F454530

General Info

Members Datasets Scaffolds Average Seq Length
494 215 988 198

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100179088|Ga0070688_1001790882
Length 238
Sequence VHVPDDRIGRGRACFPLGRLPSVEQRCYFVGVLPGSFFQIDPLQCAENLVGSELVWGKCAGIVVETEAYLVEGDQASHTFNRPSARAFVERNKPGAAYIYFNYGVHWMLNVLVKDGPRDGLILIRAIEPRRGLAIMRQRRGLKDIRRLCSGPGKLTQALAITKRHHEIDLSSDPAHCFRARLDPEVSVVADRRIGISRAKDFPWRFTLLGSQFLSVPVRAPKLSSRAGEARRAVTQAA

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.11
Rhizosphere 90.69
Stem 0
Stem Tuber 0
Unclassified 28.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100179088 3300005365 Bacteria 1469
2 SwRhRL3b_contig_1743896 2162886006 Unclassified 930
3 SwRhRL2b_contig_339522 2162886007 Bacteria 1762
4 SwRhRL2b_contig_624290 2162886007 Bacteria 1423
5 JGI24035J26624_1001490 3300002126 Bacteria 2210
6 JGI25404J52841_10003112 3300003659 Bacteria 3240
7 JGI25405J52794_10004818 3300003911 Bacteria 2420
8 Ga0065704_10016980 3300005289 Bacteria 2315
9 Ga0065704_10082514 3300005289 Bacteria 3590
10 Ga0065704_10436574 3300005289 Unclassified 718
11 Ga0065712_10013465 3300005290 Bacteria 1838
12 Ga0065712_10013728 3300005290 Bacteria 2377
13 Ga0065712_10078885 3300005290 Unclassified 3279
14 Ga0065715_10005815 3300005293 Bacteria 5292
15 Ga0065715_10012033 3300005293 Bacteria 2527
16 Ga0065715_10126884 3300005293 Bacteria 2099
17 Ga0065715_10164222 3300005293 Unclassified 1583
18 Ga0065715_10211939 3300005293 Unclassified 1310
19 Ga0065715_10346230 3300005293 Unclassified 950
20 Ga0065707_10004285 3300005295 Unclassified 3898
21 Ga0065707_10028591 3300005295 Unclassified 1408
22 Ga0065707_10293931 3300005295 Bacteria 1019
23 Ga0070676_10000696 3300005328 Bacteria 16507
24 Ga0070676_10050689 3300005328 Bacteria 2434
25 Ga0070683_100144614 3300005329 Unclassified 2253
26 Ga0070683_100175161 3300005329 Unclassified 2036
27 Ga0070683_100536251 3300005329 Unclassified 1119
28 Ga0070690_100045006 3300005330 Bacteria 2802
29 Ga0070690_100053220 3300005330 Bacteria 2589
30 Ga0070670_100102061 3300005331 Bacteria 2470
31 Ga0070670_100135466 3300005331 Bacteria 2128
32 Ga0070670_100156536 3300005331 Bacteria 1973
33 Ga0070677_10065649 3300005333 Bacteria 1511
34 Ga0068869_100369546 3300005334 Bacteria 1173
35 Ga0070666_10012972 3300005335 Bacteria 5275
36 Ga0070666_10079440 3300005335 Unclassified 2240
37 Ga0070666_10105892 3300005335 Bacteria 1942
38 Ga0070680_100109006 3300005336 Bacteria 2304
39 Ga0070682_100993880 3300005337 Unclassified 696
40 Ga0068868_100009589 3300005338 Bacteria 6980
41 Ga0068868_100541398 3300005338 Unclassified 1025
42 Ga0070660_100013578 3300005339 Bacteria 5849
43 Ga0070660_100213019 3300005339 Bacteria 1569
44 Ga0070689_100007402 3300005340 Bacteria 7673
45 Ga0070689_100058061 3300005340 Unclassified 3005
46 Ga0070687_100000341 3300005343 Bacteria 15892
47 Ga0070687_100134675 3300005343 Bacteria 1431
48 Ga0070687_100257008 3300005343 Unclassified 1088
49 Ga0070668_100001201 3300005347 Bacteria 18378
50 Ga0070668_100004613 3300005347 Bacteria 10207
51 Ga0070668_100200022 3300005347 Unclassified 1640
52 Ga0070668_100413100 3300005347 Unclassified 1154
53 Ga0070669_100001855 3300005353 Bacteria 15202
54 Ga0070669_100004342 3300005353 Bacteria 10242
55 Ga0070675_100002833 3300005354 Bacteria 13070
56 Ga0070675_100034684 3300005354 Bacteria 4096
57 Ga0070675_100054287 3300005354 Bacteria 3296
58 Ga0070675_100058910 3300005354 Bacteria 3168
59 Ga0070675_100224627 3300005354 Bacteria 1636
60 Ga0070675_101020732 3300005354 Unclassified 760
61 Ga0070671_100029899 3300005355 Bacteria 4494
62 Ga0070671_100039597 3300005355 Bacteria 3913
63 Ga0070671_100040891 3300005355 Bacteria 3852
64 Ga0070671_100081921 3300005355 Bacteria 2698
65 Ga0070671_100380801 3300005355 Bacteria 1206
66 Ga0070671_100551884 3300005355 Unclassified 993
67 Ga0070674_100006776 3300005356 Bacteria 6710
68 Ga0070674_100276564 3300005356 Unclassified 1329
69 Ga0070674_100929345 3300005356 Bacteria 759
70 Ga0070673_100016582 3300005364 Bacteria 5213
71 Ga0070673_100034767 3300005364 Bacteria 3817
72 Ga0070673_100219113 3300005364 Bacteria 1646
73 Ga0070688_100003026 3300005365 Bacteria 8580
74 Ga0070688_100003114 3300005365 Bacteria 8480
75 Ga0070688_100093215 3300005365 Bacteria 1972
76 Ga0070659_100002696 3300005366 Bacteria 12623
77 Ga0070659_100012152 3300005366 Bacteria 6379
78 Ga0070659_100408018 3300005366 Unclassified 1148
79 Ga0070667_100001580 3300005367 Bacteria 20402
80 Ga0070667_100327218 3300005367 Unclassified 1384
81 Ga0070709_10592716 3300005434 Unclassified 852
82 Ga0070714_100457788 3300005435 Unclassified 1212
83 Ga0070713_100085744 3300005436 Bacteria 2698
84 Ga0070713_100204631 3300005436 Bacteria 1784
85 Ga0070713_100264916 3300005436 Bacteria 1572
86 Ga0070713_100420899 3300005436 Bacteria 1250
87 Ga0070713_100687093 3300005436 Unclassified 976
88 Ga0070711_100074608 3300005439 Bacteria 2399
89 Ga0070711_100146307 3300005439 Bacteria 1777
90 Ga0070711_100193227 3300005439 Bacteria 1566
91 Ga0070711_100358058 3300005439 Bacteria 1175
92 Ga0070711_100510359 3300005439 Unclassified 992
93 Ga0070705_100020375 3300005440 Bacteria 3508
94 Ga0070705_100054795 3300005440 Bacteria 2341
95 Ga0070705_100182143 3300005440 Unclassified 1424
96 Ga0070700_100010896 3300005441 Bacteria 5028
97 Ga0070694_100019027 3300005444 Bacteria 4364
98 Ga0070708_100150555 3300005445 Bacteria 2164
99 Ga0070663_100182368 3300005455 Bacteria 1629
100 Ga0070678_100064761 3300005456 Unclassified 2710
101 Ga0070678_100103830 3300005456 Bacteria 2209
102 Ga0070678_100192209 3300005456 Bacteria 1679
103 Ga0070678_100445618 3300005456 Bacteria 1133
104 Ga0070678_100566619 3300005456 Unclassified 1010
105 Ga0070662_100001695 3300005457 Bacteria 13547
106 Ga0070662_100016168 3300005457 Bacteria 5006
107 Ga0070662_100041975 3300005457 Bacteria 3266
108 Ga0070662_100354177 3300005457 Unclassified 1203
109 Ga0070681_10246037 3300005458 Unclassified 1701
110 Ga0068867_100264197 3300005459 Bacteria 1404
111 Ga0070685_10023538 3300005466 Bacteria 3373
112 Ga0070706_100019607 3300005467 Bacteria 6238
113 Ga0070706_100065092 3300005467 Bacteria 3371
114 Ga0070706_100079800 3300005467 Unclassified 3029
115 Ga0070706_100260052 3300005467 Bacteria 1620
116 Ga0070706_100366787 3300005467 Unclassified 1342
117 Ga0070706_100611786 3300005467 Unclassified 1012
118 Ga0070706_101123856 3300005467 Unclassified 723
119 Ga0070707_100005832 3300005468 Bacteria 11487
120 Ga0070707_100005929 3300005468 Bacteria 11403
121 Ga0070707_100026132 3300005468 Bacteria 5541
122 Ga0070707_100096558 3300005468 Unclassified 2863
123 Ga0070707_100224139 3300005468 Bacteria 1831
124 Ga0070707_100691456 3300005468 Unclassified 983
125 Ga0070707_100726600 3300005468 Bacteria 956
126 Ga0070707_101005972 3300005468 Unclassified 799
127 Ga0070698_100003606 3300005471 Bacteria 17018
128 Ga0070699_100122285 3300005518 Unclassified 2290
129 Ga0070699_100178039 3300005518 Bacteria 1886
130 Ga0070679_100108324 3300005530 Bacteria 2764
131 Ga0070684_100003792 3300005535 Bacteria 11417
132 Ga0070684_100281539 3300005535 Bacteria 1523
133 Ga0070697_100010165 3300005536 Bacteria 7343
134 Ga0070697_100014958 3300005536 Bacteria 6090
135 Ga0070697_100111381 3300005536 Bacteria 2281
136 Ga0070672_100031309 3300005543 Bacteria 4003
137 Ga0070672_100048847 3300005543 Unclassified 3290
138 Ga0070672_100080021 3300005543 Bacteria 2617
139 Ga0070686_100138613 3300005544 Bacteria 1691
140 Ga0070696_100038989 3300005546 Bacteria 3281
141 Ga0070665_100021144 3300005548 Bacteria 6541
142 Ga0070665_100046645 3300005548 Bacteria 4351
143 Ga0070665_100195612 3300005548 Unclassified 2023
144 Ga0070665_100265655 3300005548 Bacteria 1717
145 Ga0070665_100311592 3300005548 Unclassified 1578
146 Ga0070665_100595407 3300005548 Bacteria 1119
147 Ga0070704_100001402 3300005549 Bacteria 12836
148 Ga0070704_100452909 3300005549 Bacteria 1105
149 Ga0070664_100068018 3300005564 Bacteria 3045
150 Ga0068854_100535216 3300005578 Bacteria 991
151 Ga0068856_100022867 3300005614 Bacteria 6079
152 Ga0068856_100194578 3300005614 Unclassified 2042
153 Ga0068856_100533441 3300005614 Bacteria 1195
154 Ga0070702_100062121 3300005615 Bacteria 2177
155 Ga0068859_100334810 3300005617 Bacteria 1608
156 Ga0068864_100203406 3300005618 Unclassified 1820
157 Ga0068864_100395206 3300005618 Bacteria 1313
158 Ga0068866_10006586 3300005718 Unclassified 4843
159 Ga0068861_101035564 3300005719 Bacteria 785
160 Ga0068863_100112736 3300005841 Bacteria 2590
161 Ga0068858_100003575 3300005842 Bacteria 15382
162 Ga0068858_101499807 3300005842 Unclassified 665
163 Ga0068860_100008831 3300005843 Bacteria 10038
164 Ga0068860_100025538 3300005843 Bacteria 5699
165 Ga0068860_100227044 3300005843 Bacteria 1814
166 Ga0068862_100003692 3300005844 Bacteria 13084
167 Ga0081455_10000382 3300005937 Bacteria 58627
168 Ga0081455_10000953 3300005937 Bacteria 37056
169 Ga0081455_10008384 3300005937 Bacteria 10749
170 Ga0081455_10087703 3300005937 Bacteria 2531
171 Ga0081540_1000018 3300005983 Bacteria 164931
172 Ga0081540_1087177 3300005983 Bacteria 1384
173 Ga0081539_10001954 3300005985 Bacteria 31470
174 Ga0081539_10039961 3300005985 Bacteria 2761
175 Ga0081539_10316124 3300005985 Unclassified 666
176 Ga0070717_10047126 3300006028 Bacteria 3530
177 Ga0070717_10069166 3300006028 Bacteria 2939
178 Ga0070717_10110806 3300006028 Bacteria 2341
179 Ga0070717_10399039 3300006028 Bacteria 1235
180 Ga0070715_10070930 3300006163 Bacteria 1556
181 Ga0070715_10489920 3300006163 Unclassified 702
182 Ga0070716_100012547 3300006173 Bacteria 4298
183 Ga0070716_100154358 3300006173 Bacteria 1480
184 Ga0070716_100269707 3300006173 Bacteria 1169
185 Ga0070712_100004698 3300006175 Bacteria 8444
186 Ga0070712_100006091 3300006175 Bacteria 7466
187 Ga0070712_100098072 3300006175 Bacteria 2161
188 Ga0070712_100325556 3300006175 Bacteria 1251
189 Ga0070712_100326743 3300006175 Bacteria 1248
190 Ga0070712_100541852 3300006175 Unclassified 980
191 Ga0097621_100012433 3300006237 Bacteria 6310
192 Ga0097621_100214135 3300006237 Bacteria 1677
193 Ga0068871_100157039 3300006358 Bacteria 1943
194 Ga0068871_100706056 3300006358 Unclassified 924
195 Ga0075428_100643494 3300006844 Unclassified 1131
196 Ga0075433_10211380 3300006852 Bacteria 1724
197 Ga0075434_100178681 3300006871 Unclassified 2142
198 Ga0075434_100604707 3300006871 Unclassified 1115
199 Ga0068865_100073413 3300006881 Unclassified 2433
200 Ga0097620_100334803 3300006931 Bacteria 1608
201 Ga0099794_10286991 3300007265 Unclassified 851
202 Ga0099795_10022871 3300007788 Bacteria 2068
203 Ga0099795_10079705 3300007788 Bacteria 1251
204 Ga0105240_10632082 3300009093 Bacteria 1175
205 Ga0111539_10184407 3300009094 Bacteria 2437
206 Ga0111539_10768158 3300009094 Bacteria 1122
207 Ga0105245_10041725 3300009098 Unclassified 4090
208 Ga0105245_10232609 3300009098 Unclassified 1783
209 Ga0105245_10361102 3300009098 Bacteria 1441
210 Ga0114129_10274624 3300009147 Bacteria 2254
211 Ga0114129_10816373 3300009147 Unclassified 1188
212 Ga0114129_10849493 3300009147 Bacteria 1161
213 Ga0105243_10155618 3300009148 Bacteria 1965
214 Ga0105243_10851979 3300009148 Bacteria 903
215 Ga0105242_10333173 3300009176 Bacteria 1396
216 Ga0105248_10040122 3300009177 Bacteria 5247
217 Ga0105237_10242225 3300009545 Bacteria 1805
218 Ga0105237_10941945 3300009545 Unclassified 870
219 Ga0105249_10004187 3300009553 Bacteria 12458
220 Ga0105249_10052627 3300009553 Bacteria 3719
221 Ga0105249_10415905 3300009553 Unclassified 1377
222 Ga0099796_10168337 3300010159 Bacteria 873
223 Ga0105239_10133617 3300010375 Bacteria 2762
224 Ga0105239_11471495 3300010375 Bacteria 787
225 Ga0105246_10090873 3300011119 Unclassified 2199
226 Ga0157371_10379907 3300013102 Bacteria 1031
227 Ga0157374_10009471 3300013296 Bacteria 8363
228 Ga0157374_10012184 3300013296 Bacteria 7472
229 Ga0157374_10037440 3300013296 Bacteria 4452
230 Ga0157374_10040962 3300013296 Bacteria 4267
231 Ga0157374_10060343 3300013296 Bacteria 3549
232 Ga0157374_10113173 3300013296 Bacteria 2612
233 Ga0157374_10117145 3300013296 Bacteria 2567
234 Ga0157374_10125517 3300013296 Bacteria 2480
235 Ga0157374_10127695 3300013296 Bacteria 2458
236 Ga0157378_10005834 3300013297 Bacteria 10797
237 Ga0157378_10035450 3300013297 Bacteria 4413
238 Ga0157378_10061651 3300013297 Bacteria 3348
239 Ga0157378_10155551 3300013297 Bacteria 2134
240 Ga0157378_10233884 3300013297 Bacteria 1752
241 Ga0157378_10312219 3300013297 Bacteria 1525
242 Ga0157378_10522796 3300013297 Unclassified 1188
243 Ga0163162_10005483 3300013306 Bacteria 12260
244 Ga0163162_10035769 3300013306 Bacteria 4947
245 Ga0163162_10051300 3300013306 Bacteria 4139
246 Ga0163162_10129152 3300013306 Bacteria 2635
247 Ga0163162_10410772 3300013306 Bacteria 1486
248 Ga0157372_10147309 3300013307 Bacteria 2715
249 Ga0157372_11084755 3300013307 Unclassified 926
250 Ga0157375_10013682 3300013308 Bacteria 7232
251 Ga0157375_10017453 3300013308 Bacteria 6477
252 Ga0157375_10030360 3300013308 Bacteria 5095
253 Ga0157375_10030681 3300013308 Bacteria 5072
254 Ga0157375_10060776 3300013308 Bacteria 3749
255 Ga0157375_10070734 3300013308 Bacteria 3500
256 Ga0157375_10241817 3300013308 Bacteria 1965
257 Ga0163163_10018945 3300014325 Bacteria 6457
258 Ga0163163_10655886 3300014325 Bacteria 1113
259 Ga0163163_11152884 3300014325 Unclassified 838
260 Ga0157377_10006509 3300014745 Bacteria 5575
261 Ga0157377_10045649 3300014745 Bacteria 2448
262 Ga0157377_10166694 3300014745 Unclassified 1374
263 Ga0157379_10006220 3300014968 Bacteria 10279
264 Ga0157379_10116199 3300014968 Bacteria 2406
265 Ga0157379_11065349 3300014968 Bacteria 773
266 Ga0157376_10020451 3300014969 Bacteria 5120
267 Ga0157376_10156963 3300014969 Bacteria 2058
268 Ga0157376_10300993 3300014969 Unclassified 1518
269 Ga0157376_10454420 3300014969 Unclassified 1250
270 Ga0163161_10003199 3300017792 Bacteria 11516
271 Ga0207666_1001231 3300025271 Unclassified 3011
272 Ga0207666_1007430 3300025271 Unclassified 1443
273 Ga0207673_1004381 3300025290 Unclassified 1689
274 Ga0207697_10000343 3300025315 Bacteria 25933
275 Ga0207697_10001114 3300025315 Bacteria 14796
276 Ga0207697_10001425 3300025315 Bacteria 13071
277 Ga0207697_10003122 3300025315 Bacteria 8280
278 Ga0207697_10004541 3300025315 Bacteria 6609
279 Ga0207697_10009799 3300025315 Bacteria 4120
280 Ga0207697_10015202 3300025315 Bacteria 3183
281 Ga0207697_10019715 3300025315 Bacteria 2763
282 Ga0207682_10053301 3300025893 Bacteria 1677
283 Ga0207688_10004754 3300025901 Bacteria 7395
284 Ga0207688_10030154 3300025901 Bacteria 2990
285 Ga0207680_10082005 3300025903 Bacteria 2029
286 Ga0207647_10020840 3300025904 Unclassified 4388
287 Ga0207685_10214563 3300025905 Bacteria 912
288 Ga0207699_10209739 3300025906 Bacteria 1324
289 Ga0207645_10000107 3300025907 Bacteria 61800
290 Ga0207645_10000461 3300025907 Bacteria 33685
291 Ga0207645_10032476 3300025907 Bacteria 3355
292 Ga0207684_10053011 3300025910 Unclassified 3443
293 Ga0207684_10206451 3300025910 Bacteria 1695
294 Ga0207684_10238887 3300025910 Unclassified 1567
295 Ga0207684_10289250 3300025910 Bacteria 1413
296 Ga0207684_10529168 3300025910 Unclassified 1009
297 Ga0207693_10004398 3300025915 Bacteria 11917
298 Ga0207693_10014526 3300025915 Bacteria 6328
299 Ga0207693_10023515 3300025915 Bacteria 4892
300 Ga0207693_10034956 3300025915 Unclassified 3964
301 Ga0207693_10109959 3300025915 Bacteria 2161
302 Ga0207663_10001207 3300025916 Bacteria 11939
303 Ga0207663_10201438 3300025916 Bacteria 1436
304 Ga0207663_10303410 3300025916 Bacteria 1194
305 Ga0207663_10508510 3300025916 Unclassified 937
306 Ga0207662_10000220 3300025918 Bacteria 26588
307 Ga0207662_10011504 3300025918 Bacteria 4911
308 Ga0207657_10181623 3300025919 Bacteria 1701
309 Ga0207649_10152804 3300025920 Bacteria 1592
310 Ga0207646_10052044 3300025922 Bacteria 3664
311 Ga0207646_10074455 3300025922 Bacteria 3033
312 Ga0207646_10288942 3300025922 Unclassified 1482
313 Ga0207646_10429555 3300025922 Bacteria 1192
314 Ga0207681_10001485 3300025923 Bacteria 15120
315 Ga0207681_10093845 3300025923 Bacteria 2149
316 Ga0207650_10141251 3300025925 Bacteria 1893
317 Ga0207650_10178614 3300025925 Bacteria 1691
318 Ga0207659_10001782 3300025926 Bacteria 12718
319 Ga0207659_10015268 3300025926 Unclassified 4971
320 Ga0207659_10020088 3300025926 Bacteria 4408
321 Ga0207659_10035715 3300025926 Bacteria 3438
322 Ga0207659_10075168 3300025926 Bacteria 2478
323 Ga0207659_10213393 3300025926 Bacteria 1548
324 Ga0207659_10464575 3300025926 Unclassified 1067
325 Ga0207659_10469098 3300025926 Unclassified 1062
326 Ga0207700_10091440 3300025928 Bacteria 2403
327 Ga0207700_10235627 3300025928 Bacteria 1558
328 Ga0207700_10976253 3300025928 Unclassified 758
329 Ga0207664_10314223 3300025929 Unclassified 1381
330 Ga0207664_11261475 3300025929 Unclassified 658
331 Ga0207644_10012537 3300025931 Bacteria 5633
332 Ga0207644_10013562 3300025931 Bacteria 5437
333 Ga0207644_10189611 3300025931 Bacteria 1616
334 Ga0207690_10001853 3300025932 Bacteria 12996
335 Ga0207690_10014158 3300025932 Bacteria 4811
336 Ga0207706_10000823 3300025933 Bacteria 32168
337 Ga0207706_10020281 3300025933 Bacteria 5975
338 Ga0207706_10035230 3300025933 Bacteria 4451
339 Ga0207709_10112355 3300025935 Bacteria 1824
340 Ga0207670_10035335 3300025936 Bacteria 3239
341 Ga0207670_10099572 3300025936 Bacteria 2074
342 Ga0207670_10113980 3300025936 Bacteria 1953
343 Ga0207670_10127749 3300025936 Bacteria 1857
344 Ga0207670_10302706 3300025936 Bacteria 1252
345 Ga0207669_10098488 3300025937 Bacteria 1925
346 Ga0207669_10206627 3300025937 Unclassified 1430
347 Ga0207669_10341231 3300025937 Bacteria 1154
348 Ga0207704_10189052 3300025938 Bacteria 1496
349 Ga0207704_10373665 3300025938 Bacteria 1117
350 Ga0207704_10693186 3300025938 Bacteria 843
351 Ga0207665_10008639 3300025939 Bacteria 6706
352 Ga0207665_10020473 3300025939 Bacteria 4347
353 Ga0207691_10003764 3300025940 Bacteria 14729
354 Ga0207689_10024551 3300025942 Bacteria 5056
355 Ga0207661_10052103 3300025944 Bacteria 3268
356 Ga0207661_10261788 3300025944 Unclassified 1541
357 Ga0207661_10527520 3300025944 Bacteria 1080
358 Ga0207679_10149842 3300025945 Bacteria 1897
359 Ga0207679_10287775 3300025945 Bacteria 1411
360 Ga0207651_10008500 3300025960 Bacteria 5549
361 Ga0207651_10072875 3300025960 Unclassified 2440
362 Ga0207651_10120667 3300025960 Bacteria 1987
363 Ga0207712_10002598 3300025961 Bacteria 11590
364 Ga0207712_10011880 3300025961 Bacteria 5552
365 Ga0207668_10002066 3300025972 Bacteria 11710
366 Ga0207668_10019680 3300025972 Unclassified 4272
367 Ga0207668_10257717 3300025972 Bacteria 1420
368 Ga0207658_10008296 3300025986 Bacteria 7076
369 Ga0207658_10046979 3300025986 Unclassified 3156
370 Ga0207658_10057058 3300025986 Bacteria 2900
371 Ga0207658_10188943 3300025986 Bacteria 1710
372 Ga0207677_10017917 3300026023 Unclassified 4238
373 Ga0207677_10025176 3300026023 Unclassified 3708
374 Ga0207677_10055272 3300026023 Bacteria 2713
375 Ga0207677_10142574 3300026023 Bacteria 1837
376 Ga0207703_10013944 3300026035 Bacteria 6265
377 Ga0207678_10002470 3300026067 Bacteria 16794
378 Ga0207678_10466406 3300026067 Bacteria 1099
379 Ga0207708_10010835 3300026075 Bacteria 6781
380 Ga0207702_10079405 3300026078 Unclassified 2844
381 Ga0207641_10065229 3300026088 Bacteria 3114
382 Ga0207641_10983939 3300026088 Bacteria 840
383 Ga0207648_10169473 3300026089 Bacteria 1930
384 Ga0207648_10360805 3300026089 Bacteria 1311
385 Ga0207648_10532363 3300026089 Unclassified 1077
386 Ga0207676_10332737 3300026095 Bacteria 1398
387 Ga0207675_101141000 3300026118 Bacteria 799
388 Ga0207683_10002988 3300026121 Bacteria 14764
389 Ga0207683_10238078 3300026121 Unclassified 1660
390 Ga0209974_10156979 3300027876 Unclassified 823
391 Ga0207428_10250444 3300027907 Unclassified 1321
392 Ga0268266_10008519 3300028379 Bacteria 9112
393 Ga0268266_10073769 3300028379 Unclassified 2962
394 Ga0268266_10310884 3300028379 Bacteria 1472
395 Ga0268266_10424554 3300028379 Bacteria 1260
396 Ga0268265_10007473 3300028380 Bacteria 7379
397 Ga0268264_10004813 3300028381 Bacteria 11451
398 Ga0268264_10069267 3300028381 Bacteria 2983
399 Ga0268264_10346012 3300028381 Bacteria 1414
400 Ga0373934_0258316 3300035086 Bacteria 721
401 Ga0373943_0421433 3300035170 Bacteria 773
402 Ga0373955_0262159 3300035172 Unclassified 1038
403 Ga0373931_0072796 3300035691 Bacteria 1880
404 Ga0373935_0062137 3300035692 Bacteria 2392
405 Ga0373935_0092911 3300035692 Bacteria 1978
406 Ga0373927_0113706 3300035695 Bacteria 1764
407 Ga0373927_0566349 3300035695 Unclassified 751
408 Ga0373933_0256965 3300035724 Unclassified 1126
409 Ga0373933_0533366 3300035724 Unclassified 770
410 Ga0373947_0113200 3300035725 Unclassified 1717
411 Ga0373947_0245233 3300035725 Bacteria 1183
412 Ga0373937_1005864 3300036401 Bacteria 782
413 Ga0373925_0186634 3300037068 Bacteria 1644
414 Ga0395898_0134163 3300037466 Bacteria 2370
415 Ga0395905_0012802 3300037471 Bacteria 8067
416 Ga0395901_0016990 3300038443 Bacteria 7415
417 Ga0451839_1372021 3300041496 Bacteria 823
418 Ga0439464_0007721 3300042439 Bacteria 2815
419 Ga0439460_0008982 3300042461 Bacteria 2529
420 Ga0451576_0730695 3300045051 Bacteria 1040
421 Ga0466967_0067375 3300045976 Bacteria 3193
422 Ga0495629_0282486 3300046459 Unclassified 1139
423 Ga0495651_0236195 3300046462 Unclassified 1256
424 Ga0495639_0112229 3300046475 Bacteria 1295
425 Ga0495628_0201256 3300046516 Unclassified 1500
426 Ga0495652_0115495 3300046529 Bacteria 2150
427 Ga0495667_0081808 3300046559 Unclassified 2099
428 Ga0495634_0351065 3300046642 Unclassified 883
429 Ga0495635_0595945 3300046663 Unclassified 722
430 Ga0495588_0026922 3300046674 Unclassified 2872
431 Ga0495657_0236313 3300046675 Unclassified 1104
432 Ga0495646_0448939 3300046680 Unclassified 666
433 Ga0495647_0144870 3300046681 Unclassified 1015
434 Ga0495669_0095422 3300046684 Bacteria 1377
435 Ga0495669_0375343 3300046684 Unclassified 688
436 Ga0495624_0167545 3300046690 Bacteria 1341
437 Ga0495675_0160399 3300047444 Bacteria 1385
438 Ga0495684_0047263 3300047471 Unclassified 3292
439 Ga0495684_0229434 3300047471 Unclassified 1358
440 Ga0496100_0004962 3300048903 Bacteria 7114
441 Ga0496100_0120767 3300048903 Unclassified 1833
442 Ga0496101_0008720 3300048904 Bacteria 6629
443 Ga0496102_0131324 3300048905 Bacteria 2344
444 Ga0496102_0185530 3300048905 Unclassified 1960
445 Ga0496102_0189278 3300048905 Bacteria 1939
446 Ga0496103_0058811 3300048906 Unclassified 2388
447 Ga0496103_0132897 3300048906 Unclassified 1590
448 Ga0496104_0080694 3300048907 Unclassified 3102
449 Ga0496104_0092103 3300048907 Unclassified 2898
450 Ga0496104_1237120 3300048907 Unclassified 650
451 Ga0496105_0052493 3300048908 Unclassified 3368
452 Ga0496105_0195003 3300048908 Bacteria 1655
453 Ga0496106_0000636 3300048909 Bacteria 25176
454 Ga0496106_0029031 3300048909 Unclassified 4122
455 Ga0496106_0362123 3300048909 Bacteria 1165
456 Ga0496107_0037922 3300048910 Unclassified 3459
457 Ga0496107_0110499 3300048910 Bacteria 2020
458 Ga0496107_0216619 3300048910 Bacteria 1424
459 Ga0496108_0160305 3300048911 Bacteria 1944
460 Ga0496108_0283765 3300048911 Unclassified 1441
461 Ga0496108_0440870 3300048911 Bacteria 1138
462 Ga0496109_0041441 3300048912 Bacteria 4171
463 Ga0496109_0063138 3300048912 Unclassified 3388
464 Ga0496109_0091825 3300048912 Unclassified 2808
465 Ga0496109_0102817 3300048912 Bacteria 2652
466 Ga0496109_0289196 3300048912 Unclassified 1545
467 Ga0496109_0935480 3300048912 Bacteria 805
468 Ga0496110_0095128 3300048913 Unclassified 2668
469 Ga0496112_0032459 3300048915 Bacteria 5070
470 Ga0496112_0047599 3300048915 Unclassified 4207
471 Ga0496112_0076811 3300048915 Unclassified 3303
472 Ga0496112_0094412 3300048915 Unclassified 2962
473 Ga0496112_0102115 3300048915 Bacteria 2837
474 Ga0496112_0412112 3300048915 Bacteria 1290
475 Ga0496112_0590915 3300048915 Bacteria 1042
476 Ga0496112_0729443 3300048915 Unclassified 918
477 Ga0496112_1113468 3300048915 Bacteria 708
478 Ga0496113_0104812 3300048916 Unclassified 2195
479 Ga0496114_0072432 3300048917 Bacteria 2898
480 Ga0496114_0076562 3300048917 Bacteria 2819
481 Ga0496115_0015548 3300048918 Bacteria 5775
482 Ga0496115_0050689 3300048918 Unclassified 3326
483 Ga0496115_0106436 3300048918 Unclassified 2302
484 Ga0496115_0122004 3300048918 Bacteria 2145
485 nmdc:mga05p37_196697_c1 3300050507 Bacteria 988
486 nmdc:mga05p37_314244_c1 3300050507 Bacteria 1856
487 nmdc:mga08y16_1076930_c1 3300050511 Unclassified 780
488 nmdc:mga0n895_1408173_c1 3300050512 Unclassified 665
489 nmdc:mga0n895_254950_c1 3300050512 Unclassified 1780
490 nmdc:mga0n895_71495_c1 3300050512 Bacteria 3440
491 nmdc:mga0a205_652107_c1 3300050515 Unclassified 904
492 nmdc:mga0a205_831930_c1 3300050515 Bacteria 770
493 Ga0495619_0377675 3300053085 Unclassified 979
494 Ga0495619_0439301 3300053085 Bacteria 900
495 Ga0070688_100179088
496 SwRhRL3b_contig_1743896
497 SwRhRL2b_contig_339522
498 SwRhRL2b_contig_624290
499 JGI24035J26624_1001490
500 JGI25404J52841_10003112
501 JGI25405J52794_10004818
502 Ga0065704_10016980
503 Ga0065704_10082514
504 Ga0065704_10436574
505 Ga0065712_10013465
506 Ga0065712_10013728
507 Ga0065712_10078885
508 Ga0065715_10005815
509 Ga0065715_10012033
510 Ga0065715_10126884
511 Ga0065715_10164222
512 Ga0065715_10211939
513 Ga0065715_10346230
514 Ga0065707_10004285
515 Ga0065707_10028591
516 Ga0065707_10293931
517 Ga0070676_10000696
518 Ga0070676_10050689
519 Ga0070683_100144614
520 Ga0070683_100175161
521 Ga0070683_100536251
522 Ga0070690_100045006
523 Ga0070690_100053220
524 Ga0070670_100102061
525 Ga0070670_100135466
526 Ga0070670_100156536
527 Ga0070677_10065649
528 Ga0068869_100369546
529 Ga0070666_10012972
530 Ga0070666_10079440
531 Ga0070666_10105892
532 Ga0070680_100109006
533 Ga0070682_100993880
534 Ga0068868_100009589
535 Ga0068868_100541398
536 Ga0070660_100013578
537 Ga0070660_100213019
538 Ga0070689_100007402
539 Ga0070689_100058061
540 Ga0070687_100000341
541 Ga0070687_100134675
542 Ga0070687_100257008
543 Ga0070668_100001201
544 Ga0070668_100004613
545 Ga0070668_100200022
546 Ga0070668_100413100
547 Ga0070669_100001855
548 Ga0070669_100004342
549 Ga0070675_100002833
550 Ga0070675_100034684
551 Ga0070675_100054287
552 Ga0070675_100058910
553 Ga0070675_100224627
554 Ga0070675_101020732
555 Ga0070671_100029899
556 Ga0070671_100039597
557 Ga0070671_100040891
558 Ga0070671_100081921
559 Ga0070671_100380801
560 Ga0070671_100551884
561 Ga0070674_100006776
562 Ga0070674_100276564
563 Ga0070674_100929345
564 Ga0070673_100016582
565 Ga0070673_100034767
566 Ga0070673_100219113
567 Ga0070688_100003026
568 Ga0070688_100003114
569 Ga0070688_100093215
570 Ga0070659_100002696
571 Ga0070659_100012152
572 Ga0070659_100408018
573 Ga0070667_100001580
574 Ga0070667_100327218
575 Ga0070709_10592716
576 Ga0070714_100457788
577 Ga0070713_100085744
578 Ga0070713_100204631
579 Ga0070713_100264916
580 Ga0070713_100420899
581 Ga0070713_100687093
582 Ga0070711_100074608
583 Ga0070711_100146307
584 Ga0070711_100193227
585 Ga0070711_100358058
586 Ga0070711_100510359
587 Ga0070705_100020375
588 Ga0070705_100054795
589 Ga0070705_100182143
590 Ga0070700_100010896
591 Ga0070694_100019027
592 Ga0070708_100150555
593 Ga0070663_100182368
594 Ga0070678_100064761
595 Ga0070678_100103830
596 Ga0070678_100192209
597 Ga0070678_100445618
598 Ga0070678_100566619
599 Ga0070662_100001695
600 Ga0070662_100016168
601 Ga0070662_100041975
602 Ga0070662_100354177
603 Ga0070681_10246037
604 Ga0068867_100264197
605 Ga0070685_10023538
606 Ga0070706_100019607
607 Ga0070706_100065092
608 Ga0070706_100079800
609 Ga0070706_100260052
610 Ga0070706_100366787
611 Ga0070706_100611786
612 Ga0070706_101123856
613 Ga0070707_100005832
614 Ga0070707_100005929
615 Ga0070707_100026132
616 Ga0070707_100096558
617 Ga0070707_100224139
618 Ga0070707_100691456
619 Ga0070707_100726600
620 Ga0070707_101005972
621 Ga0070698_100003606
622 Ga0070699_100122285
623 Ga0070699_100178039
624 Ga0070679_100108324
625 Ga0070684_100003792
626 Ga0070684_100281539
627 Ga0070697_100010165
628 Ga0070697_100014958
629 Ga0070697_100111381
630 Ga0070672_100031309
631 Ga0070672_100048847
632 Ga0070672_100080021
633 Ga0070686_100138613
634 Ga0070696_100038989
635 Ga0070665_100021144
636 Ga0070665_100046645
637 Ga0070665_100195612
638 Ga0070665_100265655
639 Ga0070665_100311592
640 Ga0070665_100595407
641 Ga0070704_100001402
642 Ga0070704_100452909
643 Ga0070664_100068018
644 Ga0068854_100535216
645 Ga0068856_100022867
646 Ga0068856_100194578
647 Ga0068856_100533441
648 Ga0070702_100062121
649 Ga0068859_100334810
650 Ga0068864_100203406
651 Ga0068864_100395206
652 Ga0068866_10006586
653 Ga0068861_101035564
654 Ga0068863_100112736
655 Ga0068858_100003575
656 Ga0068858_101499807
657 Ga0068860_100008831
658 Ga0068860_100025538
659 Ga0068860_100227044
660 Ga0068862_100003692
661 Ga0081455_10000382
662 Ga0081455_10000953
663 Ga0081455_10008384
664 Ga0081455_10087703
665 Ga0081540_1000018
666 Ga0081540_1087177
667 Ga0081539_10001954
668 Ga0081539_10039961
669 Ga0081539_10316124
670 Ga0070717_10047126
671 Ga0070717_10069166
672 Ga0070717_10110806
673 Ga0070717_10399039
674 Ga0070715_10070930
675 Ga0070715_10489920
676 Ga0070716_100012547
677 Ga0070716_100154358
678 Ga0070716_100269707
679 Ga0070712_100004698
680 Ga0070712_100006091
681 Ga0070712_100098072
682 Ga0070712_100325556
683 Ga0070712_100326743
684 Ga0070712_100541852
685 Ga0097621_100012433
686 Ga0097621_100214135
687 Ga0068871_100157039
688 Ga0068871_100706056
689 Ga0075428_100643494
690 Ga0075433_10211380
691 Ga0075434_100178681
692 Ga0075434_100604707
693 Ga0068865_100073413
694 Ga0097620_100334803
695 Ga0099794_10286991
696 Ga0099795_10022871
697 Ga0099795_10079705
698 Ga0105240_10632082
699 Ga0111539_10184407
700 Ga0111539_10768158
701 Ga0105245_10041725
702 Ga0105245_10232609
703 Ga0105245_10361102
704 Ga0114129_10274624
705 Ga0114129_10816373
706 Ga0114129_10849493
707 Ga0105243_10155618
708 Ga0105243_10851979
709 Ga0105242_10333173
710 Ga0105248_10040122
711 Ga0105237_10242225
712 Ga0105237_10941945
713 Ga0105249_10004187
714 Ga0105249_10052627
715 Ga0105249_10415905
716 Ga0099796_10168337
717 Ga0105239_10133617
718 Ga0105239_11471495
719 Ga0105246_10090873
720 Ga0157371_10379907
721 Ga0157374_10009471
722 Ga0157374_10012184
723 Ga0157374_10037440
724 Ga0157374_10040962
725 Ga0157374_10060343
726 Ga0157374_10113173
727 Ga0157374_10117145
728 Ga0157374_10125517
729 Ga0157374_10127695
730 Ga0157378_10005834
731 Ga0157378_10035450
732 Ga0157378_10061651
733 Ga0157378_10155551
734 Ga0157378_10233884
735 Ga0157378_10312219
736 Ga0157378_10522796
737 Ga0163162_10005483
738 Ga0163162_10035769
739 Ga0163162_10051300
740 Ga0163162_10129152
741 Ga0163162_10410772
742 Ga0157372_10147309
743 Ga0157372_11084755
744 Ga0157375_10013682
745 Ga0157375_10017453
746 Ga0157375_10030360
747 Ga0157375_10030681
748 Ga0157375_10060776
749 Ga0157375_10070734
750 Ga0157375_10241817
751 Ga0163163_10018945
752 Ga0163163_10655886
753 Ga0163163_11152884
754 Ga0157377_10006509
755 Ga0157377_10045649
756 Ga0157377_10166694
757 Ga0157379_10006220
758 Ga0157379_10116199
759 Ga0157379_11065349
760 Ga0157376_10020451
761 Ga0157376_10156963
762 Ga0157376_10300993
763 Ga0157376_10454420
764 Ga0163161_10003199
765 Ga0207666_1001231
766 Ga0207666_1007430
767 Ga0207673_1004381
768 Ga0207697_10000343
769 Ga0207697_10001114
770 Ga0207697_10001425
771 Ga0207697_10003122
772 Ga0207697_10004541
773 Ga0207697_10009799
774 Ga0207697_10015202
775 Ga0207697_10019715
776 Ga0207682_10053301
777 Ga0207688_10004754
778 Ga0207688_10030154
779 Ga0207680_10082005
780 Ga0207647_10020840
781 Ga0207685_10214563
782 Ga0207699_10209739
783 Ga0207645_10000107
784 Ga0207645_10000461
785 Ga0207645_10032476
786 Ga0207684_10053011
787 Ga0207684_10206451
788 Ga0207684_10238887
789 Ga0207684_10289250
790 Ga0207684_10529168
791 Ga0207693_10004398
792 Ga0207693_10014526
793 Ga0207693_10023515
794 Ga0207693_10034956
795 Ga0207693_10109959
796 Ga0207663_10001207
797 Ga0207663_10201438
798 Ga0207663_10303410
799 Ga0207663_10508510
800 Ga0207662_10000220
801 Ga0207662_10011504
802 Ga0207657_10181623
803 Ga0207649_10152804
804 Ga0207646_10052044
805 Ga0207646_10074455
806 Ga0207646_10288942
807 Ga0207646_10429555
808 Ga0207681_10001485
809 Ga0207681_10093845
810 Ga0207650_10141251
811 Ga0207650_10178614
812 Ga0207659_10001782
813 Ga0207659_10015268
814 Ga0207659_10020088
815 Ga0207659_10035715
816 Ga0207659_10075168
817 Ga0207659_10213393
818 Ga0207659_10464575
819 Ga0207659_10469098
820 Ga0207700_10091440
821 Ga0207700_10235627
822 Ga0207700_10976253
823 Ga0207664_10314223
824 Ga0207664_11261475
825 Ga0207644_10012537
826 Ga0207644_10013562
827 Ga0207644_10189611
828 Ga0207690_10001853
829 Ga0207690_10014158
830 Ga0207706_10000823
831 Ga0207706_10020281
832 Ga0207706_10035230
833 Ga0207709_10112355
834 Ga0207670_10035335
835 Ga0207670_10099572
836 Ga0207670_10113980
837 Ga0207670_10127749
838 Ga0207670_10302706
839 Ga0207669_10098488
840 Ga0207669_10206627
841 Ga0207669_10341231
842 Ga0207704_10189052
843 Ga0207704_10373665
844 Ga0207704_10693186
845 Ga0207665_10008639
846 Ga0207665_10020473
847 Ga0207691_10003764
848 Ga0207689_10024551
849 Ga0207661_10052103
850 Ga0207661_10261788
851 Ga0207661_10527520
852 Ga0207679_10149842
853 Ga0207679_10287775
854 Ga0207651_10008500
855 Ga0207651_10072875
856 Ga0207651_10120667
857 Ga0207712_10002598
858 Ga0207712_10011880
859 Ga0207668_10002066
860 Ga0207668_10019680
861 Ga0207668_10257717
862 Ga0207658_10008296
863 Ga0207658_10046979
864 Ga0207658_10057058
865 Ga0207658_10188943
866 Ga0207677_10017917
867 Ga0207677_10025176
868 Ga0207677_10055272
869 Ga0207677_10142574
870 Ga0207703_10013944
871 Ga0207678_10002470
872 Ga0207678_10466406
873 Ga0207708_10010835
874 Ga0207702_10079405
875 Ga0207641_10065229
876 Ga0207641_10983939
877 Ga0207648_10169473
878 Ga0207648_10360805
879 Ga0207648_10532363
880 Ga0207676_10332737
881 Ga0207675_101141000
882 Ga0207683_10002988
883 Ga0207683_10238078
884 Ga0209974_10156979
885 Ga0207428_10250444
886 Ga0268266_10008519
887 Ga0268266_10073769
888 Ga0268266_10310884
889 Ga0268266_10424554
890 Ga0268265_10007473
891 Ga0268264_10004813
892 Ga0268264_10069267
893 Ga0268264_10346012
894 Ga0373934_0258316
895 Ga0373943_0421433
896 Ga0373955_0262159
897 Ga0373931_0072796
898 Ga0373935_0062137
899 Ga0373935_0092911
900 Ga0373927_0113706
901 Ga0373927_0566349
902 Ga0373933_0256965
903 Ga0373933_0533366
904 Ga0373947_0113200
905 Ga0373947_0245233
906 Ga0373937_1005864
907 Ga0373925_0186634
908 Ga0395898_0134163
909 Ga0395905_0012802
910 Ga0395901_0016990
911 Ga0451839_1372021
912 Ga0439464_0007721
913 Ga0439460_0008982
914 Ga0451576_0730695
915 Ga0466967_0067375
916 Ga0495629_0282486
917 Ga0495651_0236195
918 Ga0495639_0112229
919 Ga0495628_0201256
920 Ga0495652_0115495
921 Ga0495667_0081808
922 Ga0495634_0351065
923 Ga0495635_0595945
924 Ga0495588_0026922
925 Ga0495657_0236313
926 Ga0495646_0448939
927 Ga0495647_0144870
928 Ga0495669_0095422
929 Ga0495669_0375343
930 Ga0495624_0167545
931 Ga0495675_0160399
932 Ga0495684_0047263
933 Ga0495684_0229434
934 Ga0496100_0004962
935 Ga0496100_0120767
936 Ga0496101_0008720
937 Ga0496102_0131324
938 Ga0496102_0185530
939 Ga0496102_0189278
940 Ga0496103_0058811
941 Ga0496103_0132897
942 Ga0496104_0080694
943 Ga0496104_0092103
944 Ga0496104_1237120
945 Ga0496105_0052493
946 Ga0496105_0195003
947 Ga0496106_0000636
948 Ga0496106_0029031
949 Ga0496106_0362123
950 Ga0496107_0037922
951 Ga0496107_0110499
952 Ga0496107_0216619
953 Ga0496108_0160305
954 Ga0496108_0283765
955 Ga0496108_0440870
956 Ga0496109_0041441
957 Ga0496109_0063138
958 Ga0496109_0091825
959 Ga0496109_0102817
960 Ga0496109_0289196
961 Ga0496109_0935480
962 Ga0496110_0095128
963 Ga0496112_0032459
964 Ga0496112_0047599
965 Ga0496112_0076811
966 Ga0496112_0094412
967 Ga0496112_0102115
968 Ga0496112_0412112
969 Ga0496112_0590915
970 Ga0496112_0729443
971 Ga0496112_1113468
972 Ga0496113_0104812
973 Ga0496114_0072432
974 Ga0496114_0076562
975 Ga0496115_0015548
976 Ga0496115_0050689
977 Ga0496115_0106436
978 Ga0496115_0122004
979 nmdc:mga05p37_196697_c1
980 nmdc:mga05p37_314244_c1
981 nmdc:mga08y16_1076930_c1
982 nmdc:mga0n895_1408173_c1
983 nmdc:mga0n895_254950_c1
984 nmdc:mga0n895_71495_c1
985 nmdc:mga0a205_652107_c1
986 nmdc:mga0a205_831930_c1
987 Ga0495619_0377675
988 Ga0495619_0439301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02245

Pur_DNA_glyco

Methylpurine-DNA glycosylase (MPG)

36

212

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qi5-assembly2.cif.gz_B crystal structure of human alkyladenine dna glycosylase in complex with 3,n4-ethenocystosine containing duplex dna 0.7925 2 184
1f4r-assembly1.cif.gz_A crystal structure of the human aag dna repair glycosylase complexed with 1,n6-ethenoadenine-dna 0.791 2 184
1f6o-assembly1.cif.gz_A crystal structure of the human aag dna repair glycosylase complexed with dna 0.7854 2 184
3qi5-assembly1.cif.gz_A crystal structure of human alkyladenine dna glycosylase in complex with 3,n4-ethenocystosine containing duplex dna 0.779 2 184
3uby-assembly1.cif.gz_A crystal structure of human alklyadenine dna glycosylase in a lower and higher-affinity complex with dna 0.7777 2 185
ID Description Score Start End Superfamily
af_Q0DX49_88_284_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.7913 2 182 3.10.300.10
1f4rA00 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.791 2 184 3.10.300.10
af_P9WJP7_1_198_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.7881 2 177 3.10.300.10
1f4rA00 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.7615 2 184 3.10.300.10
af_Q0DX49_88_284_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.7549 2 182 3.10.300.10
ID Description Score Start End GO Terms
AF-A0A2V5NM68-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.8384 1 184 GO:0003677
GO:0003905
GO:0006284
AF-A0A2V6G842-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.837 1 184 GO:0003677
GO:0003905
GO:0006284
AF-A0A081CZB9-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.8344 1 184 GO:0003677
GO:0003905
GO:0006284
AF-A0A538P030-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.8307 1 178 GO:0003677
GO:0003905
GO:0006284
AF-A0A2V6EM48-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.8287 1 184 GO:0003677
GO:0003905
GO:0006284

Map