F454500

General Info

Members Datasets Scaffolds Average Seq Length
493 237 493 139

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0065154|Ga0500637_0065154_535_1041
Length 168
Sequence LKLFVSGAEVSAGTKLFDLILCLIITKITTKMYPQEIVLPMKEELTDNGFNELLTSGEVDDQLKKTGTTLVMVNSVCGCSAGSARPGVLMAVANAAKRPDFLATSFAGFDLEAVNKIREHLLPYPPSSPAIALFKDGQLVHMIERHQIEGRPAQLIAHNLIAAFEEYC

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
143 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
161 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
169 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
170 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
205 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
218 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
219 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
220 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
221 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
222 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
225 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
231 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
236 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.11
Nodule 0
Rhizoplane 1.01
Rhizosphere 86.61
Stem 0
Stem Tuber 0
Unclassified 4.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_976832 2162886011 Unclassified 2100
2 rootH1_10010838 3300003316 Bacteria 2184
3 rootH2_10014508 3300003320 Bacteria 12751
4 rootH2_10036928 3300003320 Bacteria 2044
5 rootH2_10036934 3300003320 Bacteria 2219
6 rootL2_10079223 3300003322 Bacteria 2186
7 rootH1_10063907 3300003323 Bacteria 24298
8 rootH1_10249477 3300003323 Bacteria 1598
9 Ga0065714_10190746 3300005288 Bacteria 929
10 Ga0065704_10115507 3300005289 Bacteria 1823
11 Ga0065712_10184852 3300005290 Unclassified 1170
12 Ga0065707_10319697 3300005295 Unclassified 969
13 Ga0070658_11304996 3300005327 Unclassified 630
14 Ga0070676_10206022 3300005328 Bacteria 1292
15 Ga0070670_100155923 3300005331 Unclassified 1977
16 Ga0070670_100702247 3300005331 Bacteria 910
17 Ga0070670_101352366 3300005331 Unclassified 652
18 Ga0070677_10013638 3300005333 Bacteria 2847
19 Ga0068869_100017002 3300005334 Unclassified 4919
20 Ga0068869_100132047 3300005334 Unclassified 1920
21 Ga0068869_100625514 3300005334 Unclassified 912
22 Ga0070666_10124580 3300005335 Bacteria 1788
23 Ga0070666_11101326 3300005335 Bacteria 590
24 Ga0070682_101139877 3300005337 Unclassified 655
25 Ga0068868_100626087 3300005338 Bacteria 956
26 Ga0070660_100581721 3300005339 Unclassified 935
27 Ga0070691_10201312 3300005341 Bacteria 1046
28 Ga0070661_101046521 3300005344 Bacteria 678
29 Ga0070668_100024244 3300005347 Bacteria 4595
30 Ga0070668_100096990 3300005347 Bacteria 2331
31 Ga0070668_100563923 3300005347 Bacteria 992
32 Ga0070669_100118524 3300005353 Bacteria 2016
33 Ga0070669_100260142 3300005353 Unclassified 1384
34 Ga0070675_100006553 3300005354 Bacteria 8945
35 Ga0070675_100031488 3300005354 Bacteria 4288
36 Ga0070675_100589842 3300005354 Bacteria 1007
37 Ga0070671_100005252 3300005355 Bacteria 10322
38 Ga0070671_100028986 3300005355 Bacteria 4563
39 Ga0070674_100463557 3300005356 Bacteria 1048
40 Ga0070674_100802179 3300005356 Bacteria 813
41 Ga0070674_100920300 3300005356 Unclassified 763
42 Ga0070673_100006882 3300005364 Bacteria 7438
43 Ga0070673_100018724 3300005364 Bacteria 4956
44 Ga0070673_100057425 3300005364 Bacteria 3075
45 Ga0070688_100002109 3300005365 Bacteria 10033
46 Ga0070659_100002765 3300005366 Bacteria 12491
47 Ga0070667_100035020 3300005367 Bacteria 4204
48 Ga0070667_100201963 3300005367 Bacteria 1764
49 Ga0070667_100264924 3300005367 Bacteria 1540
50 Ga0070667_100442368 3300005367 Unclassified 1187
51 Ga0070667_101058259 3300005367 Unclassified 758
52 Ga0070700_100041588 3300005441 Bacteria 2818
53 Ga0070694_100247067 3300005444 Unclassified 1348
54 Ga0070678_100143511 3300005456 Bacteria 1914
55 Ga0070662_100025304 3300005457 Bacteria 4097
56 Ga0070662_100436553 3300005457 Bacteria 1085
57 Ga0070662_100560159 3300005457 Unclassified 958
58 Ga0070681_11285232 3300005458 Unclassified 654
59 Ga0068867_100008939 3300005459 Bacteria 7070
60 Ga0068867_100065927 3300005459 Unclassified 2696
61 Ga0068867_100150269 3300005459 Bacteria 1829
62 Ga0068867_100674708 3300005459 Bacteria 909
63 Ga0070685_10266786 3300005466 Bacteria 1141
64 Ga0070698_100216440 3300005471 Bacteria 1850
65 Ga0070698_100313432 3300005471 Bacteria 1500
66 Ga0068853_100011572 3300005539 Bacteria 7174
67 Ga0068853_100018549 3300005539 Bacteria 5759
68 Ga0068853_100348235 3300005539 Unclassified 1378
69 Ga0068853_101046598 3300005539 Bacteria 786
70 Ga0068853_101090495 3300005539 Bacteria 770
71 Ga0070672_100069850 3300005543 Bacteria 2790
72 Ga0070672_100145808 3300005543 Unclassified 1956
73 Ga0070686_100002884 3300005544 Bacteria 9443
74 Ga0070686_100108068 3300005544 Bacteria 1890
75 Ga0070665_100376784 3300005548 Unclassified 1426
76 Ga0070665_100479899 3300005548 Bacteria 1254
77 Ga0070665_102560641 3300005548 Bacteria 511
78 Ga0068855_100049776 3300005563 Bacteria 4941
79 Ga0068855_100124093 3300005563 Unclassified 2954
80 Ga0068855_100311646 3300005563 Bacteria 1741
81 Ga0070664_100031925 3300005564 Bacteria 4405
82 Ga0070664_100247053 3300005564 Unclassified 1603
83 Ga0070664_100514564 3300005564 Bacteria 1104
84 Ga0068857_100003505 3300005577 Bacteria 13099
85 Ga0068857_100039698 3300005577 Bacteria 4171
86 Ga0068854_100046131 3300005578 Unclassified 3102
87 Ga0068854_100178145 3300005578 Bacteria 1659
88 Ga0068854_102126760 3300005578 Bacteria 518
89 Ga0068856_100093596 3300005614 Bacteria 2991
90 Ga0068856_100383972 3300005614 Bacteria 1424
91 Ga0070702_100022312 3300005615 Bacteria 3343
92 Ga0070702_101412918 3300005615 Bacteria 569
93 Ga0068852_100004062 3300005616 Bacteria 10297
94 Ga0068852_100034326 3300005616 Unclassified 4219
95 Ga0068852_100107775 3300005616 Bacteria 2528
96 Ga0068852_100238129 3300005616 Bacteria 1738
97 Ga0068852_100288992 3300005616 Bacteria 1583
98 Ga0068852_100625796 3300005616 Bacteria 1082
99 Ga0068859_100016032 3300005617 Bacteria 7531
100 Ga0068859_100020489 3300005617 Bacteria 6636
101 Ga0068864_100010951 3300005618 Bacteria 7498
102 Ga0068864_101207237 3300005618 Unclassified 755
103 Ga0068864_101342541 3300005618 Unclassified 716
104 Ga0068866_10394588 3300005718 Bacteria 891
105 Ga0068861_100001965 3300005719 Bacteria 13244
106 Ga0068861_100382225 3300005719 Bacteria 1244
107 Ga0068851_10028209 3300005834 Bacteria 2772
108 Ga0068851_10410440 3300005834 Unclassified 798
109 Ga0068870_10004870 3300005840 Bacteria 5807
110 Ga0068863_100125362 3300005841 Bacteria 2450
111 Ga0068863_100316971 3300005841 Bacteria 1514
112 Ga0068858_100106495 3300005842 Bacteria 2617
113 Ga0068858_100209474 3300005842 Bacteria 1845
114 Ga0068860_100039636 3300005843 Bacteria 4506
115 Ga0068860_100312890 3300005843 Bacteria 1540
116 Ga0068860_100664403 3300005843 Unclassified 1050
117 Ga0068860_102150303 3300005843 Bacteria 579
118 Ga0068862_100002806 3300005844 Bacteria 15264
119 Ga0068862_100181521 3300005844 Bacteria 1889
120 Ga0075366_10086149 3300006195 Bacteria 1879
121 Ga0075366_10155166 3300006195 Bacteria 1387
122 Ga0075366_10246252 3300006195 Bacteria 1090
123 Ga0075366_10540012 3300006195 Bacteria 722
124 Ga0075366_10574210 3300006195 Bacteria 698
125 Ga0097621_100000240 3300006237 Bacteria 36634
126 Ga0097621_100080529 3300006237 Bacteria 2709
127 Ga0097621_100940484 3300006237 Bacteria 806
128 Ga0068871_100001592 3300006358 Bacteria 15259
129 Ga0068871_100069681 3300006358 Bacteria 2889
130 Ga0068871_100370646 3300006358 Bacteria 1270
131 Ga0068871_100593989 3300006358 Bacteria 1006
132 Ga0068865_100213394 3300006881 Bacteria 1505
133 Ga0097620_100016032 3300006931 Bacteria 7531
134 Ga0097620_100020491 3300006931 Bacteria 6636
135 Ga0075435_100472592 3300007076 Bacteria 1082
136 Ga0075435_101512049 3300007076 Bacteria 589
137 Ga0105240_10000143 3300009093 Bacteria 146858
138 Ga0105240_10000551 3300009093 Bacteria 69267
139 Ga0105240_10007226 3300009093 Bacteria 16171
140 Ga0105240_10021439 3300009093 Bacteria 8592
141 Ga0105240_10054329 3300009093 Bacteria 5020
142 Ga0105240_10139854 3300009093 Bacteria 2895
143 Ga0105240_10318162 3300009093 Unclassified 1775
144 Ga0105240_10342403 3300009093 Unclassified 1698
145 Ga0105240_10536581 3300009093 Bacteria 1296
146 Ga0111539_10000891 3300009094 Bacteria 39017
147 Ga0111539_10331885 3300009094 Unclassified 1770
148 Ga0105247_10323200 3300009101 Bacteria 1077
149 Ga0114129_10004633 3300009147 Bacteria 19408
150 Ga0105241_10020483 3300009174 Bacteria 4886
151 Ga0105241_10165542 3300009174 Bacteria 1822
152 Ga0105242_10014570 3300009176 Bacteria 6089
153 Ga0105242_10040705 3300009176 Unclassified 3745
154 Ga0105242_10412588 3300009176 Bacteria 1263
155 Ga0105242_10792276 3300009176 Bacteria 937
156 Ga0105248_10029195 3300009177 Bacteria 6150
157 Ga0105237_10003347 3300009545 Bacteria 19082
158 Ga0105237_10007614 3300009545 Bacteria 11835
159 Ga0105237_10033712 3300009545 Bacteria 5187
160 Ga0105237_10160188 3300009545 Bacteria 2249
161 Ga0105237_10634014 3300009545 Unclassified 1076
162 Ga0105238_10021583 3300009551 Bacteria 6559
163 Ga0105238_10262229 3300009551 Bacteria 1708
164 Ga0105238_10869376 3300009551 Bacteria 919
165 Ga0105249_10013308 3300009553 Bacteria 7265
166 Ga0105249_10021451 3300009553 Bacteria 5782
167 Ga0105249_10088025 3300009553 Unclassified 2900
168 Ga0105249_10167203 3300009553 Bacteria 2130
169 Ga0105249_11246099 3300009553 Bacteria 815
170 Ga0105249_11324649 3300009553 Bacteria 792
171 Ga0105249_11593767 3300009553 Bacteria 725
172 Ga0105239_10003235 3300010375 Bacteria 20124
173 Ga0105239_10022589 3300010375 Bacteria 6935
174 Ga0105239_10027826 3300010375 Bacteria 6220
175 Ga0105239_10034112 3300010375 Bacteria 5587
176 Ga0157373_10072984 3300013100 Bacteria 2422
177 Ga0157373_10276692 3300013100 Bacteria 1189
178 Ga0157373_10298645 3300013100 Bacteria 1143
179 Ga0157371_10011950 3300013102 Bacteria 6658
180 Ga0157371_10180871 3300013102 Bacteria 1508
181 Ga0157370_10002155 3300013104 Bacteria 24041
182 Ga0157370_10052530 3300013104 Bacteria 3891
183 Ga0157370_10307384 3300013104 Unclassified 1463
184 Ga0157370_10497414 3300013104 Bacteria 1120
185 Ga0157370_10680842 3300013104 Bacteria 939
186 Ga0157369_10008630 3300013105 Bacteria 11687
187 Ga0157369_10041664 3300013105 Bacteria 5011
188 Ga0157369_10308908 3300013105 Bacteria 1644
189 Ga0157374_10048019 3300013296 Unclassified 3960
190 Ga0157374_10270114 3300013296 Bacteria 1676
191 Ga0157378_10011538 3300013297 Bacteria 7738
192 Ga0157378_10038701 3300013297 Unclassified 4228
193 Ga0157378_10130050 3300013297 Bacteria 2330
194 Ga0157378_10232411 3300013297 Bacteria 1758
195 Ga0157378_10518049 3300013297 Unclassified 1194
196 Ga0163162_10000732 3300013306 Bacteria 30443
197 Ga0163162_10004783 3300013306 Bacteria 13071
198 Ga0163162_11669618 3300013306 Unclassified 727
199 Ga0157372_10007174 3300013307 Bacteria 11862
200 Ga0157372_10013342 3300013307 Bacteria 8772
201 Ga0157372_10071366 3300013307 Unclassified 3911
202 Ga0157372_10104320 3300013307 Bacteria 3240
203 Ga0157372_10327797 3300013307 Unclassified 1783
204 Ga0157375_10019034 3300013308 Bacteria 6234
205 Ga0157375_12125030 3300013308 Bacteria 668
206 Ga0163163_10011454 3300014325 Bacteria 8045
207 Ga0163163_10026514 3300014325 Bacteria 5541
208 Ga0157380_10000351 3300014326 Bacteria 27609
209 Ga0157380_10011360 3300014326 Bacteria 6435
210 Ga0157380_13028016 3300014326 Unclassified 536
211 Ga0157377_10008920 3300014745 Bacteria 4906
212 Ga0157377_10019125 3300014745 Bacteria 3575
213 Ga0157379_10035508 3300014968 Bacteria 4445
214 Ga0157379_10037205 3300014968 Bacteria 4339
215 Ga0157379_10419529 3300014968 Bacteria 1232
216 Ga0157379_11240049 3300014968 Bacteria 718
217 Ga0157376_10000321 3300014969 Bacteria 32171
218 Ga0157376_11033660 3300014969 Bacteria 845
219 Ga0157376_11068804 3300014969 Unclassified 832
220 Ga0163161_10035946 3300017792 Bacteria 3546
221 Ga0163161_10135669 3300017792 Bacteria 1860
222 Ga0163161_10483820 3300017792 Bacteria 1005
223 Ga0163161_10536374 3300017792 Bacteria 957
224 Ga0163161_11647171 3300017792 Unclassified 567
225 Ga0206352_10357943 3300020078 Bacteria 587
226 Ga0207697_10022395 3300025315 Unclassified 2589
227 Ga0207697_10072778 3300025315 Bacteria 1442
228 Ga0207682_10014859 3300025893 Bacteria 3033
229 Ga0207680_11024715 3300025903 Bacteria 591
230 Ga0207647_10000057 3300025904 Bacteria 85211
231 Ga0207647_10011439 3300025904 Bacteria 6223
232 Ga0207645_10046433 3300025907 Bacteria 2774
233 Ga0207645_10078138 3300025907 Unclassified 2121
234 Ga0207643_10025185 3300025908 Unclassified 3287
235 Ga0207654_10024376 3300025911 Bacteria 3252
236 Ga0207654_10363930 3300025911 Bacteria 998
237 Ga0207707_10509571 3300025912 Bacteria 1025
238 Ga0207695_10000016 3300025913 Bacteria 771991
239 Ga0207695_10000758 3300025913 Bacteria 62084
240 Ga0207695_10102076 3300025913 Bacteria 2862
241 Ga0207695_10136421 3300025913 Unclassified 2406
242 Ga0207695_10159252 3300025913 Bacteria 2190
243 Ga0207695_10310048 3300025913 Bacteria 1468
244 Ga0207695_10352866 3300025913 Bacteria 1358
245 Ga0207671_10002097 3300025914 Bacteria 21800
246 Ga0207671_10003246 3300025914 Bacteria 16357
247 Ga0207671_10005581 3300025914 Bacteria 11554
248 Ga0207671_10006376 3300025914 Bacteria 10522
249 Ga0207671_10576581 3300025914 Unclassified 897
250 Ga0207662_10074312 3300025918 Bacteria 2063
251 Ga0207649_11144367 3300025920 Bacteria 614
252 Ga0207681_10035878 3300025923 Bacteria 3269
253 Ga0207694_10076085 3300025924 Unclassified 2628
254 Ga0207694_10190809 3300025924 Bacteria 1664
255 Ga0207694_10435190 3300025924 Bacteria 1094
256 Ga0207650_10253889 3300025925 Unclassified 1424
257 Ga0207650_11063212 3300025925 Bacteria 689
258 Ga0207650_11299294 3300025925 Bacteria 619
259 Ga0207659_10038511 3300025926 Bacteria 3326
260 Ga0207700_11156299 3300025928 Unclassified 691
261 Ga0207644_10011465 3300025931 Bacteria 5867
262 Ga0207644_10053853 3300025931 Bacteria 2896
263 Ga0207644_10614090 3300025931 Bacteria 904
264 Ga0207690_10129371 3300025932 Bacteria 1846
265 Ga0207706_10062630 3300025933 Unclassified 3275
266 Ga0207706_11519516 3300025933 Bacteria 545
267 Ga0207686_10030840 3300025934 Bacteria 3179
268 Ga0207686_10338955 3300025934 Bacteria 1129
269 Ga0207686_11812532 3300025934 Unclassified 505
270 Ga0207670_10084776 3300025936 Unclassified 2225
271 Ga0207669_10474708 3300025937 Bacteria 996
272 Ga0207669_10705981 3300025937 Bacteria 829
273 Ga0207704_10385791 3300025938 Bacteria 1101
274 Ga0207704_10792452 3300025938 Bacteria 791
275 Ga0207691_10001600 3300025940 Bacteria 22516
276 Ga0207691_10021140 3300025940 Bacteria 6149
277 Ga0207691_10138588 3300025940 Unclassified 2145
278 Ga0207691_10147178 3300025940 Unclassified 2072
279 Ga0207711_10019031 3300025941 Bacteria 5714
280 Ga0207689_10057444 3300025942 Bacteria 3201
281 Ga0207689_10070303 3300025942 Bacteria 2875
282 Ga0207689_10279582 3300025942 Bacteria 1382
283 Ga0207661_10417148 3300025944 Unclassified 1219
284 Ga0207679_10028999 3300025945 Bacteria 3849
285 Ga0207679_10527935 3300025945 Unclassified 1056
286 Ga0207679_10574482 3300025945 Unclassified 1014
287 Ga0207667_10004084 3300025949 Bacteria 17932
288 Ga0207667_10032655 3300025949 Bacteria 5606
289 Ga0207667_10290669 3300025949 Bacteria 1670
290 Ga0207651_10011964 3300025960 Bacteria 4883
291 Ga0207651_10040014 3300025960 Bacteria 3097
292 Ga0207651_10090910 3300025960 Unclassified 2233
293 Ga0207651_10945674 3300025960 Bacteria 769
294 Ga0207712_10011232 3300025961 Bacteria 5703
295 Ga0207712_10280905 3300025961 Bacteria 1359
296 Ga0207712_10427955 3300025961 Bacteria 1118
297 Ga0207668_10041649 3300025972 Bacteria 3106
298 Ga0207668_10090986 3300025972 Bacteria 2241
299 Ga0207668_10775831 3300025972 Bacteria 847
300 Ga0207640_10041054 3300025981 Bacteria 2940
301 Ga0207640_10502304 3300025981 Bacteria 1010
302 Ga0207640_11939374 3300025981 Bacteria 533
303 Ga0207658_10174527 3300025986 Bacteria 1774
304 Ga0207658_10292090 3300025986 Bacteria 1401
305 Ga0207658_10596800 3300025986 Unclassified 992
306 Ga0207658_10917018 3300025986 Unclassified 798
307 Ga0207677_10178402 3300026023 Bacteria 1668
308 Ga0207639_10019994 3300026041 Bacteria 4786
309 Ga0207639_10565953 3300026041 Bacteria 1045
310 Ga0207639_10689246 3300026041 Bacteria 947
311 Ga0207639_10715937 3300026041 Unclassified 929
312 Ga0207702_10071590 3300026078 Bacteria 2986
313 Ga0207702_10130183 3300026078 Bacteria 2263
314 Ga0207641_10113975 3300026088 Bacteria 2401
315 Ga0207641_10122009 3300026088 Bacteria 2327
316 Ga0207641_10179688 3300026088 Bacteria 1937
317 Ga0207648_10026968 3300026089 Bacteria 5102
318 Ga0207648_10157580 3300026089 Bacteria 2004
319 Ga0207648_10313967 3300026089 Bacteria 1407
320 Ga0207676_10003308 3300026095 Bacteria 11439
321 Ga0207676_10086193 3300026095 Bacteria 2565
322 Ga0207674_10005767 3300026116 Bacteria 14688
323 Ga0207674_10051760 3300026116 Bacteria 4190
324 Ga0207675_100000422 3300026118 Bacteria 40963
325 Ga0207675_100394040 3300026118 Bacteria 1364
326 Ga0207675_100884313 3300026118 Bacteria 909
327 Ga0207683_10041041 3300026121 Bacteria 4039
328 Ga0207683_10048794 3300026121 Unclassified 3705
329 Ga0207683_11333243 3300026121 Bacteria 664
330 Ga0207698_10005847 3300026142 Bacteria 7643
331 Ga0207698_10022495 3300026142 Bacteria 4382
332 Ga0207698_10041812 3300026142 Unclassified 3419
333 Ga0207698_10689647 3300026142 Bacteria 1015
334 Ga0207698_10971809 3300026142 Bacteria 859
335 Ga0207698_11011351 3300026142 Unclassified 842
336 Ga0207698_11081528 3300026142 Unclassified 814
337 Ga0209974_10123419 3300027876 Unclassified 919
338 Ga0207428_10135440 3300027907 Unclassified 1883
339 Ga0268265_10154489 3300028380 Bacteria 1940
340 Ga0268264_10025154 3300028381 Bacteria 4863
341 Ga0268264_10249687 3300028381 Bacteria 1648
342 Ga0268264_11113525 3300028381 Bacteria 798
343 Ga0268264_11423823 3300028381 Bacteria 704
344 Ga0307517_10140289 3300028786 Bacteria 1700
345 Ga0307517_10201153 3300028786 Unclassified 1245
346 Ga0307512_10441808 3300030522 Bacteria 529
347 Ga0265762_1018702 3300030760 Bacteria 1265
348 Ga0307513_10083037 3300031456 Bacteria 3296
349 Ga0307513_10548296 3300031456 Bacteria 869
350 Ga0307509_10028924 3300031507 Bacteria 6156
351 Ga0307509_10344670 3300031507 Bacteria 1216
352 Ga0307516_10000330 3300031730 Bacteria 61733
353 Ga0307516_10828286 3300031730 Bacteria 588
354 Ga0307405_10118259 3300031731 Bacteria 1809
355 Ga0307413_10172112 3300031824 Bacteria 1534
356 Ga0307406_10386413 3300031901 Bacteria 1105
357 Ga0307406_11767970 3300031901 Bacteria 549
358 Ga0307409_100986931 3300031995 Bacteria 860
359 Ga0307416_100015491 3300032002 Bacteria 5270
360 Ga0307510_10003946 3300033180 Bacteria 17390
361 Ga0307510_10540774 3300033180 Bacteria 610
362 Ga0439436_0012657 3300041404 Bacteria 2560
363 Ga0439436_0104513 3300041404 Bacteria 790
364 Ga0439439_0015898 3300041406 Bacteria 1839
365 Ga0439439_0053887 3300041406 Bacteria 1058
366 Ga0439439_0102227 3300041406 Bacteria 789
367 Ga0439465_0052263 3300041413 Bacteria 1340
368 Ga0451807_1139477 3300041486 Bacteria 552
369 Ga0451851_0464671 3300041507 Bacteria 1003
370 Ga0451853_0631556 3300041512 Bacteria 569
371 Ga0451853_4124014 3300041512 Bacteria 638
372 Ga0439431_0142833 3300041997 Bacteria 677
373 Ga0439433_0087358 3300041999 Bacteria 764
374 Ga0439442_130846 3300042002 Bacteria 552
375 Ga0439445_0158116 3300042004 Bacteria 661
376 Ga0439432_193075 3300042006 Unclassified 591
377 Ga0439449_0007361 3300042007 Bacteria 4182
378 Ga0439452_037413 3300042010 Bacteria 1157
379 Ga0439457_000215 3300042014 Bacteria 15407
380 Ga0439457_025261 3300042014 Bacteria 1315
381 Ga0439457_103064 3300042014 Bacteria 666
382 Ga0439462_0002424 3300042015 Bacteria 4328
383 Ga0439462_0125975 3300042015 Bacteria 714
384 Ga0439462_0134852 3300042015 Unclassified 690
385 Ga0450890_019704 3300042127 Bacteria 910
386 Ga0450896_017399 3300042133 Unclassified 1037
387 Ga0450898_000574 3300042134 Bacteria 4372
388 Ga0439446_0324248 3300042156 Unclassified 545
389 Ga0439434_0043248 3300042435 Bacteria 1386
390 Ga0439434_0058911 3300042435 Bacteria 1199
391 Ga0450893_0005766 3300042532 Bacteria 1996
392 Ga0451577_0088691 3300042876 Bacteria 2760
393 Ga0451577_1135110 3300042876 Unclassified 699
394 Ga0466972_0000061 3300044658 Bacteria 109075
395 Ga0466972_0022840 3300044658 Unclassified 3112
396 Ga0466972_0106651 3300044658 Bacteria 1325
397 Ga0466972_0455652 3300044658 Bacteria 601
398 Ga0466965_0498909 3300044683 Unclassified 682
399 Ga0466964_0178975 3300044706 Bacteria 1004
400 Ga0466964_0488498 3300044706 Bacteria 659
401 Ga0453684_0283121 3300044712 Bacteria 1890
402 Ga0466968_0258098 3300044735 Bacteria 829
403 Ga0466957_0014301 3300044842 Bacteria 4620
404 Ga0495638_0134592 3300046460 Bacteria 1449
405 Ga0495580_0605618 3300046472 Bacteria 724
406 Ga0495606_0002204 3300046507 Bacteria 23334
407 Ga0495648_0007051 3300046524 Bacteria 9059
408 Ga0495611_0000147 3300046648 Bacteria 50044
409 Ga0495611_0257562 3300046648 Bacteria 808
410 Ga0495625_0196549 3300046660 Unclassified 1333
411 Ga0495613_0494559 3300046689 Bacteria 824
412 Ga0495672_0023013 3300047320 Bacteria 4040
413 Ga0495672_0032055 3300047320 Bacteria 3273
414 Ga0495672_0343276 3300047320 Bacteria 695
415 Ga0495686_0000016 3300047472 Bacteria 443701
416 Ga0495686_0220469 3300047472 Bacteria 1079
417 Ga0495686_0673565 3300047472 Bacteria 530
418 Ga0496100_0616959 3300048903 Bacteria 843
419 Ga0496101_0312633 3300048904 Bacteria 1232
420 Ga0496104_0931859 3300048907 Bacteria 773
421 Ga0496105_0462396 3300048908 Bacteria 1000
422 Ga0501032_0010492 3300049569 Bacteria 6682
423 Ga0501033_0642191 3300049570 Bacteria 725
424 Ga0501034_0000017 3300049571 Bacteria 285938
425 Ga0501034_0076784 3300049571 Bacteria 3346
426 Ga0501034_0127343 3300049571 Unclassified 2531
427 Ga0501034_0129401 3300049571 Bacteria 2508
428 Ga0501036_0344155 3300049572 Unclassified 1245
429 Ga0501037_0128216 3300049573 Unclassified 1820
430 Ga0501038_0004093 3300049574 Bacteria 13564
431 Ga0501038_0047121 3300049574 Unclassified 3735
432 Ga0501038_0745078 3300049574 Bacteria 731
433 Ga0501039_0032658 3300049575 Bacteria 4013
434 Ga0501039_0141841 3300049575 Unclassified 1887
435 Ga0501043_0058841 3300049579 Bacteria 3016
436 Ga0501043_0256379 3300049579 Bacteria 1346
437 Ga0501043_0386876 3300049579 Unclassified 1058
438 Ga0501047_0008104 3300049581 Bacteria 9914
439 Ga0501047_0055596 3300049581 Unclassified 3827
440 Ga0501047_0343505 3300049581 Unclassified 1330
441 Ga0501047_0567804 3300049581 Bacteria 958
442 Ga0501074_0569206 3300049590 Bacteria 802
443 Ga0501207_026515 3300049654 Bacteria 955
444 Ga0501243_023718 3300049675 Unclassified 1022
445 Ga0501080_0317042 3300049742 Bacteria 1412
446 Ga0501080_0437990 3300049742 Bacteria 1173
447 Ga0501241_006736 3300049758 Bacteria 2111
448 Ga0501035_0074792 3300049822 Bacteria 2996
449 Ga0501035_0772434 3300049822 Bacteria 769
450 Ga0501044_0048373 3300049823 Bacteria 4393
451 Ga0501044_0148088 3300049823 Bacteria 2331
452 Ga0501044_0166729 3300049823 Bacteria 2177
453 Ga0501044_0399356 3300049823 Bacteria 1287
454 Ga0501284_00099 3300050005 Bacteria 17950
455 nmdc:mga0k408_212044_c1 3300050493 Bacteria 1156
456 nmdc:mga0k408_391330_c1 3300050493 Bacteria 828
457 nmdc:mga0k408_625709_c1 3300050493 Bacteria 634
458 nmdc:mga08y16_83654_c1 3300050511 Bacteria 3326
459 nmdc:mga0rr50_457492_c1 3300050513 Bacteria 1082
460 Ga0500578_0470861 3300053086 Bacteria 712
461 Ga0500643_046972 3300053087 Bacteria 1245
462 Ga0500646_0002176 3300053090 Bacteria 5113
463 Ga0500646_0013809 3300053090 Bacteria 2093
464 Ga0500583_0000029 3300053092 Bacteria 107304
465 Ga0500583_0057331 3300053092 Bacteria 1828
466 Ga0500651_0217743 3300053093 Bacteria 1121
467 Ga0500651_0530538 3300053093 Bacteria 646
468 Ga0500650_0122055 3300053098 Bacteria 1214
469 Ga0500555_016891 3300053103 Bacteria 2103
470 Ga0500569_035988 3300053109 Bacteria 1423
471 Ga0500569_090286 3300053109 Bacteria 992
472 Ga0500594_0018540 3300053118 Bacteria 1716
473 Ga0500595_043792 3300053119 Bacteria 1423
474 Ga0500608_046010 3300053122 Bacteria 2097
475 Ga0500621_248925 3300053126 Bacteria 598
476 Ga0500642_0012234 3300053130 Bacteria 3103
477 Ga0500655_033038 3300053133 Bacteria 1000
478 Ga0500658_0180502 3300053134 Bacteria 961
479 Ga0500658_0185482 3300053134 Bacteria 948
480 Ga0500568_0017784 3300053139 Unclassified 3129
481 Ga0500588_0001882 3300053146 Bacteria 4115
482 Ga0500589_012984 3300053147 Bacteria 3659
483 Ga0500622_0001976 3300053156 Bacteria 15412
484 Ga0500622_0035381 3300053156 Bacteria 2613
485 Ga0500622_0065107 3300053156 Bacteria 1852
486 Ga0500637_0065154 3300053178 Bacteria 2090
487 Ga0500637_0528414 3300053178 Bacteria 577
488 Ga0500645_004308 3300053730 Bacteria 5484
489 Ga0500645_125831 3300053730 Bacteria 713
490 Ga0500645_161687 3300053730 Bacteria 614
491 Ga0500587_006229 3300053739 Bacteria 1588
492 Ga0587088_210262 3300059508 Bacteria 501
493 Ga0501082_1006022 3300060353 Bacteria 729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10010838 rootH1_100108383 137
2 3300003320 rootH2_10014508 rootH2_100145085 137
3 3300003320 rootH2_10036928 rootH2_100369283 137
4 3300003320 rootH2_10036934 rootH2_100369344 137
5 3300003322 rootL2_10079223 rootL2_100792233 137
6 3300003323 rootH1_10063907 rootH1_100639072 137
7 3300003323 rootH1_10249477 rootH1_102494772 137
8 3300005327 Ga0070658_11304996 Ga0070658_113049961 137
9 3300005328 Ga0070676_10206022 Ga0070676_102060221 137
10 3300005331 Ga0070670_101352366 Ga0070670_1013523661 137
11 3300005334 Ga0068869_100625514 Ga0068869_1006255141 137
12 3300005335 Ga0070666_10124580 Ga0070666_101245802 137
13 3300005337 Ga0070682_101139877 Ga0070682_1011398771 137
14 3300005338 Ga0068868_100626087 Ga0068868_1006260871 137
15 3300005339 Ga0070660_100581721 Ga0070660_1005817212 137
16 3300005341 Ga0070691_10201312 Ga0070691_102013122 137
17 3300005354 Ga0070675_100589842 Ga0070675_1005898422 137
18 3300005355 Ga0070671_100028986 Ga0070671_1000289862 137
19 3300005356 Ga0070674_100802179 Ga0070674_1008021791 137
20 3300005356 Ga0070674_100920300 Ga0070674_1009203002 137
21 3300005364 Ga0070673_100057425 Ga0070673_1000574253 137
22 3300005367 Ga0070667_101058259 Ga0070667_1010582591 137
23 3300005441 Ga0070700_100041588 Ga0070700_1000415883 137
24 3300005457 Ga0070662_100436553 Ga0070662_1004365532 137
25 3300005457 Ga0070662_100560159 Ga0070662_1005601593 137
26 3300005458 Ga0070681_11285232 Ga0070681_112852321 137
27 3300005459 Ga0068867_100008939 Ga0068867_1000089393 137
28 3300005459 Ga0068867_100150269 Ga0068867_1001502693 137
29 3300005466 Ga0070685_10266786 Ga0070685_102667861 137
30 3300005471 Ga0070698_100216440 Ga0070698_1002164402 137
31 3300005539 Ga0068853_100011572 Ga0068853_10001157210 137
32 3300005539 Ga0068853_100018549 Ga0068853_1000185493 137
33 3300005539 Ga0068853_100348235 Ga0068853_1003482352 137
34 3300005539 Ga0068853_101090495 Ga0068853_1010904951 137
35 3300005543 Ga0070672_100069850 Ga0070672_1000698502 137
36 3300005544 Ga0070686_100002884 Ga0070686_10000288410 137
37 3300005563 Ga0068855_100049776 Ga0068855_1000497761 137
38 3300005563 Ga0068855_100124093 Ga0068855_1001240932 137
39 3300005563 Ga0068855_100311646 Ga0068855_1003116461 137
40 3300005564 Ga0070664_100031925 Ga0070664_1000319254 137
41 3300005577 Ga0068857_100039698 Ga0068857_1000396985 137
42 3300005578 Ga0068854_100046131 Ga0068854_1000461314 137
43 3300005578 Ga0068854_100178145 Ga0068854_1001781452 137
44 3300005578 Ga0068854_102126760 Ga0068854_1021267601 137
45 3300005614 Ga0068856_100093596 Ga0068856_1000935962 137
46 3300005614 Ga0068856_100383972 Ga0068856_1003839722 137
47 3300005615 Ga0070702_100022312 Ga0070702_1000223122 137
48 3300005616 Ga0068852_100034326 Ga0068852_1000343262 137
49 3300005616 Ga0068852_100107775 Ga0068852_1001077753 137
50 3300005616 Ga0068852_100238129 Ga0068852_1002381293 137
51 3300005616 Ga0068852_100288992 Ga0068852_1002889922 137
52 3300005618 Ga0068864_101342541 Ga0068864_1013425411 137
53 3300005719 Ga0068861_100382225 Ga0068861_1003822252 137
54 3300005834 Ga0068851_10410440 Ga0068851_104104401 137
55 3300005842 Ga0068858_100209474 Ga0068858_1002094741 137
56 3300005843 Ga0068860_100664403 Ga0068860_1006644032 137
57 3300006195 Ga0075366_10086149 Ga0075366_100861492 137
58 3300006195 Ga0075366_10155166 Ga0075366_101551662 137
59 3300006195 Ga0075366_10246252 Ga0075366_102462521 137
60 3300006195 Ga0075366_10540012 Ga0075366_105400122 137
61 3300006195 Ga0075366_10574210 Ga0075366_105742101 137
62 3300006358 Ga0068871_100370646 Ga0068871_1003706461 137
63 3300007076 Ga0075435_101512049 Ga0075435_1015120491 137
64 3300009093 Ga0105240_10000143 Ga0105240_1000014396 137
65 3300009093 Ga0105240_10000551 Ga0105240_1000055112 137
66 3300009093 Ga0105240_10007226 Ga0105240_100072266 137
67 3300009093 Ga0105240_10054329 Ga0105240_100543292 137
68 3300009093 Ga0105240_10139854 Ga0105240_101398542 137
69 3300009093 Ga0105240_10318162 Ga0105240_103181621 137
70 3300009093 Ga0105240_10342403 Ga0105240_103424032 137
71 3300009093 Ga0105240_10536581 Ga0105240_105365811 137
72 3300009094 Ga0111539_10331885 Ga0111539_103318853 137
73 3300009101 Ga0105247_10323200 Ga0105247_103232001 137
74 3300009147 Ga0114129_10004633 Ga0114129_100046339 137
75 3300009174 Ga0105241_10020483 Ga0105241_100204831 137
76 3300009174 Ga0105241_10165542 Ga0105241_101655421 137
77 3300009176 Ga0105242_10412588 Ga0105242_104125883 137
78 3300009545 Ga0105237_10003347 Ga0105237_100033472 137
79 3300009545 Ga0105237_10007614 Ga0105237_100076145 137
80 3300009545 Ga0105237_10033712 Ga0105237_100337125 137
81 3300009545 Ga0105237_10160188 Ga0105237_101601882 137
82 3300009545 Ga0105237_10634014 Ga0105237_106340141 137
83 3300009551 Ga0105238_10021583 Ga0105238_1002158310 137
84 3300009551 Ga0105238_10262229 Ga0105238_102622292 137
85 3300009551 Ga0105238_10869376 Ga0105238_108693761 137
86 3300009553 Ga0105249_11246099 Ga0105249_112460991 137
87 3300010375 Ga0105239_10003235 Ga0105239_100032351 137
88 3300010375 Ga0105239_10022589 Ga0105239_100225892 137
89 3300010375 Ga0105239_10027826 Ga0105239_100278262 137
90 3300010375 Ga0105239_10034112 Ga0105239_100341122 137
91 3300013100 Ga0157373_10072984 Ga0157373_100729843 137
92 3300013100 Ga0157373_10276692 Ga0157373_102766921 137
93 3300013100 Ga0157373_10298645 Ga0157373_102986451 137
94 3300013104 Ga0157370_10002155 Ga0157370_1000215513 137
95 3300013104 Ga0157370_10497414 Ga0157370_104974142 137
96 3300013104 Ga0157370_10680842 Ga0157370_106808421 137
97 3300013105 Ga0157369_10008630 Ga0157369_100086301 137
98 3300013296 Ga0157374_10048019 Ga0157374_100480193 137
99 3300013296 Ga0157374_10270114 Ga0157374_102701142 137
100 3300013297 Ga0157378_10011538 Ga0157378_100115384 137
101 3300013297 Ga0157378_10518049 Ga0157378_105180492 137
102 3300013307 Ga0157372_10007174 Ga0157372_1000717414 137
103 3300013307 Ga0157372_10071366 Ga0157372_100713661 137
104 3300013307 Ga0157372_10104320 Ga0157372_101043204 137
105 3300014325 Ga0163163_10026514 Ga0163163_100265142 137
106 3300014326 Ga0157380_10011360 Ga0157380_100113604 137
107 3300014326 Ga0157380_13028016 Ga0157380_130280161 137
108 3300014745 Ga0157377_10019125 Ga0157377_100191253 137
109 3300014968 Ga0157379_10419529 Ga0157379_104195292 137
110 3300014969 Ga0157376_11033660 Ga0157376_110336601 137
111 3300017792 Ga0163161_10483820 Ga0163161_104838203 137
112 3300017792 Ga0163161_10536374 Ga0163161_105363742 137
113 3300017792 Ga0163161_11647171 Ga0163161_116471711 137
114 3300020078 Ga0206352_10357943 Ga0206352_103579431 137
115 3300025904 Ga0207647_10011439 Ga0207647_100114395 137
116 3300025907 Ga0207645_10046433 Ga0207645_100464332 137
117 3300025911 Ga0207654_10024376 Ga0207654_100243762 137
118 3300025911 Ga0207654_10363930 Ga0207654_103639302 137
119 3300025912 Ga0207707_10509571 Ga0207707_105095712 137
120 3300025913 Ga0207695_10000016 Ga0207695_10000016425 137
121 3300025913 Ga0207695_10000758 Ga0207695_1000075845 137
122 3300025913 Ga0207695_10102076 Ga0207695_101020765 137
123 3300025913 Ga0207695_10136421 Ga0207695_101364213 137
124 3300025913 Ga0207695_10159252 Ga0207695_101592522 137
125 3300025913 Ga0207695_10310048 Ga0207695_103100481 137
126 3300025913 Ga0207695_10352866 Ga0207695_103528662 137
127 3300025914 Ga0207671_10002097 Ga0207671_100020979 137
128 3300025914 Ga0207671_10003246 Ga0207671_1000324614 137
129 3300025914 Ga0207671_10005581 Ga0207671_100055819 137
130 3300025914 Ga0207671_10006376 Ga0207671_100063767 137
131 3300025914 Ga0207671_10576581 Ga0207671_105765812 137
132 3300025918 Ga0207662_10074312 Ga0207662_100743121 137
133 3300025924 Ga0207694_10076085 Ga0207694_100760852 137
134 3300025924 Ga0207694_10190809 Ga0207694_101908092 137
135 3300025924 Ga0207694_10435190 Ga0207694_104351901 137
136 3300025925 Ga0207650_11063212 Ga0207650_110632121 137
137 3300025928 Ga0207700_11156299 Ga0207700_111562991 137
138 3300025931 Ga0207644_10053853 Ga0207644_100538531 137
139 3300025933 Ga0207706_11519516 Ga0207706_115195161 137
140 3300025934 Ga0207686_11812532 Ga0207686_118125321 137
141 3300025937 Ga0207669_10705981 Ga0207669_107059812 137
142 3300025940 Ga0207691_10021140 Ga0207691_100211406 137
143 3300025940 Ga0207691_10147178 Ga0207691_101471783 137
144 3300025942 Ga0207689_10057444 Ga0207689_100574442 137
145 3300025945 Ga0207679_10028999 Ga0207679_100289995 137
146 3300025949 Ga0207667_10004084 Ga0207667_1000408411 137
147 3300025949 Ga0207667_10032655 Ga0207667_100326553 137
148 3300025949 Ga0207667_10290669 Ga0207667_102906691 137
149 3300025960 Ga0207651_10040014 Ga0207651_100400143 137
150 3300025960 Ga0207651_10945674 Ga0207651_109456741 137
151 3300025961 Ga0207712_10280905 Ga0207712_102809052 137
152 3300025961 Ga0207712_10427955 Ga0207712_104279551 137
153 3300025981 Ga0207640_10041054 Ga0207640_100410542 137
154 3300025981 Ga0207640_10502304 Ga0207640_105023042 137
155 3300025981 Ga0207640_11939374 Ga0207640_119393741 137
156 3300025986 Ga0207658_10917018 Ga0207658_109170181 137
157 3300026023 Ga0207677_10178402 Ga0207677_101784021 137
158 3300026041 Ga0207639_10019994 Ga0207639_100199943 137
159 3300026041 Ga0207639_10689246 Ga0207639_106892462 137
160 3300026041 Ga0207639_10715937 Ga0207639_107159372 137
161 3300026078 Ga0207702_10071590 Ga0207702_100715904 137
162 3300026078 Ga0207702_10130183 Ga0207702_101301832 137
163 3300026089 Ga0207648_10026968 Ga0207648_100269682 137
164 3300026116 Ga0207674_10051760 Ga0207674_100517603 137
165 3300026118 Ga0207675_100884313 Ga0207675_1008843132 137
166 3300026121 Ga0207683_10041041 Ga0207683_100410412 137
167 3300026142 Ga0207698_10005847 Ga0207698_100058472 137
168 3300026142 Ga0207698_10041812 Ga0207698_100418124 137
169 3300026142 Ga0207698_10689647 Ga0207698_106896471 137
170 3300026142 Ga0207698_11011351 Ga0207698_110113512 137
171 3300026142 Ga0207698_11081528 Ga0207698_110815281 137
172 3300028381 Ga0268264_11113525 Ga0268264_111135251 137
173 3300028786 Ga0307517_10140289 Ga0307517_101402893 137
174 3300028786 Ga0307517_10201153 Ga0307517_102011533 137
175 3300030522 Ga0307512_10441808 Ga0307512_104418081 137
176 3300030760 Ga0265762_1018702 Ga0265762_10187021 137
177 3300031456 Ga0307513_10083037 Ga0307513_100830372 137
178 3300031456 Ga0307513_10548296 Ga0307513_105482961 137
179 3300031507 Ga0307509_10028924 Ga0307509_100289243 137
180 3300031507 Ga0307509_10344670 Ga0307509_103446702 137
181 3300031730 Ga0307516_10000330 Ga0307516_1000033012 137
182 3300031730 Ga0307516_10828286 Ga0307516_108282861 137
183 3300031901 Ga0307406_11767970 Ga0307406_117679701 137
184 3300033180 Ga0307510_10003946 Ga0307510_1000394613 137
185 3300033180 Ga0307510_10540774 Ga0307510_105407741 137
186 3300041404 Ga0439436_0012657 Ga0439436_0012657_2053_2466 137
187 3300041404 Ga0439436_0104513 Ga0439436_0104513_278_691 137
188 3300041406 Ga0439439_0015898 Ga0439439_0015898_1140_1553 137
189 3300041406 Ga0439439_0102227 Ga0439439_0102227_76_489 137
190 3300041507 Ga0451851_0464671 Ga0451851_0464671_505_918 137
191 3300041512 Ga0451853_0631556 Ga0451853_0631556_89_502 137
192 3300041512 Ga0451853_4124014 Ga0451853_4124014_188_601 137
193 3300041997 Ga0439431_0142833 Ga0439431_0142833_88_501 137
194 3300041999 Ga0439433_0087358 Ga0439433_0087358_64_477 137
195 3300042007 Ga0439449_0007361 Ga0439449_0007361_1599_2012 137
196 3300042014 Ga0439457_000215 Ga0439457_000215_4781_5194 137
197 3300042014 Ga0439457_025261 Ga0439457_025261_370_783 137
198 3300042015 Ga0439462_0002424 Ga0439462_0002424_2683_3096 137
199 3300042876 Ga0451577_1135110 Ga0451577_1135110_201_614 137
200 3300044658 Ga0466972_0000061 Ga0466972_0000061_6171_6629 137
201 3300044658 Ga0466972_0022840 Ga0466972_0022840_158_571 137
202 3300044658 Ga0466972_0106651 Ga0466972_0106651_46_459 137
203 3300044658 Ga0466972_0455652 Ga0466972_0455652_46_459 137
204 3300044683 Ga0466965_0498909 Ga0466965_0498909_162_575 137
205 3300044706 Ga0466964_0178975 Ga0466964_0178975_424_837 137
206 3300044706 Ga0466964_0488498 Ga0466964_0488498_154_567 137
207 3300044712 Ga0453684_0283121 Ga0453684_0283121_778_1191 137
208 3300044735 Ga0466968_0258098 Ga0466968_0258098_248_661 137
209 3300044842 Ga0466957_0014301 Ga0466957_0014301_862_1275 137
210 3300046460 Ga0495638_0134592 Ga0495638_0134592_317_730 137
211 3300046507 Ga0495606_0002204 Ga0495606_0002204_6224_6637 137
212 3300046524 Ga0495648_0007051 Ga0495648_0007051_5363_5776 137
213 3300046648 Ga0495611_0000147 Ga0495611_0000147_12600_13013 137
214 3300046648 Ga0495611_0257562 Ga0495611_0257562_326_739 137
215 3300046660 Ga0495625_0196549 Ga0495625_0196549_359_772 137
216 3300046689 Ga0495613_0494559 Ga0495613_0494559_134_547 137
217 3300047320 Ga0495672_0343276 Ga0495672_0343276_270_683 137
218 3300047472 Ga0495686_0000016 Ga0495686_0000016_368415_368828 137
219 3300049569 Ga0501032_0010492 Ga0501032_0010492_6148_6561 137
220 3300049570 Ga0501033_0642191 Ga0501033_0642191_181_594 137
221 3300049571 Ga0501034_0129401 Ga0501034_0129401_31_444 137
222 3300049572 Ga0501036_0344155 Ga0501036_0344155_669_1082 137
223 3300049573 Ga0501037_0128216 Ga0501037_0128216_311_724 137
224 3300049574 Ga0501038_0047121 Ga0501038_0047121_1903_2316 137
225 3300049574 Ga0501038_0745078 Ga0501038_0745078_146_604 137
226 3300049575 Ga0501039_0141841 Ga0501039_0141841_1429_1842 137
227 3300049579 Ga0501043_0256379 Ga0501043_0256379_12_425 137
228 3300049581 Ga0501047_0008104 Ga0501047_0008104_5094_5552 137
229 3300049581 Ga0501047_0055596 Ga0501047_0055596_2092_2505 137
230 3300049654 Ga0501207_026515 Ga0501207_026515_106_519 137
231 3300049758 Ga0501241_006736 Ga0501241_006736_91_504 137
232 3300049822 Ga0501035_0074792 Ga0501035_0074792_361_774 137
233 3300049823 Ga0501044_0048373 Ga0501044_0048373_496_954 137
234 3300049823 Ga0501044_0399356 Ga0501044_0399356_132_545 137
235 3300050005 Ga0501284_00099 Ga0501284_00099_9134_9547 137
236 3300050493 nmdc:mga0k408_212044_c1 nmdc:mga0k408_212044_c1_663_1076 137
237 3300050493 nmdc:mga0k408_391330_c1 nmdc:mga0k408_391330_c1_286_699 137
238 3300050493 nmdc:mga0k408_625709_c1 nmdc:mga0k408_625709_c1_120_533 137
239 3300053086 Ga0500578_0470861 Ga0500578_0470861_133_546 137
240 3300053087 Ga0500643_046972 Ga0500643_046972_813_1226 137
241 3300053090 Ga0500646_0002176 Ga0500646_0002176_2401_2814 137
242 3300053090 Ga0500646_0013809 Ga0500646_0013809_1649_2062 137
243 3300053092 Ga0500583_0000029 Ga0500583_0000029_103934_104347 137
244 3300053092 Ga0500583_0057331 Ga0500583_0057331_32_445 137
245 3300053093 Ga0500651_0217743 Ga0500651_0217743_626_1039 137
246 3300053093 Ga0500651_0530538 Ga0500651_0530538_220_633 137
247 3300053098 Ga0500650_0122055 Ga0500650_0122055_728_1141 137
248 3300053103 Ga0500555_016891 Ga0500555_016891_259_672 137
249 3300053109 Ga0500569_035988 Ga0500569_035988_594_1007 137
250 3300053109 Ga0500569_090286 Ga0500569_090286_497_910 137
251 3300053118 Ga0500594_0018540 Ga0500594_0018540_103_516 137
252 3300053119 Ga0500595_043792 Ga0500595_043792_366_779 137
253 3300053126 Ga0500621_248925 Ga0500621_248925_49_462 137
254 3300053130 Ga0500642_0012234 Ga0500642_0012234_31_444 137
255 3300053134 Ga0500658_0180502 Ga0500658_0180502_490_903 137
256 3300053134 Ga0500658_0185482 Ga0500658_0185482_132_545 137
257 3300053139 Ga0500568_0017784 Ga0500568_0017784_1693_2106 137
258 3300053146 Ga0500588_0001882 Ga0500588_0001882_2804_3217 137
259 3300053147 Ga0500589_012984 Ga0500589_012984_1270_1683 137
260 3300053156 Ga0500622_0001976 Ga0500622_0001976_7169_7582 137
261 3300053156 Ga0500622_0035381 Ga0500622_0035381_443_856 137
262 3300053156 Ga0500622_0065107 Ga0500622_0065107_293_706 137
263 3300053178 Ga0500637_0065154 Ga0500637_0065154_535_1041 137
264 3300053730 Ga0500645_004308 Ga0500645_004308_3149_3562 137
265 3300053730 Ga0500645_125831 Ga0500645_125831_132_545 137
266 3300053739 Ga0500587_006229 Ga0500587_006229_233_646 137
267 3300059508 Ga0587088_210262 Ga0587088_210262_72_485 137
268 2162886011 MRS1b_contig_976832 MRS1b_0162.00000020 138
269 3300005288 Ga0065714_10190746 Ga0065714_101907461 138
270 3300005289 Ga0065704_10115507 Ga0065704_101155073 138
271 3300005290 Ga0065712_10184852 Ga0065712_101848522 138
272 3300005295 Ga0065707_10319697 Ga0065707_103196972 138
273 3300005331 Ga0070670_100155923 Ga0070670_1001559233 138
274 3300005331 Ga0070670_100702247 Ga0070670_1007022471 138
275 3300005333 Ga0070677_10013638 Ga0070677_100136382 138
276 3300005334 Ga0068869_100017002 Ga0068869_1000170024 138
277 3300005334 Ga0068869_100132047 Ga0068869_1001320472 138
278 3300005335 Ga0070666_11101326 Ga0070666_111013261 138
279 3300005344 Ga0070661_101046521 Ga0070661_1010465211 138
280 3300005347 Ga0070668_100024244 Ga0070668_1000242441 138
281 3300005347 Ga0070668_100096990 Ga0070668_1000969903 138
282 3300005347 Ga0070668_100563923 Ga0070668_1005639232 138
283 3300005353 Ga0070669_100118524 Ga0070669_1001185242 138
284 3300005353 Ga0070669_100260142 Ga0070669_1002601422 138
285 3300005354 Ga0070675_100006553 Ga0070675_1000065537 138
286 3300005354 Ga0070675_100031488 Ga0070675_1000314883 138
287 3300005355 Ga0070671_100005252 Ga0070671_1000052526 138
288 3300005356 Ga0070674_100463557 Ga0070674_1004635572 138
289 3300005364 Ga0070673_100006882 Ga0070673_1000068823 138
290 3300005364 Ga0070673_100018724 Ga0070673_1000187245 138
291 3300005365 Ga0070688_100002109 Ga0070688_1000021092 138
292 3300005366 Ga0070659_100002765 Ga0070659_1000027659 138
293 3300005367 Ga0070667_100035020 Ga0070667_1000350203 138
294 3300005367 Ga0070667_100201963 Ga0070667_1002019632 138
295 3300005367 Ga0070667_100264924 Ga0070667_1002649242 138
296 3300005367 Ga0070667_100442368 Ga0070667_1004423682 138
297 3300005444 Ga0070694_100247067 Ga0070694_1002470671 138
298 3300005456 Ga0070678_100143511 Ga0070678_1001435113 138
299 3300005457 Ga0070662_100025304 Ga0070662_1000253043 138
300 3300005459 Ga0068867_100065927 Ga0068867_1000659272 138
301 3300005459 Ga0068867_100674708 Ga0068867_1006747081 138
302 3300005471 Ga0070698_100313432 Ga0070698_1003134322 138
303 3300005539 Ga0068853_101046598 Ga0068853_1010465981 138
304 3300005543 Ga0070672_100145808 Ga0070672_1001458083 138
305 3300005544 Ga0070686_100108068 Ga0070686_1001080682 138
306 3300005548 Ga0070665_100376784 Ga0070665_1003767842 138
307 3300005548 Ga0070665_100479899 Ga0070665_1004798991 138
308 3300005548 Ga0070665_102560641 Ga0070665_1025606411 138
309 3300005564 Ga0070664_100247053 Ga0070664_1002470532 138
310 3300005564 Ga0070664_100514564 Ga0070664_1005145641 138
311 3300005577 Ga0068857_100003505 Ga0068857_10000350513 138
312 3300005615 Ga0070702_101412918 Ga0070702_1014129181 138
313 3300005616 Ga0068852_100004062 Ga0068852_1000040624 138
314 3300005616 Ga0068852_100625796 Ga0068852_1006257962 138
315 3300005617 Ga0068859_100016032 Ga0068859_1000160322 138
316 3300005617 Ga0068859_100020489 Ga0068859_1000204896 138
317 3300005618 Ga0068864_100010951 Ga0068864_1000109518 138
318 3300005618 Ga0068864_101207237 Ga0068864_1012072371 138
319 3300005718 Ga0068866_10394588 Ga0068866_103945881 138
320 3300005719 Ga0068861_100001965 Ga0068861_1000019657 138
321 3300005834 Ga0068851_10028209 Ga0068851_100282092 138
322 3300005840 Ga0068870_10004870 Ga0068870_100048703 138
323 3300005841 Ga0068863_100125362 Ga0068863_1001253622 138
324 3300005841 Ga0068863_100316971 Ga0068863_1003169712 138
325 3300005842 Ga0068858_100106495 Ga0068858_1001064952 138
326 3300005843 Ga0068860_100039636 Ga0068860_1000396362 138
327 3300005843 Ga0068860_100312890 Ga0068860_1003128902 138
328 3300005843 Ga0068860_102150303 Ga0068860_1021503031 138
329 3300005844 Ga0068862_100002806 Ga0068862_1000028062 138
330 3300005844 Ga0068862_100181521 Ga0068862_1001815212 138
331 3300006237 Ga0097621_100000240 Ga0097621_10000024016 138
332 3300006237 Ga0097621_100080529 Ga0097621_1000805293 138
333 3300006237 Ga0097621_100940484 Ga0097621_1009404842 138
334 3300006358 Ga0068871_100001592 Ga0068871_1000015929 138
335 3300006358 Ga0068871_100069681 Ga0068871_1000696814 138
336 3300006358 Ga0068871_100593989 Ga0068871_1005939891 138
337 3300006881 Ga0068865_100213394 Ga0068865_1002133942 138
338 3300006931 Ga0097620_100016032 Ga0097620_1000160322 138
339 3300006931 Ga0097620_100020491 Ga0097620_1000204915 138
340 3300007076 Ga0075435_100472592 Ga0075435_1004725922 138
341 3300009093 Ga0105240_10021439 Ga0105240_100214398 138
342 3300009094 Ga0111539_10000891 Ga0111539_1000089119 138
343 3300009176 Ga0105242_10014570 Ga0105242_100145703 138
344 3300009176 Ga0105242_10040705 Ga0105242_100407051 138
345 3300009176 Ga0105242_10792276 Ga0105242_107922762 138
346 3300009177 Ga0105248_10029195 Ga0105248_100291952 138
347 3300009553 Ga0105249_10013308 Ga0105249_100133089 138
348 3300009553 Ga0105249_10021451 Ga0105249_100214513 138
349 3300009553 Ga0105249_10088025 Ga0105249_100880252 138
350 3300009553 Ga0105249_10167203 Ga0105249_101672033 138
351 3300009553 Ga0105249_11324649 Ga0105249_113246492 138
352 3300009553 Ga0105249_11593767 Ga0105249_115937671 138
353 3300013102 Ga0157371_10011950 Ga0157371_100119506 138
354 3300013102 Ga0157371_10180871 Ga0157371_101808712 138
355 3300013104 Ga0157370_10052530 Ga0157370_100525304 138
356 3300013104 Ga0157370_10307384 Ga0157370_103073842 138
357 3300013105 Ga0157369_10041664 Ga0157369_100416645 138
358 3300013105 Ga0157369_10308908 Ga0157369_103089083 138
359 3300013297 Ga0157378_10038701 Ga0157378_100387013 138
360 3300013297 Ga0157378_10130050 Ga0157378_101300502 138
361 3300013297 Ga0157378_10232411 Ga0157378_102324112 138
362 3300013306 Ga0163162_10000732 Ga0163162_100007327 138
363 3300013306 Ga0163162_10004783 Ga0163162_1000478312 138
364 3300013306 Ga0163162_11669618 Ga0163162_116696181 138
365 3300013307 Ga0157372_10013342 Ga0157372_100133426 138
366 3300013307 Ga0157372_10327797 Ga0157372_103277973 138
367 3300013308 Ga0157375_10019034 Ga0157375_100190342 138
368 3300013308 Ga0157375_12125030 Ga0157375_121250301 138
369 3300014325 Ga0163163_10011454 Ga0163163_100114549 138
370 3300014326 Ga0157380_10000351 Ga0157380_1000035118 138
371 3300014745 Ga0157377_10008920 Ga0157377_100089204 138
372 3300014968 Ga0157379_10035508 Ga0157379_100355082 138
373 3300014968 Ga0157379_10037205 Ga0157379_100372053 138
374 3300014968 Ga0157379_11240049 Ga0157379_112400492 138
375 3300014969 Ga0157376_10000321 Ga0157376_1000032122 138
376 3300014969 Ga0157376_11068804 Ga0157376_110688042 138
377 3300017792 Ga0163161_10035946 Ga0163161_100359462 138
378 3300017792 Ga0163161_10135669 Ga0163161_101356692 138
379 3300025315 Ga0207697_10022395 Ga0207697_100223952 138
380 3300025315 Ga0207697_10072778 Ga0207697_100727783 138
381 3300025893 Ga0207682_10014859 Ga0207682_100148592 138
382 3300025903 Ga0207680_11024715 Ga0207680_110247151 138
383 3300025904 Ga0207647_10000057 Ga0207647_1000005743 138
384 3300025907 Ga0207645_10078138 Ga0207645_100781382 138
385 3300025908 Ga0207643_10025185 Ga0207643_100251854 138
386 3300025920 Ga0207649_11144367 Ga0207649_111443671 138
387 3300025923 Ga0207681_10035878 Ga0207681_100358785 138
388 3300025925 Ga0207650_10253889 Ga0207650_102538892 138
389 3300025925 Ga0207650_11299294 Ga0207650_112992941 138
390 3300025926 Ga0207659_10038511 Ga0207659_100385112 138
391 3300025931 Ga0207644_10011465 Ga0207644_100114654 138
392 3300025931 Ga0207644_10614090 Ga0207644_106140902 138
393 3300025932 Ga0207690_10129371 Ga0207690_101293712 138
394 3300025933 Ga0207706_10062630 Ga0207706_100626302 138
395 3300025934 Ga0207686_10030840 Ga0207686_100308401 138
396 3300025934 Ga0207686_10338955 Ga0207686_103389552 138
397 3300025936 Ga0207670_10084776 Ga0207670_100847762 138
398 3300025937 Ga0207669_10474708 Ga0207669_104747082 138
399 3300025938 Ga0207704_10385791 Ga0207704_103857911 138
400 3300025938 Ga0207704_10792452 Ga0207704_107924522 138
401 3300025940 Ga0207691_10001600 Ga0207691_100016003 138
402 3300025940 Ga0207691_10138588 Ga0207691_101385881 138
403 3300025941 Ga0207711_10019031 Ga0207711_100190314 138
404 3300025942 Ga0207689_10070303 Ga0207689_100703033 138
405 3300025942 Ga0207689_10279582 Ga0207689_102795822 138
406 3300025944 Ga0207661_10417148 Ga0207661_104171481 138
407 3300025945 Ga0207679_10527935 Ga0207679_105279351 138
408 3300025945 Ga0207679_10574482 Ga0207679_105744822 138
409 3300025960 Ga0207651_10011964 Ga0207651_100119644 138
410 3300025960 Ga0207651_10090910 Ga0207651_100909103 138
411 3300025961 Ga0207712_10011232 Ga0207712_100112327 138
412 3300025972 Ga0207668_10041649 Ga0207668_100416492 138
413 3300025972 Ga0207668_10090986 Ga0207668_100909863 138
414 3300025972 Ga0207668_10775831 Ga0207668_107758311 138
415 3300025986 Ga0207658_10174527 Ga0207658_101745272 138
416 3300025986 Ga0207658_10292090 Ga0207658_102920901 138
417 3300025986 Ga0207658_10596800 Ga0207658_105968002 138
418 3300026041 Ga0207639_10565953 Ga0207639_105659532 138
419 3300026088 Ga0207641_10113975 Ga0207641_101139752 138
420 3300026088 Ga0207641_10122009 Ga0207641_101220091 138
421 3300026088 Ga0207641_10179688 Ga0207641_101796882 138
422 3300026089 Ga0207648_10157580 Ga0207648_101575802 138
423 3300026089 Ga0207648_10313967 Ga0207648_103139672 138
424 3300026095 Ga0207676_10003308 Ga0207676_100033088 138
425 3300026095 Ga0207676_10086193 Ga0207676_100861933 138
426 3300026116 Ga0207674_10005767 Ga0207674_100057675 138
427 3300026118 Ga0207675_100000422 Ga0207675_10000042213 138
428 3300026118 Ga0207675_100394040 Ga0207675_1003940402 138
429 3300026121 Ga0207683_10048794 Ga0207683_100487943 138
430 3300026121 Ga0207683_11333243 Ga0207683_113332431 138
431 3300026142 Ga0207698_10022495 Ga0207698_100224953 138
432 3300026142 Ga0207698_10971809 Ga0207698_109718091 138
433 3300027876 Ga0209974_10123419 Ga0209974_101234192 138
434 3300027907 Ga0207428_10135440 Ga0207428_101354402 138
435 3300028380 Ga0268265_10154489 Ga0268265_101544891 138
436 3300028381 Ga0268264_10025154 Ga0268264_100251542 138
437 3300028381 Ga0268264_10249687 Ga0268264_102496872 138
438 3300028381 Ga0268264_11423823 Ga0268264_114238231 138
439 3300031731 Ga0307405_10118259 Ga0307405_101182593 138
440 3300031824 Ga0307413_10172112 Ga0307413_101721123 138
441 3300031901 Ga0307406_10386413 Ga0307406_103864132 138
442 3300031995 Ga0307409_100986931 Ga0307409_1009869312 138
443 3300032002 Ga0307416_100015491 Ga0307416_1000154912 138
444 3300041406 Ga0439439_0053887 Ga0439439_0053887_614_1030 138
445 3300041413 Ga0439465_0052263 Ga0439465_0052263_399_815 138
446 3300041486 Ga0451807_1139477 Ga0451807_1139477_62_478 138
447 3300042002 Ga0439442_130846 Ga0439442_130846_107_523 138
448 3300042004 Ga0439445_0158116 Ga0439445_0158116_77_493 138
449 3300042006 Ga0439432_193075 Ga0439432_193075_75_491 138
450 3300042010 Ga0439452_037413 Ga0439452_037413_611_1108 138
451 3300042014 Ga0439457_103064 Ga0439457_103064_231_647 138
452 3300042015 Ga0439462_0125975 Ga0439462_0125975_142_558 138
453 3300042015 Ga0439462_0134852 Ga0439462_0134852_51_467 138
454 3300042127 Ga0450890_019704 Ga0450890_019704_309_725 138
455 3300042133 Ga0450896_017399 Ga0450896_017399_221_637 138
456 3300042134 Ga0450898_000574 Ga0450898_000574_16_432 138
457 3300042156 Ga0439446_0324248 Ga0439446_0324248_15_431 138
458 3300042435 Ga0439434_0043248 Ga0439434_0043248_657_1073 138
459 3300042435 Ga0439434_0058911 Ga0439434_0058911_274_690 138
460 3300042532 Ga0450893_0005766 Ga0450893_0005766_1236_1652 138
461 3300042876 Ga0451577_0088691 Ga0451577_0088691_246_662 138
462 3300046472 Ga0495580_0605618 Ga0495580_0605618_132_548 138
463 3300047320 Ga0495672_0023013 Ga0495672_0023013_1022_1438 138
464 3300047320 Ga0495672_0032055 Ga0495672_0032055_894_1310 138
465 3300047472 Ga0495686_0220469 Ga0495686_0220469_154_579 138
466 3300047472 Ga0495686_0673565 Ga0495686_0673565_73_489 138
467 3300048903 Ga0496100_0616959 Ga0496100_0616959_33_449 138
468 3300048904 Ga0496101_0312633 Ga0496101_0312633_411_827 138
469 3300048907 Ga0496104_0931859 Ga0496104_0931859_344_760 138
470 3300048908 Ga0496105_0462396 Ga0496105_0462396_474_890 138
471 3300049571 Ga0501034_0000017 Ga0501034_0000017_170713_171129 138
472 3300049571 Ga0501034_0076784 Ga0501034_0076784_1803_2219 138
473 3300049571 Ga0501034_0127343 Ga0501034_0127343_511_927 138
474 3300049574 Ga0501038_0004093 Ga0501038_0004093_11574_11990 138
475 3300049575 Ga0501039_0032658 Ga0501039_0032658_2273_2689 138
476 3300049579 Ga0501043_0058841 Ga0501043_0058841_1628_2044 138
477 3300049579 Ga0501043_0386876 Ga0501043_0386876_351_767 138
478 3300049581 Ga0501047_0343505 Ga0501047_0343505_831_1247 138
479 3300049581 Ga0501047_0567804 Ga0501047_0567804_305_721 138
480 3300049590 Ga0501074_0569206 Ga0501074_0569206_209_625 138
481 3300049675 Ga0501243_023718 Ga0501243_023718_210_626 138
482 3300049742 Ga0501080_0317042 Ga0501080_0317042_416_832 138
483 3300049742 Ga0501080_0437990 Ga0501080_0437990_667_1083 138
484 3300049822 Ga0501035_0772434 Ga0501035_0772434_108_524 138
485 3300049823 Ga0501044_0148088 Ga0501044_0148088_626_1042 138
486 3300049823 Ga0501044_0166729 Ga0501044_0166729_792_1208 138
487 3300050511 nmdc:mga08y16_83654_c1 nmdc:mga08y16_83654_c1_986_1402 138
488 3300050513 nmdc:mga0rr50_457492_c1 nmdc:mga0rr50_457492_c1_517_933 138
489 3300053122 Ga0500608_046010 Ga0500608_046010_1198_1614 138
490 3300053133 Ga0500655_033038 Ga0500655_033038_163_579 138
491 3300053178 Ga0500637_0528414 Ga0500637_0528414_52_468 138
492 3300053730 Ga0500645_161687 Ga0500645_161687_152_568 138
493 3300060353 Ga0501082_1006022 Ga0501082_1006022_192_608 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06491

Disulph_isomer

Disulphide isomerase

33

168

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.958 4 137
7rzb-assembly1.cif.gz_A-2 brxa from staphylococcus aureus with bacillithiol mixed disulfide 0.9479 3 138
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.9246 4 137
3iv4-assembly1.cif.gz_A a putative oxidoreductase with a thioredoxin fold 0.83 16 131
3iv4-assembly1.cif.gz_A a putative oxidoreductase with a thioredoxin fold 0.7905 16 131
ID Description Score Start End Superfamily
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9677 19 137 3.40.30.10
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9598 19 137 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9405 19 137 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9182 19 137 3.40.30.10
af_Q2G066_1_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8268 21 131 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7C4Y0K2-F1-model_v4 BrxA/BrxB family bacilliredoxin 1.002 53 138
AF-A0A1N6FS19-F1-model_v4 Putative bacilliredoxin, YphP/YqiW family 0.9878 1 137
AF-A0A317LZ60-F1-model_v4 Putative YphP/YqiW family bacilliredoxin 0.9866 1 137
AF-A0A1I5I8J0-F1-model_v4 Putative bacilliredoxin, YphP/YqiW family 0.9865 1 137
AF-A0A4R6INA8-F1-model_v4 Putative YphP/YqiW family bacilliredoxin 0.986 1 138

Feature Viewer

pLDDT pTM Quality
93.39 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map