteria 1170
30 Ga0070705_100001282 3300005440 Bacteria 13558
31 Ga0070663_100000956 3300005455 Bacteria 15676
32 Ga0070707_100109638 3300005468 Bacteria 2677
33 Ga0070679_100001408 3300005530 Bacteria 21242
34 Ga0070679_100370561 3300005530 Bacteria 1379
35 Ga0070679_100466630 3300005530 Bacteria 1207
36 Ga0070684_100533895 3300005535 Bacteria 1088
37 Ga0068853_100229329 3300005539 Bacteria 1698
38 Ga0070686_100139581 3300005544 Bacteria 1685
39 Ga0070665_100001866 3300005548 Bacteria 23912
40 Ga0070664_100023781 3300005564 Bacteria 5062
41 Ga0070664_100048204 3300005564 Bacteria 3600
42 Ga0068857_100529097 3300005577 Bacteria 1109
43 Ga0068854_100079831 3300005578 Bacteria 2413
44 Ga0068856_100021817 3300005614 Bacteria 6223
45 Ga0068856_100064417 3300005614 Bacteria 3622
46 Ga0070702_100031418 3300005615 Bacteria 2905
47 Ga0068852_100106430 3300005616 Bacteria 2542
48 Ga0068864_100162232 3300005618 Bacteria 2032
49 Ga0068861_100046791 3300005719 Bacteria 3263
50 Ga0068870_10149606 3300005840 Bacteria 1374
51 Ga0068858_100401862 3300005842 Bacteria 1316
52 Ga0068860_100262507 3300005843 Bacteria 1684
53 Ga0081455_10006595 3300005937 Bacteria 12416
54 Ga0081538_10007117 3300005981 Bacteria 9718
55 Ga0081538_10053094 3300005981 Bacteria 2413
56 Ga0081539_10014131 3300005985 Bacteria 5935
57 Ga0081539_10032728 3300005985 Bacteria 3180
58 Ga0070717_10000059 3300006028 Bacteria 92958
59 Ga0070717_10006505 3300006028 Bacteria 8597
60 Ga0070717_10124764 3300006028 Bacteria 2209
61 Ga0070717_10138816 3300006028 Bacteria 2095
62 Ga0070712_100000050 3300006175 Bacteria 63870
63 Ga0070712_100003930 3300006175 Bacteria 9152
64 Ga0075367_10060886 3300006178 Bacteria 2252
65 Ga0075428_100480466 3300006844 Bacteria 1330
66 Ga0075430_100005591 3300006846 Bacteria 10621
67 Ga0075435_100201611 3300007076 Bacteria 1686
68 Ga0111539_10731244 3300009094 Bacteria 1152
69 Ga0105245_10088020 3300009098 Bacteria 2852
70 Ga0105245_10099043 3300009098 Bacteria 2694
71 Ga0105245_10679759 3300009098 Bacteria 1061
72 Ga0105247_10127562 3300009101 Bacteria 1655
73 Ga0114129_10430841 3300009147 Bacteria 1733
74 Ga0105243_10264610 3300009148 Bacteria 1541
75 Ga0105243_10363897 3300009148 Bacteria 1332
76 Ga0105242_10212235 3300009176 Bacteria 1726
77 Ga0105248_10457989 3300009177 Bacteria 1438
78 Ga0105237_10002855 3300009545 Bacteria 21010
79 Ga0105238_10308946 3300009551 Bacteria 1566
80 Ga0105249_10182215 3300009553 Bacteria 2044
81 Ga0105239_10234470 3300010375 Bacteria 2059
82 Ga0105246_10001906 3300011119 Bacteria 12566
83 Ga0157369_10380692 3300013105 Bacteria 1465
84 Ga0157378_10045177 3300013297 Bacteria 3913
85 Ga0157372_10222421 3300013307 Bacteria 2188
86 Ga0157372_10553244 3300013307 Bacteria 1341
87 Ga0157375_10821063 3300013308 Bacteria 1078
88 Ga0163163_10572760 3300014325 Bacteria 1192
89 Ga0163163_10777746 3300014325 Bacteria 1021
90 Ga0157377_10107129 3300014745 Bacteria 1675
91 Ga0157377_10120651 3300014745 Bacteria 1588
92 Ga0157376_10013434 3300014969 Bacteria 6109
93 Ga0213873_10020573 3300021358 Bacteria 1543
94 Ga0213874_10027078 3300021377 Bacteria 1628
95 Ga0213876_10006195 3300021384 Bacteria 6529
96 Ga0213876_10016850 3300021384 Bacteria 3860
97 Ga0213876_10018320 3300021384 Bacteria 3697
98 Ga0213876_10024390 3300021384 Bacteria 3193
99 Ga0213876_10033375 3300021384 Bacteria 2714
100 Ga0213876_10042423 3300021384 Bacteria 2404
101 Ga0213875_10022251 3300021388 Bacteria 3033
102 Ga0213875_10040509 3300021388 Bacteria 2193
103 Ga0207692_10000013 3300025898 Bacteria 103819
104 Ga0207692_10008320 3300025898 Bacteria 4291
105 Ga0207688_10031322 3300025901 Bacteria 2936
106 Ga0207688_10113024 3300025901 Bacteria 1578
107 Ga0207643_10056122 3300025908 Bacteria 2240
108 Ga0207707_10363532 3300025912 Bacteria 1246
109 Ga0207695_10045768 3300025913 Bacteria 4642
110 Ga0207671_10000406 3300025914 Bacteria 60268
111 Ga0207693_10000151 3300025915 Bacteria 64033
112 Ga0207693_10030023 3300025915 Bacteria 4291
113 Ga0207693_10092243 3300025915 Bacteria 2374
114 Ga0207693_10096696 3300025915 Bacteria 2315
115 Ga0207693_10368809 3300025915 Bacteria 1123
116 Ga0207663_10001263 3300025916 Bacteria 11728
117 Ga0207663_10087869 3300025916 Bacteria 2054
118 Ga0207663_10239441 3300025916 Bacteria 1330
119 Ga0207660_10293545 3300025917 Bacteria 1293
120 Ga0207652_10004337 3300025921 Bacteria 11559
121 Ga0207652_10400935 3300025921 Bacteria 1238
122 Ga0207646_10052888 3300025922 Bacteria 3634
123 Ga0207681_10149122 3300025923 Bacteria 1750
124 Ga0207694_10114619 3300025924 Bacteria 2147
125 Ga0207687_10047049 3300025927 Bacteria 2989
126 Ga0207700_10066875 3300025928 Bacteria 2748
127 Ga0207700_10131880 3300025928 Bacteria 2041
128 Ga0207700_10154445 3300025928 Bacteria 1900
129 Ga0207664_10000331 3300025929 Bacteria 35072
130 Ga0207664_10008731 3300025929 Bacteria 7084
131 Ga0207664_10024773 3300025929 Bacteria 4512
132 Ga0207664_10028236 3300025929 Bacteria 4262
133 Ga0207664_10083709 3300025929 Bacteria 2601
134 Ga0207664_10099647 3300025929 Bacteria 2398
135 Ga0207664_10135867 3300025929 Bacteria 2075
136 Ga0207664_10368321 3300025929 Bacteria 1274
137 Ga0207690_10000075 3300025932 Bacteria 85885
138 Ga0207690_10133371 3300025932 Bacteria 1821
139 Ga0207690_10178610 3300025932 Bacteria 1596
140 Ga0207711_10092299 3300025941 Bacteria 2664
141 Ga0207661_10021692 3300025944 Bacteria 4817
142 Ga0207661_10193730 3300025944 Bacteria 1783
143 Ga0207703_10100252 3300026035 Bacteria 2453
144 Ga0207639_10248044 3300026041 Bacteria 1551
145 Ga0207678_10005666 3300026067 Bacteria 11162
146 Ga0207678_10103480 3300026067 Bacteria 2430
147 Ga0207678_10172987 3300026067 Bacteria 1844
148 Ga0207678_10187283 3300026067 Bacteria 1768
149 Ga0207641_10497510 3300026088 Bacteria 1183
150 Ga0207676_10091893 3300026095 Bacteria 2494
151 Ga0207676_10330427 3300026095 Bacteria 1403
152 Ga0207674_10339326 3300026116 Bacteria 1453
153 Ga0207675_100175355 3300026118 Bacteria 2051
154 Ga0268266_10012068 3300028379 Bacteria 7476
155 Ga0265337_1008720 3300028556 Bacteria 3663
156 Ga0265326_10000023 3300028558 Bacteria 113142
157 Ga0265326_10000587 3300028558 Bacteria 13639
158 Ga0265319_1000084 3300028563 Bacteria 73879
159 Ga0265319_1000147 3300028563 Bacteria 52278
160 Ga0265319_1001040 3300028563 Bacteria 17346
161 Ga0265319_1003583 3300028563 Bacteria 8047
162 Ga0265334_10000094 3300028573 Bacteria 63340
163 Ga0265318_10003087 3300028577 Bacteria 8557
164 Ga0265322_10050452 3300028654 Bacteria 1181
165 Ga0265336_10000004 3300028666 Bacteria 418303
166 Ga0265336_10004740 3300028666 Bacteria 5100
167 Ga0265338_10000012 3300028800 Bacteria 418599
168 Ga0265338_10003073 3300028800 Bacteria 23964
169 Ga0265338_10017938 3300028800 Bacteria 7601
170 Ga0265338_10039663 3300028800 Bacteria 4438
171 Ga0265338_10050747 3300028800 Bacteria 3745
172 Ga0265324_10001935 3300029957 Bacteria 11108
173 Ga0265320_10012992 3300031240 Bacteria 4808
174 Ga0265320_10018161 3300031240 Bacteria 3881
175 Ga0265340_10000001 3300031247 Bacteria 1647668
176 Ga0265327_10004950 3300031251 Bacteria 11448
177 Ga0265327_10023500 3300031251 Bacteria 3650
178 Ga0265316_10226667 3300031344 Bacteria 1377
179 Ga0307408_100009883 3300031548 Bacteria 6288
180 Ga0307408_100515889 3300031548 Bacteria 1049
181 Ga0265314_10083280 3300031711 Bacteria 2103
182 Ga0265342_10045978 3300031712 Bacteria 2625
183 Ga0307405_10103347 3300031731 Bacteria 1916
184 Ga0307405_10162782 3300031731 Bacteria 1582
185 Ga0307413_10056488 3300031824 Bacteria 2395
186 Ga0307410_10484774 3300031852 Bacteria 1015
187 Ga0307407_10003149 3300031903 Bacteria 6679
188 Ga0307407_10285484 3300031903 Bacteria 1145
189 Ga0307409_100039084 3300031995 Bacteria 3517
190 Ga0307416_100344883 3300032002 Bacteria 1504
191 Ga0307415_100161184 3300032126 Bacteria 1739
192 Ga0307415_100287448 3300032126 Bacteria 1355
193 Ga0307415_100374900 3300032126 Bacteria 1206
194 Ga0373954_0095212 3300035118 Bacteria 1433
195 Ga0373956_0024028 3300035119 Bacteria 2621
196 Ga0373943_0093961 3300035170 Bacteria 1557
197 Ga0373955_0091216 3300035172 Bacteria 1737
198 Ga0373937_0063630 3300036401 Bacteria 3393
199 Ga0373925_0063524 3300037068 Bacteria 2778
200 Ga0395900_0001718 3300037418 Bacteria 25307
201 Ga0395900_0376148 3300037418 Bacteria 1389
202 Ga0395898_0000631 3300037466 Bacteria 64382
203 Ga0395898_0083738 3300037466 Bacteria 3074
204 Ga0436364_0058171 3300037853 Bacteria 1382
205 Ga0436364_0247174 3300037853 Bacteria 4781
206 Ga0436364_0507893 3300037853 Bacteria 50699
207 Ga0436364_0575977 3300037853 Bacteria 6746
208 Ga0436364_0737248 3300037853 Bacteria 154680
209 Ga0436364_0902807 3300037853 Bacteria 4219
210 Ga0436364_1042648 3300037853 Bacteria 3372
211 Ga0436364_1052875 3300037853 Bacteria 9684
212 Ga0436364_1101297 3300037853 Bacteria 15265
213 Ga0436364_1533268 3300037853 Bacteria 22684
214 Ga0395901_0108314 3300038443 Bacteria 2917
215 Ga0436365_0113281 3300039437 Bacteria 19851
216 Ga0436365_0424742 3300039437 Bacteria 1866
217 Ga0436365_0445438 3300039437 Bacteria 2777
218 Ga0436365_0716929 3300039437 Bacteria 12555
219 Ga0436365_0955685 3300039437 Bacteria 3460
220 Ga0436365_1295859 3300039437 Bacteria 13419
221 Ga0436365_1458052 3300039437 Bacteria 8630
222 Ga0436365_1671936 3300039437 Bacteria 2899
223 Ga0436365_1716280 3300039437 Bacteria 1945
224 Ga0436365_1882637 3300039437 Bacteria 12677
225 Ga0436365_1911673 3300039437 Bacteria 3390
226 Ga0436360_0999984 3300039438 Bacteria 1340
227 Ga0436363_0143113 3300039450 Bacteria 2390
228 Ga0436363_0360923 3300039450 Bacteria 13447
229 Ga0436363_0373489 3300039450 Bacteria 1379
230 Ga0436363_0430149 3300039450 Bacteria 3041
231 Ga0436363_0736430 3300039450 Bacteria 18930
232 Ga0436363_1488239 3300039450 Bacteria 1871
233 Ga0436363_1528514 3300039450 Bacteria 4346
234 Ga0436362_0011373 3300039453 Bacteria 3067
235 Ga0436362_0459354 3300039453 Bacteria 1341
236 Ga0436362_0525200 3300039453 Bacteria 1985
237 Ga0436362_1201143 3300039453 Bacteria 1864
238 Ga0436362_1291769 3300039453 Bacteria 898
239 Ga0451833_1435828 3300041491 Bacteria 1304
240 Ga0439460_0066476 3300042461 Bacteria 1109
241 Ga0466969_0019848 3300044656 Bacteria 3486
242 Ga0466969_0208808 3300044656 Bacteria 890
243 Ga0466965_0010478 3300044683 Bacteria 4326
244 Ga0466966_0052130 3300044684 Bacteria 2600
245 Ga0466966_0074566 3300044684 Bacteria 2121
246 Ga0466963_0000289 3300044694 Bacteria 22666
247 Ga0466963_0003130 3300044694 Bacteria 9384
248 Ga0466963_0007001 3300044694 Bacteria 6711
249 Ga0466963_0066251 3300044694 Bacteria 2422
250 Ga0466963_0086032 3300044694 Bacteria 2135
251 Ga0466963_0121506 3300044694 Bacteria 1798
252 Ga0466963_0161457 3300044694 Bacteria 1559
253 Ga0466963_0171674 3300044694 Bacteria 1512
254 Ga0466971_0018551 3300044719 Bacteria 3082
255 Ga0466971_0025064 3300044719 Bacteria 2664
256 Ga0466971_0091051 3300044719 Bacteria 1397
257 Ga0466971_0152692 3300044719 Bacteria 1079
258 Ga0466971_0189462 3300044719 Bacteria 969
259 Ga0466968_0016608 3300044735 Bacteria 2933
260 Ga0466968_0022545 3300044735 Bacteria 2559
261 Ga0466968_0090638 3300044735 Bacteria 1354
262 Ga0466970_0132080 3300044765 Bacteria 1372
263 Ga0466957_0001241 3300044842 Bacteria 13295
264 Ga0466957_0004393 3300044842 Bacteria 7844
265 Ga0466957_0074001 3300044842 Bacteria 2112
266 Ga0466957_0135230 3300044842 Bacteria 1583
267 Ga0466957_0155324 3300044842 Bacteria 1483
268 Ga0466959_0016429 3300045049 Bacteria 5408
269 Ga0466959_0017059 3300045049 Bacteria 5316
270 Ga0466959_0092934 3300045049 Bacteria 2165
271 Ga0466959_0146362 3300045049 Bacteria 1667
272 Ga0466959_0285888 3300045049 Bacteria 1131
273 Ga0466959_0369460 3300045049 Bacteria 977
274 Ga0466958_0003810 3300045836 Bacteria 7878
275 Ga0466958_0009445 3300045836 Bacteria 5435
276 Ga0466958_0010019 3300045836 Bacteria 5295
277 Ga0466958_0012749 3300045836 Bacteria 4766
278 Ga0466958_0013297 3300045836 Bacteria 4683
279 Ga0466958_0022909 3300045836 Bacteria 3662
280 Ga0466958_0026267 3300045836 Bacteria 3441
281 Ga0466958_0064882 3300045836 Bacteria 2228
282 Ga0466958_0077559 3300045836 Bacteria 2041
283 Ga0466958_0084600 3300045836 Bacteria 1956
284 Ga0466958_0131058 3300045836 Bacteria 1574
285 Ga0466967_0008600 3300045976 Bacteria 7502
286 Ga0466967_0011564 3300045976 Bacteria 6696
287 Ga0466967_0015570 3300045976 Bacteria 5964
288 Ga0466967_0019322 3300045976 Bacteria 5475
289 Ga0466967_0045227 3300045976 Bacteria 3824
290 Ga0466967_0053995 3300045976 Bacteria 3534
291 Ga0466967_0056913 3300045976 Bacteria 3450
292 Ga0466967_0062929 3300045976 Bacteria 3295
293 Ga0466967_0149604 3300045976 Bacteria 2181
294 Ga0466967_0400718 3300045976 Bacteria 1335
295 Ga0495592_0039355 3300046454 Bacteria 3552
296 Ga0495641_0030061 3300046461 Bacteria 2610
297 Ga0495651_0221386 3300046462 Bacteria 1309
298 Ga0495653_0001695 3300046463 Bacteria 17331
299 Ga0495664_0000011 3300046477 Bacteria 253351
300 Ga0495664_0228224 3300046477 Bacteria 1127
301 Ga0495594_0000011 3300046499 Bacteria 118444
302 Ga0495608_0003879 3300046511 Bacteria 10747
303 Ga0495618_0000149 3300046514 Bacteria 49623
304 Ga0495618_0014721 3300046514 Bacteria 4770
305 Ga0495618_0188183 3300046514 Bacteria 1310
306 Ga0495628_0049538 3300046516 Bacteria 3326
307 Ga0495630_0000182 3300046517 Bacteria 48697
308 Ga0495630_0094591 3300046517 Bacteria 2259
309 Ga0495652_0012851 3300046529 Bacteria 7543
310 Ga0495652_0030002 3300046529 Bacteria 4772
311 Ga0495652_0066401 3300046529 Bacteria 3028
312 Ga0495587_0023943 3300046536 Bacteria 3747
313 Ga0495645_0000023 3300046543 Bacteria 130982
314 Ga0495645_0000181 3300046543 Bacteria 44474
315 Ga0495645_0184025 3300046543 Bacteria 1429
316 Ga0495667_0090229 3300046559 Bacteria 1986
317 Ga0495635_0014024 3300046663 Bacteria 5608
318 Ga0495657_0000213 3300046675 Bacteria 52360
319 Ga0495657_0011453 3300046675 Bacteria 6629
320 Ga0495599_0072609 3300046678 Bacteria 2148
321 Ga0495646_0005200 3300046680 Bacteria 8208
322 Ga0495646_0211478 3300046680 Bacteria 1052
323 Ga0495613_0019719 3300046689 Bacteria 5026
324 Ga0495613_0115057 3300046689 Bacteria 1936
325 Ga0495600_0019326 3300046809 Bacteria 4350
326 Ga0495604_0003942 3300047317 Bacteria 11815
327 Ga0495604_0015615 3300047317 Bacteria 6063
328 Ga0495674_0032636 3300047319 Bacteria 4722
329 Ga0495672_0013753 3300047320 Bacteria 5569
330 Ga0495676_0060128 3300047321 Bacteria 2980
331 Ga0495680_0007443 3300047322 Bacteria 10036
332 Ga0495684_0011522 3300047471 Bacteria 6831
333 Ga0496100_0000550 3300048903 Bacteria 17789
334 Ga0496100_0002681 3300048903 Bacteria 9078
335 Ga0496100_0008555 3300048903 Bacteria 5712
336 Ga0496101_0000482 3300048904 Bacteria 25132
337 Ga0496101_0005976 3300048904 Bacteria 7803
338 Ga0496101_0314433 3300048904 Bacteria 1228
339 Ga0496102_0000053 3300048905 Bacteria 176385
340 Ga0496102_0017531 3300048905 Bacteria 6272
341 Ga0496102_0043359 3300048905 Bacteria 4079
342 Ga0496103_0000411 3300048906 Bacteria 37997
343 Ga0496103_0077180 3300048906 Bacteria 2091
344 Ga0496104_0000036 3300048907 Bacteria 180472
345 Ga0496104_0008601 3300048907 Bacteria 9077
346 Ga0496104_0015670 3300048907 Bacteria 6875
347 Ga0496104_0181289 3300048907 Bacteria 2016
348 Ga0496104_0285821 3300048907 Bacteria 1562
349 Ga0496104_0318231 3300048907 Bacteria 1469
350 Ga0496104_0558862 3300048907 Bacteria 1055
351 Ga0496105_0058221 3300048908 Bacteria 3190
352 Ga0496105_0224128 3300048908 Bacteria 1530
353 Ga0496105_0263527 3300048908 Bacteria 1393
354 Ga0496106_0005926 3300048909 Bacteria 9035
355 Ga0496106_0155508 3300048909 Bacteria 1805
356 Ga0496107_0006912 3300048910 Bacteria 7817
357 Ga0496108_0019473 3300048911 Bacteria 5573
358 Ga0496108_0023719 3300048911 Bacteria 5049
359 Ga0496108_0194661 3300048911 Bacteria 1758
360 Ga0496109_0003335 3300048912 Bacteria 13433
361 Ga0496109_0007640 3300048912 Bacteria 9167
362 Ga0496109_0066382 3300048912 Bacteria 3303
363 Ga0496109_0360988 3300048912 Bacteria 1372
364 Ga0496110_0000378 3300048913 Bacteria 29857
365 Ga0496110_0002877 3300048913 Bacteria 13011
366 Ga0496110_0040129 3300048913 Bacteria 4079
367 Ga0496110_0064163 3300048913 Bacteria 3245
368 Ga0496111_0000350 3300048914 Bacteria 22852
369 Ga0496111_0032037 3300048914 Bacteria 3747
370 Ga0496111_0039447 3300048914 Bacteria 3385
371 Ga0496112_0000454 3300048915 Bacteria 27324
372 Ga0496112_0017750 3300048915 Bacteria 6697
373 Ga0496112_0038790 3300048915 Bacteria 4653
374 Ga0496112_0044560 3300048915 Bacteria 4347
375 Ga0496112_0092357 3300048915 Bacteria 2996
376 Ga0496112_0170818 3300048915 Bacteria 2139
377 Ga0496112_0258956 3300048915 Bacteria 1689
378 Ga0496112_0649218 3300048915 Bacteria 985
379 Ga0496113_0068502 3300048916 Bacteria 2693
380 Ga0496113_0097648 3300048916 Bacteria 2273
381 Ga0496113_0143723 3300048916 Bacteria 1878
382 Ga0496113_0439980 3300048916 Bacteria 1047
383 Ga0496114_0230517 3300048917 Bacteria 1627
384 Ga0496115_0000006 3300048918 Bacteria 252944
385 Ga0496115_0000064 3300048918 Bacteria 99309
386 Ga0496115_0011977 3300048918 Bacteria 6516
387 Ga0496115_0072615 3300048918 Bacteria 2792
388 Ga0496121_0070417 3300048924 Bacteria 2817
389 Ga0496122_0155508 3300048925 Bacteria 1404
390 Ga0501031_0002856 3300049568 Bacteria 11032
391 Ga0501032_0000297 3300049569 Bacteria 41782
392 Ga0501033_0001109 3300049570 Bacteria 24436
393 Ga0501033_0006341 3300049570 Bacteria 9271
394 Ga0501033_0385191 3300049570 Bacteria 979
395 Ga0501034_0038342 3300049571 Bacteria 4852
396 Ga0501034_0043272 3300049571 Bacteria 4558
397 Ga0501036_0024005 3300049572 Bacteria 5139
398 Ga0501036_0053177 3300049572 Bacteria 3430
399 Ga0501036_0104323 3300049572 Bacteria 2397
400 Ga0501037_0000452 3300049573 Bacteria 33455
401 Ga0501037_0031882 3300049573 Bacteria 3891
402 Ga0501037_0130419 3300049573 Bacteria 1803
403 Ga0501038_0001076 3300049574 Bacteria 24669
404 Ga0501038_0022495 3300049574 Bacteria 5648
405 Ga0501039_0014615 3300049575 Bacteria 6009
406 Ga0501039_0018657 3300049575 Bacteria 5326
407 Ga0501040_0026027 3300049576 Bacteria 3936
408 Ga0501040_0099235 3300049576 Bacteria 2030
409 Ga0501040_0119045 3300049576 Bacteria 1852
410 Ga0501040_0127586 3300049576 Bacteria 1787
411 Ga0501041_0015762 3300049577 Bacteria 4490
412 Ga0501041_0071750 3300049577 Bacteria 2126
413 Ga0501042_0017980 3300049578 Bacteria 4889
414 Ga0501042_0066221 3300049578 Bacteria 2582
415 Ga0501042_0068626 3300049578 Bacteria 2535
416 Ga0501042_0190721 3300049578 Bacteria 1478
417 Ga0501043_0001014 3300049579 Bacteria 24659
418 Ga0501043_0023939 3300049579 Bacteria 4790
419 Ga0501046_0001243 3300049580 Bacteria 24668
420 Ga0501046_0003800 3300049580 Bacteria 13821
421 Ga0501046_0055512 3300049580 Bacteria 3112
422 Ga0501047_0000513 3300049581 Bacteria 41790
423 Ga0501047_0009245 3300049581 Bacteria 9306
424 Ga0501047_0071366 3300049581 Bacteria 3343
425 Ga0501047_0206697 3300049581 Bacteria 1822
426 Ga0501048_0016262 3300049582 Bacteria 5484
427 Ga0501048_0117431 3300049582 Bacteria 1879
428 Ga0501067_0004862 3300049583 Bacteria 7458
429 Ga0501068_0018844 3300049584 Bacteria 3999
430 Ga0501068_0027715 3300049584 Bacteria 3346
431 Ga0501069_0000975 3300049585 Bacteria 13613
432 Ga0501069_0015737 3300049585 Bacteria 4054
433 Ga0501069_0071899 3300049585 Bacteria 1939
434 Ga0501070_0000351 3300049586 Bacteria 41785
435 Ga0501071_0062777 3300049587 Bacteria 2692
436 Ga0501071_0094038 3300049587 Bacteria 2204
437 Ga0501071_0134035 3300049587 Bacteria 1842
438 Ga0501072_0031948 3300049588 Bacteria 4121
439 Ga0501072_0079060 3300049588 Bacteria 2604
440 Ga0501072_0186940 3300049588 Bacteria 1652
441 Ga0501072_0312707 3300049588 Bacteria 1248
442 Ga0501073_0007102 3300049589 Bacteria 8338
443 Ga0501073_0035784 3300049589 Bacteria 3527
444 Ga0501073_0192015 3300049589 Bacteria 1413
445 Ga0501073_0322338 3300049589 Bacteria 1067
446 Ga0501074_0013051 3300049590 Bacteria 6040
447 Ga0501074_0036177 3300049590 Bacteria 3577
448 Ga0501074_0067425 3300049590 Bacteria 2573
449 Ga0501074_0090306 3300049590 Bacteria 2194
450 Ga0501075_0076407 3300049591 Bacteria 2533
451 Ga0501075_0209883 3300049591 Bacteria 1485
452 Ga0501076_0010370 3300049592 Bacteria 6913
453 Ga0501076_0089453 3300049592 Bacteria 2475
454 Ga0501076_0200970 3300049592 Bacteria 1627
455 Ga0501077_0036905 3300049593 Bacteria 3114
456 Ga0501079_0004712 3300049741 Bacteria 10093
457 Ga0501079_0056871 3300049741 Bacteria 3018
458 Ga0501079_0061776 3300049741 Bacteria 2890
459 Ga0501079_0094955 3300049741 Bacteria 2311
460 Ga0501079_0120248 3300049741 Bacteria 2042
461 Ga0501080_0048883 3300049742 Bacteria 3936
462 Ga0501080_0165504 3300049742 Bacteria 2041
463 Ga0501080_0181474 3300049742 Bacteria 1936
464 Ga0501083_0005854 3300049744 Bacteria 8703
465 Ga0501083_0011414 3300049744 Bacteria 6231
466 Ga0501083_0074752 3300049744 Bacteria 2251
467 Ga0501035_0003467 3300049822 Bacteria 15104
468 Ga0501035_0025990 3300049822 Bacteria 5363
469 Ga0501035_0101915 3300049822 Bacteria 2519
470 Ga0501044_0001061 3300049823 Bacteria 33060
471 Ga0501044_0088349 3300049823 Bacteria 3129
472 Ga0501044_0183886 3300049823 Bacteria 2056
473 Ga0501045_0046174 3300049824 Bacteria 3172
474 Ga0501045_0112564 3300049824 Bacteria 2018
475 Ga0501045_0117906 3300049824 Bacteria 1970
476 Ga0501045_0203088 3300049824 Bacteria 1477
477 nmdc:mga09592_219270_c1 3300050508 Bacteria 1648
478 nmdc:mga08y16_79092_c1 3300050511 Bacteria 3427
479 Ga0495601_0003139 3300053077 Bacteria 9454
480 Ga0495612_0000057 3300053078 Bacteria 49938
481 Ga0495595_0020267 3300053084 Bacteria 2893
482 Ga0495619_0001172 3300053085 Bacteria 17234
483 Ga0495619_0010562 3300053085 Bacteria 5810
484 Ga0500556_0001191 3300053104 Bacteria 12336
485 Ga0500616_0005938 3300053153 Bacteria 8151
486 Ga0501084_0013057 3300054114 Bacteria 6873
487 Ga0501084_0041490 3300054114 Bacteria 3850
488 Ga0501084_0134768 3300054114 Bacteria 2079
489 Ga0501082_0012216 3300060353 Bacteria 7378
490 Ga0501082_0058917 3300060353 Bacteria 3309
491 Ga0501082_0059055 3300060353 Bacteria 3305
492 Ga0466962_0006004 3300061719 Bacteria 5839
493 Ga0466962_0044756 3300061719 Bacteria 2117
494 Ga0530510_0046248 3300061734 Bacteria 3144
495 Ga0213875_10000106
496 Ga0070683_100051247
497 Ga0070683_100170204
498 Ga0070690_100142567
499 Ga0070680_100305679
500 Ga0070682_100210046
501 Ga0070692_10003344
502 Ga0070668_100096925
503 Ga0070669_100005455
504 Ga0070659_100000013
505 Ga0070659_100132160
506 Ga0070709_10064986
507 Ga0070714_100000355
508 Ga0070714_100008926
509 Ga0070714_100011637
510 Ga0070714_100039548
511 Ga0070714_100131431
512 Ga0070714_100151515
513 Ga0070714_100175858
514 Ga0070714_100207289
515 Ga0070714_100257962
516 Ga0070714_100433183
517 Ga0070713_100024879
518 Ga0070713_100152286
519 Ga0070713_100285035
520 Ga0070710_10000015
521 Ga0070710_10064828
522 Ga0070711_100003862
523 Ga0070711_100360957
524 Ga0070705_100001282
525 Ga0070663_100000956
526 Ga0070707_100109638
527 Ga0070679_100001408
528 Ga0070679_100370561
529 Ga0070679_100466630
530 Ga0070684_100533895
531 Ga0068853_100229329
532 Ga0070686_100139581
533 Ga0070665_100001866
534 Ga0070664_100023781
535 Ga0070664_100048204
536 Ga0068857_100529097
537 Ga0068854_100079831
538 Ga0068856_100021817
539 Ga0068856_100064417
540 Ga0070702_100031418
541 Ga0068852_100106430
542 Ga0068864_100162232
543 Ga0068861_100046791
544 Ga0068870_10149606
545 Ga0068858_100401862
546 Ga0068860_100262507
547 Ga0081455_10006595
548 Ga0081538_10007117
549 Ga0081538_10053094
550 Ga0081539_10014131
551 Ga0081539_10032728
552 Ga0070717_10000059
553 Ga0070717_10006505
554 Ga0070717_10124764
555 Ga0070717_10138816
556 Ga0070712_100000050
557 Ga0070712_100003930
558 Ga0075367_10060886
559 Ga0075428_100480466
560 Ga0075430_100005591
561 Ga0075435_100201611
562 Ga0111539_10731244
563 Ga0105245_10088020
564 Ga0105245_10099043
565 Ga0105245_10679759
566 Ga0105247_10127562
567 Ga0114129_10430841
568 Ga0105243_10264610
569 Ga0105243_10363897
570 Ga0105242_10212235
571 Ga0105248_10457989
572 Ga0105237_10002855
573 Ga0105238_10308946
574 Ga0105249_10182215
575 Ga0105239_10234470
576 Ga0105246_10001906
577 Ga0157369_10380692
578 Ga0157378_10045177
579 Ga0157372_10222421
580 Ga0157372_10553244
581 Ga0157375_10821063
582 Ga0163163_10572760
583 Ga0163163_10777746
584 Ga0157377_10107129
585 Ga0157377_10120651
586 Ga0157376_10013434
587 Ga0213873_10020573
588 Ga0213874_10027078
589 Ga0213876_10006195
590 Ga0213876_10016850
591 Ga0213876_10018320
592 Ga0213876_10024390
593 Ga0213876_10033375
594 Ga0213876_10042423
595 Ga0213875_10022251
596 Ga0213875_10040509
597 Ga0207692_10000013
598 Ga0207692_10008320
599 Ga0207688_10031322
600 Ga0207688_10113024
601 Ga0207643_10056122
602 Ga0207707_10363532
603 Ga0207695_10045768
604 Ga0207671_10000406
605 Ga0207693_10000151
606 Ga0207693_10030023
607 Ga0207693_10092243
608 Ga0207693_10096696
609 Ga0207693_10368809
610 Ga0207663_10001263
611 Ga0207663_10087869
612 Ga0207663_10239441
613 Ga0207660_10293545
614 Ga0207652_10004337
615 Ga0207652_10400935
616 Ga0207646_10052888
617 Ga0207681_10149122
618 Ga0207694_10114619
619 Ga0207687_10047049
620 Ga0207700_10066875
621 Ga0207700_10131880
622 Ga0207700_10154445
623 Ga0207664_10000331
624 Ga0207664_10008731
625 Ga0207664_10024773
626 Ga0207664_10028236
627 Ga0207664_10083709
628 Ga0207664_10099647
629 Ga0207664_10135867
630 Ga0207664_10368321
631 Ga0207690_10000075
632 Ga0207690_10133371
633 Ga0207690_10178610
634 Ga0207711_10092299
635 Ga0207661_10021692
636 Ga0207661_10193730
637 Ga0207703_10100252
638 Ga0207639_10248044
639 Ga0207678_10005666
640 Ga0207678_10103480
641 Ga0207678_10172987
642 Ga0207678_10187283
643 Ga0207641_10497510
644 Ga0207676_10091893
645 Ga0207676_10330427
646 Ga0207674_10339326
647 Ga0207675_100175355
648 Ga0268266_10012068
649 Ga0265337_1008720
650 Ga0265326_10000023
651 Ga0265326_10000587
652 Ga0265319_1000084
653 Ga0265319_1000147
654 Ga0265319_1001040
655 Ga0265319_1003583
656 Ga0265334_10000094
657 Ga0265318_10003087
658 Ga0265322_10050452
659 Ga0265336_10000004
660 Ga0265336_10004740
661 Ga0265338_10000012
662 Ga0265338_10003073
663 Ga0265338_10017938
664 Ga0265338_10039663
665 Ga0265338_10050747
666 Ga0265324_10001935
667 Ga0265320_10012992
668 Ga0265320_10018161
669 Ga0265340_10000001
670 Ga0265327_10004950
671 Ga0265327_10023500
672 Ga0265316_10226667
673 Ga0307408_100009883
674 Ga0307408_100515889
675 Ga0265314_10083280
676 Ga0265342_10045978
677 Ga0307405_10103347
678 Ga0307405_10162782
679 Ga0307413_10056488
680 Ga0307410_10484774
681 Ga0307407_10003149
682 Ga0307407_10285484
683 Ga0307409_100039084
684 Ga0307416_100344883
685 Ga0307415_100161184
686 Ga0307415_100287448
687 Ga0307415_100374900
688 Ga0373954_0095212
689 Ga0373956_0024028
690 Ga0373943_0093961
691 Ga0373955_0091216
692 Ga0373937_0063630
693 Ga0373925_0063524
694 Ga0395900_0001718
695 Ga0395900_0376148
696 Ga0395898_0000631
697 Ga0395898_0083738
698 Ga0436364_0058171
699 Ga0436364_0247174
700 Ga0436364_0507893
701 Ga0436364_0575977
702 Ga0436364_0737248
703 Ga0436364_0902807
704 Ga0436364_1042648
705 Ga0436364_1052875
706 Ga0436364_1101297
707 Ga0436364_1533268
708 Ga0395901_0108314
709 Ga0436365_0113281
710 Ga0436365_0424742
711 Ga0436365_0445438
712 Ga0436365_0716929
713 Ga0436365_0955685
714 Ga0436365_1295859
715 Ga0436365_1458052
716 Ga0436365_1671936
717 Ga0436365_1716280
718 Ga0436365_1882637
719 Ga0436365_1911673
720 Ga0436360_0999984
721 Ga0436363_0143113
722 Ga0436363_0360923
723 Ga0436363_0373489
724 Ga0436363_0430149
725 Ga0436363_0736430
726 Ga0436363_1488239
727 Ga0436363_1528514
728 Ga0436362_0011373
729 Ga0436362_0459354
730 Ga0436362_0525200
731 Ga0436362_1201143
732 Ga0436362_1291769
733 Ga0451833_1435828
734 Ga0439460_0066476
735 Ga0466969_0019848
736 Ga0466969_0208808
737 Ga0466965_0010478
738 Ga0466966_0052130
739 Ga0466966_0074566
740 Ga0466963_0000289
741 Ga0466963_0003130
742 Ga0466963_0007001
743 Ga0466963_0066251
744 Ga0466963_0086032
745 Ga0466963_0121506
746 Ga0466963_0161457
747 Ga0466963_0171674
748 Ga0466971_0018551
749 Ga0466971_0025064
750 Ga0466971_0091051
751 Ga0466971_0152692
752 Ga0466971_0189462
753 Ga0466968_0016608
754 Ga0466968_0022545
755 Ga0466968_0090638
756 Ga0466970_0132080
757 Ga0466957_0001241
758 Ga0466957_0004393
759 Ga0466957_0074001
760 Ga0466957_0135230
761 Ga0466957_0155324
762 Ga0466959_0016429
763 Ga0466959_0017059
764 Ga0466959_0092934
765 Ga0466959_0146362
766 Ga0466959_0285888
767 Ga0466959_0369460
768 Ga0466958_0003810
769 Ga0466958_0009445
770 Ga0466958_0010019
771 Ga0466958_0012749
772 Ga0466958_0013297
773 Ga0466958_0022909
774 Ga0466958_0026267
775 Ga0466958_0064882
776 Ga0466958_0077559
777 Ga0466958_0084600
778 Ga0466958_0131058
779 Ga0466967_0008600
780 Ga0466967_0011564
781 Ga0466967_0015570
782 Ga0466967_0019322
783 Ga0466967_0045227
784 Ga0466967_0053995
785 Ga0466967_0056913
786 Ga0466967_0062929
787 Ga0466967_0149604
788 Ga0466967_0400718
789 Ga0495592_0039355
790 Ga0495641_0030061
791 Ga0495651_0221386
792 Ga0495653_0001695
793 Ga0495664_0000011
794 Ga0495664_0228224
795 Ga0495594_0000011
796 Ga0495608_0003879
797 Ga0495618_0000149
798 Ga0495618_0014721
799 Ga0495618_0188183
800 Ga0495628_0049538
801 Ga0495630_0000182
802 Ga0495630_0094591
803 Ga0495652_0012851
804 Ga0495652_0030002
805 Ga0495652_0066401
806 Ga0495587_0023943
807 Ga0495645_0000023
808 Ga0495645_0000181
809 Ga0495645_0184025
810 Ga0495667_0090229
811 Ga0495635_0014024
812 Ga0495657_0000213
813 Ga0495657_0011453
814 Ga0495599_0072609
815 Ga0495646_0005200
816 Ga0495646_0211478
817 Ga0495613_0019719
818 Ga0495613_0115057
819 Ga0495600_0019326
820 Ga0495604_0003942
821 Ga0495604_0015615
822 Ga0495674_0032636
823 Ga0495672_0013753
824 Ga0495676_0060128
825 Ga0495680_0007443
826 Ga0495684_0011522
827 Ga0496100_0000550
828 Ga0496100_0002681
829 Ga0496100_0008555
830 Ga0496101_0000482
831 Ga0496101_0005976
832 Ga0496101_0314433
833 Ga0496102_0000053
834 Ga0496102_0017531
835 Ga0496102_0043359
836 Ga0496103_0000411
837 Ga0496103_0077180
838 Ga0496104_0000036
839 Ga0496104_0008601
840 Ga0496104_0015670
841 Ga0496104_0181289
842 Ga0496104_0285821
843 Ga0496104_0318231
844 Ga0496104_0558862
845 Ga0496105_0058221
846 Ga0496105_0224128
847 Ga0496105_0263527
848 Ga0496106_0005926
849 Ga0496106_0155508
850 Ga0496107_0006912
851 Ga0496108_0019473
852 Ga0496108_0023719
853 Ga0496108_0194661
854 Ga0496109_0003335
855 Ga0496109_0007640
856 Ga0496109_0066382
857 Ga0496109_0360988
858 Ga0496110_0000378
859 Ga0496110_0002877
860 Ga0496110_0040129
861 Ga0496110_0064163
862 Ga0496111_0000350
863 Ga0496111_0032037
864 Ga0496111_0039447
865 Ga0496112_0000454
866 Ga0496112_0017750
867 Ga0496112_0038790
868 Ga0496112_0044560
869 Ga0496112_0092357
870 Ga0496112_0170818
871 Ga0496112_0258956
872 Ga0496112_0649218
873 Ga0496113_0068502
874 Ga0496113_0097648
875 Ga0496113_0143723
876 Ga0496113_0439980
877 Ga0496114_0230517
878 Ga0496115_0000006
879 Ga0496115_0000064
880 Ga0496115_0011977
881 Ga0496115_0072615
882 Ga0496121_0070417
883 Ga0496122_0155508
884 Ga0501031_0002856
885 Ga0501032_0000297
886 Ga0501033_0001109
887 Ga0501033_0006341
888 Ga0501033_0385191
889 Ga0501034_0038342
890 Ga0501034_0043272
891 Ga0501036_0024005
892 Ga0501036_0053177
893 Ga0501036_0104323
894 Ga0501037_0000452
895 Ga0501037_0031882
896 Ga0501037_0130419
897 Ga0501038_0001076
898 Ga0501038_0022495
899 Ga0501039_0014615
900 Ga0501039_0018657
901 Ga0501040_0026027
902 Ga0501040_0099235
903 Ga0501040_0119045
904 Ga0501040_0127586
905 Ga0501041_0015762
906 Ga0501041_0071750
907 Ga0501042_0017980
908 Ga0501042_0066221
909 Ga0501042_0068626
910 Ga0501042_0190721
911 Ga0501043_0001014
912 Ga0501043_0023939
913 Ga0501046_0001243
914 Ga0501046_0003800
915 Ga0501046_0055512
916 Ga0501047_0000513
917 Ga0501047_0009245
918 Ga0501047_0071366
919 Ga0501047_0206697
920 Ga0501048_0016262
921 Ga0501048_0117431
922 Ga0501067_0004862
923 Ga0501068_0018844
924 Ga0501068_0027715
925 Ga0501069_0000975
926 Ga0501069_0015737
927 Ga0501069_0071899
928 Ga0501070_0000351
929 Ga0501071_0062777
930 Ga0501071_0094038
931 Ga0501071_0134035
932 Ga0501072_0031948
933 Ga0501072_0079060
934 Ga0501072_0186940
935 Ga0501072_0312707
936 Ga0501073_0007102
937 Ga0501073_0035784
938 Ga0501073_0192015
939 Ga0501073_0322338
940 Ga0501074_0013051
941 Ga0501074_0036177
942 Ga0501074_0067425
943 Ga0501074_0090306
944 Ga0501075_0076407
945 Ga0501075_0209883
946 Ga0501076_0010370
947 Ga0501076_0089453
948 Ga0501076_0200970
949 Ga0501077_0036905
950 Ga0501079_0004712
951 Ga0501079_0056871
952 Ga0501079_0061776
953 Ga0501079_0094955
954 Ga0501079_0120248
955 Ga0501080_0048883
956 Ga0501080_0165504
957 Ga0501080_0181474
958 Ga0501083_0005854
959 Ga0501083_0011414
960 Ga0501083_0074752
961 Ga0501035_0003467
962 Ga0501035_0025990
963 Ga0501035_0101915
964 Ga0501044_0001061
965 Ga0501044_0088349
966 Ga0501044_0183886
967 Ga0501045_0046174
968 Ga0501045_0112564
969 Ga0501045_0117906
970 Ga0501045_0203088
971 nmdc:mga09592_219270_c1
972 nmdc:mga08y16_79092_c1
973 Ga0495601_0003139
974 Ga0495612_0000057
975 Ga0495595_0020267
976 Ga0495619_0001172
977 Ga0495619_0010562
978 Ga0500556_0001191
979 Ga0500616_0005938
980 Ga0501084_0013057
981 Ga0501084_0041490
982 Ga0501084_0134768
983 Ga0501082_0012216
984 Ga0501082_0058917
985 Ga0501082_0059055
986 Ga0466962_0006004
987 Ga0466962_0044756
988 Ga0530510_0046248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

22

297

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k1g-assembly2.cif.gz_B structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair 0.9404 2 278
2nq9-assembly1.cif.gz_A high resolution crystal structure of escherichia coli endonuclease iv (endo iv) y72a mutant bound to damaged dna 0.9383 2 278
1qum-assembly1.cif.gz_A crystal structure of escherichia coli endonuclease iv in complex with damaged dna 0.9379 2 278
4hno-assembly1.cif.gz_A high resolution crystal structure of dna apurinic/apyrimidinic (ap) endonuclease iv nfo from thermatoga maritima 0.9378 1 280
4k1g-assembly2.cif.gz_B structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair 0.9307 2 278
ID Description Score Start End Superfamily
af_A0A2R8Q599_47_340_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9604 2 277 3.20.20.150
af_Q8IE02_304_597_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9573 2 277 3.20.20.150
af_Q966U0_262_539_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9465 3 277 3.20.20.150
af_Q10002_117_395_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9447 2 277 3.20.20.150
1qumA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9379 2 278 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A838CYH5-F1-model_v4 Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV) 0.9934 1 286 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-A0A537YPV9-F1-model_v4 Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV) 0.9929 1 287 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-A0A7W1NG32-F1-model_v4 deleted 0.9922 44 285
AF-A0A6J4RKP9-F1-model_v4 Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV) 0.9915 1 285 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-A0A7W0RI40-F1-model_v4 Deoxyribonuclease IV 0.9904 1 251 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270

Map