F454495

General Info

Members Datasets Scaffolds Average Seq Length
493 266 986 310

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_2749_c1|nmdc:mga03683_2749_c1_3698_4822
Length 374
Sequence MAALRRCVKAGSGRAEIDRFKPAAIRCIVAAQNRMPLRMQQRREEAMRLARRRFLQLASSAVATAVPRIANAQAYPTRPITLVVPYPPGGPTDTIARLLAERMRAPLGQPIVIENVSGGGGTIAVTRVSRAPGDGYTIGIGHWGSHVINGAVYTLPINVLTDLEPIALISDGPQLLTAAKNVPAKNLTELIAWLKANPGKGLVGTTGVGGASHLAAILFAKTIGAEVQIVPYRGTAPRMQDMLAGTIHLAFDQVAGGLPQVQAGALQCYAVTSKTRLAVAPDIPTVDEAGLPGFYISVWHGMWASKGTPRDIIARLSASLVDALADATVRQRLIDLGQELPTPERITPEALGAYQKAEAEKWWPIVKAAGIKVD

Samples

Sample ID Description Type Environment
1 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
164 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 0
Rhizoplane 13.39
Rhizosphere 78.9
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03683_2749_c1 3300050489 Bacteria 5520
2 JGI25151J46595_10000174 3300003187 Bacteria 83009
3 JGI25153J46596_10001063 3300003215 Bacteria 16760
4 Ga0070690_100012374 3300005330 Bacteria 5021
5 Ga0070690_100030283 3300005330 Bacteria 3361
6 Ga0070690_100182793 3300005330 Unclassified 1449
7 Ga0070690_100282460 3300005330 Bacteria 1184
8 Ga0070677_10006262 3300005333 Bacteria 3948
9 Ga0068869_100070352 3300005334 Bacteria 2589
10 Ga0068869_100141636 3300005334 Bacteria 1857
11 Ga0070666_10036663 3300005335 Unclassified 3256
12 Ga0070680_100006895 3300005336 Bacteria 8661
13 Ga0070682_100172605 3300005337 Bacteria 1504
14 Ga0068868_100022271 3300005338 Bacteria 4779
15 Ga0068868_100293789 3300005338 Bacteria 1378
16 Ga0070660_100162996 3300005339 Bacteria 1797
17 Ga0070660_100279827 3300005339 Bacteria 1365
18 Ga0070689_100000399 3300005340 Bacteria 25458
19 Ga0070689_100112986 3300005340 Unclassified 2162
20 Ga0070687_100022958 3300005343 Bacteria 2958
21 Ga0070687_100024719 3300005343 Bacteria 2873
22 Ga0070668_100374993 3300005347 Bacteria 1210
23 Ga0070669_100022370 3300005353 Bacteria 4520
24 Ga0070669_100093918 3300005353 Bacteria 2253
25 Ga0070675_100061399 3300005354 Bacteria 3103
26 Ga0070675_100090937 3300005354 Bacteria 2556
27 Ga0070675_100154117 3300005354 Bacteria 1972
28 Ga0070675_100435506 3300005354 Bacteria 1174
29 Ga0070671_100057079 3300005355 Unclassified 3248
30 Ga0070671_100361934 3300005355 Bacteria 1238
31 Ga0070671_100466702 3300005355 Bacteria 1084
32 Ga0070674_100000456 3300005356 Bacteria 20586
33 Ga0070674_100061862 3300005356 Bacteria 2614
34 Ga0070674_100065663 3300005356 Bacteria 2547
35 Ga0070674_100303185 3300005356 Unclassified 1274
36 Ga0070674_100408800 3300005356 Bacteria 1111
37 Ga0070673_100021267 3300005364 Bacteria 4699
38 Ga0070673_100026117 3300005364 Bacteria 4308
39 Ga0070688_100036078 3300005365 Bacteria 3006
40 Ga0070667_100054149 3300005367 Bacteria 3387
41 Ga0070713_100132591 3300005436 Bacteria 2199
42 Ga0070710_10162843 3300005437 Bacteria 1385
43 Ga0070705_100135682 3300005440 Bacteria 1612
44 Ga0070705_100137973 3300005440 Bacteria 1601
45 Ga0070708_100241131 3300005445 Bacteria 1697
46 Ga0070663_100091026 3300005455 Bacteria 2260
47 Ga0070678_100198470 3300005456 Unclassified 1654
48 Ga0070678_100276396 3300005456 Bacteria 1418
49 Ga0070678_100439399 3300005456 Bacteria 1141
50 Ga0070662_100379767 3300005457 Bacteria 1163
51 Ga0070681_10010946 3300005458 Bacteria 8971
52 Ga0070681_10093671 3300005458 Bacteria 2953
53 Ga0068867_100329261 3300005459 Bacteria 1268
54 Ga0070679_100006669 3300005530 Bacteria 10764
55 Ga0070679_100346295 3300005530 Bacteria 1434
56 Ga0070684_100072837 3300005535 Bacteria 3026
57 Ga0068853_100088285 3300005539 Bacteria 2722
58 Ga0070672_100019484 3300005543 Bacteria 4925
59 Ga0070672_100322245 3300005543 Bacteria 1314
60 Ga0070672_100334118 3300005543 Bacteria 1289
61 Ga0070686_100025852 3300005544 Bacteria 3536
62 Ga0070696_100065316 3300005546 Bacteria 2551
63 Ga0070665_100151156 3300005548 Bacteria 2325
64 Ga0070665_100284387 3300005548 Bacteria 1656
65 Ga0070704_100088338 3300005549 Unclassified 2303
66 Ga0070664_100052836 3300005564 Bacteria 3443
67 Ga0068857_100091041 3300005577 Bacteria 2730
68 Ga0068854_100192572 3300005578 Bacteria 1598
69 Ga0068854_100411030 3300005578 Bacteria 1122
70 Ga0068856_100347986 3300005614 Bacteria 1501
71 Ga0070702_100005470 3300005615 Bacteria 5920
72 Ga0070702_100013931 3300005615 Bacteria 4071
73 Ga0070702_100215925 3300005615 Unclassified 1279
74 Ga0068852_100089534 3300005616 Bacteria 2751
75 Ga0068859_100039153 3300005617 Bacteria 4755
76 Ga0068859_100621021 3300005617 Bacteria 1173
77 Ga0068864_100185808 3300005618 Bacteria 1903
78 Ga0068864_100309195 3300005618 Bacteria 1481
79 Ga0068861_100034295 3300005719 Bacteria 3752
80 Ga0068861_100384697 3300005719 Bacteria 1241
81 Ga0068861_100421960 3300005719 Bacteria 1189
82 Ga0068863_100133497 3300005841 Bacteria 2371
83 Ga0068858_100213895 3300005842 Bacteria 1824
84 Ga0068858_100419553 3300005842 Bacteria 1287
85 Ga0068860_100002602 3300005843 Bacteria 18884
86 Ga0068862_100032297 3300005844 Bacteria 4422
87 Ga0081455_10007642 3300005937 Bacteria 11353
88 Ga0081455_10022722 3300005937 Bacteria 5853
89 Ga0081455_10153933 3300005937 Bacteria 1770
90 Ga0070717_10043255 3300006028 Bacteria 3676
91 Ga0075365_10198145 3300006038 Bacteria 1406
92 Ga0075368_10000446 3300006042 Bacteria 12188
93 Ga0075363_100009123 3300006048 Bacteria 4656
94 Ga0075363_100024940 3300006048 Bacteria 3044
95 Ga0075364_10020154 3300006051 Bacteria 4194
96 Ga0075364_10130350 3300006051 Bacteria 1687
97 Ga0075367_10042250 3300006178 Bacteria 2667
98 Ga0075367_10069352 3300006178 Bacteria 2117
99 Ga0075369_10010036 3300006186 Bacteria 3698
100 Ga0075366_10007051 3300006195 Bacteria 6185
101 Ga0075366_10017761 3300006195 Bacteria 4100
102 Ga0097621_100342110 3300006237 Bacteria 1328
103 Ga0097621_100422497 3300006237 Bacteria 1197
104 Ga0075370_10017630 3300006353 Bacteria 3861
105 Ga0075370_10065646 3300006353 Bacteria 2070
106 Ga0068871_100338739 3300006358 Bacteria 1328
107 Ga0075428_100037046 3300006844 Bacteria 5372
108 Ga0075428_100194514 3300006844 Bacteria 2194
109 Ga0075428_100257969 3300006844 Bacteria 1878
110 Ga0075430_100031661 3300006846 Bacteria 4488
111 Ga0075430_100193820 3300006846 Bacteria 1688
112 Ga0075431_100166885 3300006847 Unclassified 2263
113 Ga0075433_10085196 3300006852 Bacteria 2790
114 Ga0075434_100046319 3300006871 Bacteria 4315
115 Ga0075434_100091942 3300006871 Bacteria 3036
116 Ga0075429_100040939 3300006880 Bacteria 4034
117 Ga0075429_100058775 3300006880 Bacteria 3349
118 Ga0075429_100145198 3300006880 Bacteria 2077
119 Ga0068865_100014574 3300006881 Bacteria 4998
120 Ga0097620_100039153 3300006931 Bacteria 4755
121 Ga0097620_100621021 3300006931 Bacteria 1173
122 Ga0099795_10000249 3300007788 Bacteria 9580
123 Ga0111539_10004683 3300009094 Bacteria 17879
124 Ga0111539_10030025 3300009094 Bacteria 6613
125 Ga0111539_10067349 3300009094 Bacteria 4228
126 Ga0111539_10105844 3300009094 Bacteria 3300
127 Ga0111539_10111822 3300009094 Bacteria 3205
128 Ga0111539_10335673 3300009094 Bacteria 1759
129 Ga0111539_10353354 3300009094 Bacteria 1710
130 Ga0105245_10029905 3300009098 Bacteria 4816
131 Ga0105245_10643408 3300009098 Bacteria 1090
132 Ga0105247_10134011 3300009101 Bacteria 1617
133 Ga0114129_10011697 3300009147 Bacteria 12487
134 Ga0114129_10042892 3300009147 Bacteria 6366
135 Ga0114129_10215863 3300009147 Bacteria 2591
136 Ga0105243_10048140 3300009148 Bacteria 3359
137 Ga0105243_10055735 3300009148 Bacteria 3141
138 Ga0105242_10497668 3300009176 Bacteria 1159
139 Ga0105248_10045028 3300009177 Bacteria 4948
140 Ga0105248_10553433 3300009177 Bacteria 1298
141 Ga0105249_10023992 3300009553 Bacteria 5478
142 Ga0105249_10374618 3300009553 Bacteria 1448
143 Ga0105239_10095875 3300010375 Bacteria 3277
144 Ga0105239_10219214 3300010375 Bacteria 2133
145 Ga0105246_10342809 3300011119 Bacteria 1222
146 Ga0157378_10370449 3300013297 Bacteria 1404
147 Ga0163162_10031945 3300013306 Bacteria 5225
148 Ga0157375_10226912 3300013308 Bacteria 2026
149 Ga0157375_10433369 3300013308 Bacteria 1480
150 Ga0157375_10646918 3300013308 Bacteria 1214
151 Ga0163163_10044944 3300014325 Bacteria 4334
152 Ga0163163_10133306 3300014325 Bacteria 2524
153 Ga0157380_10020339 3300014326 Bacteria 4959
154 Ga0157380_10103896 3300014326 Bacteria 2371
155 Ga0157380_10133356 3300014326 Bacteria 2122
156 Ga0157380_10190646 3300014326 Unclassified 1809
157 Ga0157380_10192375 3300014326 Unclassified 1802
158 Ga0157380_10412028 3300014326 Bacteria 1286
159 Ga0157380_10434098 3300014326 Bacteria 1256
160 Ga0157377_10008215 3300014745 Bacteria 5079
161 Ga0157377_10073627 3300014745 Unclassified 1980
162 Ga0157377_10212568 3300014745 Bacteria 1234
163 Ga0157379_10024104 3300014968 Bacteria 5401
164 Ga0157379_10197930 3300014968 Bacteria 1816
165 Ga0157379_10226459 3300014968 Unclassified 1694
166 Ga0157376_10116344 3300014969 Bacteria 2362
167 Ga0157376_10145750 3300014969 Bacteria 2129
168 Ga0163161_10060219 3300017792 Bacteria 2763
169 Ga0163161_10105980 3300017792 Bacteria 2097
170 Ga0213872_10027557 3300021361 Bacteria 2608
171 Ga0209758_1000079 3300025297 Bacteria 262874
172 Ga0209758_1029447 3300025297 Bacteria 2295
173 Ga0207697_10094320 3300025315 Bacteria 1270
174 Ga0207656_10055429 3300025321 Unclassified 1725
175 Ga0207682_10005754 3300025893 Bacteria 5029
176 Ga0207682_10011152 3300025893 Unclassified 3515
177 Ga0207710_10026883 3300025900 Bacteria 2488
178 Ga0207688_10008894 3300025901 Bacteria 5464
179 Ga0207688_10015657 3300025901 Bacteria 4113
180 Ga0207688_10030538 3300025901 Bacteria 2972
181 Ga0207688_10069110 3300025901 Bacteria 2001
182 Ga0207647_10011378 3300025904 Bacteria 6241
183 Ga0207685_10052672 3300025905 Bacteria 1577
184 Ga0207645_10039283 3300025907 Bacteria 3032
185 Ga0207645_10047531 3300025907 Bacteria 2740
186 Ga0207643_10033499 3300025908 Bacteria 2874
187 Ga0207643_10105979 3300025908 Bacteria 1652
188 Ga0207684_10098847 3300025910 Bacteria 2492
189 Ga0207707_10062009 3300025912 Bacteria 3253
190 Ga0207663_10020536 3300025916 Bacteria 3742
191 Ga0207663_10304106 3300025916 Bacteria 1193
192 Ga0207660_10202275 3300025917 Bacteria 1552
193 Ga0207662_10000773 3300025918 Bacteria 14699
194 Ga0207662_10019325 3300025918 Unclassified 3875
195 Ga0207662_10124100 3300025918 Bacteria 1622
196 Ga0207657_10008032 3300025919 Bacteria 10762
197 Ga0207681_10074176 3300025923 Bacteria 2383
198 Ga0207650_10001141 3300025925 Bacteria 19510
199 Ga0207659_10039339 3300025926 Bacteria 3298
200 Ga0207659_10159225 3300025926 Bacteria 1771
201 Ga0207687_10099029 3300025927 Bacteria 2141
202 Ga0207687_10432134 3300025927 Bacteria 1089
203 Ga0207687_10453412 3300025927 Bacteria 1064
204 Ga0207700_10096853 3300025928 Bacteria 2344
205 Ga0207644_10033628 3300025931 Bacteria 3585
206 Ga0207706_10009235 3300025933 Bacteria 9062
207 Ga0207706_10017536 3300025933 Bacteria 6453
208 Ga0207706_10422094 3300025933 Bacteria 1155
209 Ga0207686_10139133 3300025934 Bacteria 1675
210 Ga0207709_10293819 3300025935 Bacteria 1205
211 Ga0207670_10000333 3300025936 Bacteria 27980
212 Ga0207670_10066213 3300025936 Bacteria 2481
213 Ga0207670_10245928 3300025936 Bacteria 1380
214 Ga0207669_10015535 3300025937 Bacteria 3842
215 Ga0207669_10142168 3300025937 Bacteria 1667
216 Ga0207704_10099884 3300025938 Bacteria 1931
217 Ga0207691_10031106 3300025940 Bacteria 4984
218 Ga0207691_10092481 3300025940 Unclassified 2709
219 Ga0207691_10118514 3300025940 Bacteria 2348
220 Ga0207691_10126828 3300025940 Bacteria 2258
221 Ga0207691_10230151 3300025940 Bacteria 1605
222 Ga0207711_10059249 3300025941 Bacteria 3297
223 Ga0207679_10098357 3300025945 Bacteria 2281
224 Ga0207679_10107306 3300025945 Bacteria 2197
225 Ga0207712_10170907 3300025961 Bacteria 1699
226 Ga0207668_10070186 3300025972 Bacteria 2497
227 Ga0207668_10231865 3300025972 Bacteria 1489
228 Ga0207658_10048315 3300025986 Bacteria 3120
229 Ga0207658_10116812 3300025986 Bacteria 2120
230 Ga0207703_10292255 3300026035 Bacteria 1483
231 Ga0207703_10476027 3300026035 Bacteria 1170
232 Ga0207639_10133413 3300026041 Bacteria 2059
233 Ga0207678_10146956 3300026067 Bacteria 2012
234 Ga0207678_10597034 3300026067 Bacteria 968
235 Ga0207708_10003986 3300026075 Bacteria 10864
236 Ga0207708_10055841 3300026075 Bacteria 3011
237 Ga0207708_10209810 3300026075 Bacteria 1556
238 Ga0207702_10126805 3300026078 Bacteria 2292
239 Ga0207641_10128207 3300026088 Bacteria 2274
240 Ga0207648_10026075 3300026089 Bacteria 5197
241 Ga0207648_10034821 3300026089 Bacteria 4439
242 Ga0207676_10038846 3300026095 Bacteria 3636
243 Ga0207676_10203890 3300026095 Bacteria 1749
244 Ga0207676_10236315 3300026095 Bacteria 1637
245 Ga0207674_10149238 3300026116 Bacteria 2295
246 Ga0207675_100012385 3300026118 Bacteria 7966
247 Ga0207675_100200797 3300026118 Bacteria 1915
248 Ga0207675_100339225 3300026118 Bacteria 1471
249 Ga0207675_100427733 3300026118 Bacteria 1308
250 Ga0207675_100441040 3300026118 Bacteria 1289
251 Ga0207675_100508272 3300026118 Bacteria 1200
252 Ga0207683_10014072 3300026121 Bacteria 6820
253 Ga0207683_10021976 3300026121 Bacteria 5473
254 Ga0207683_10040848 3300026121 Bacteria 4050
255 Ga0207683_10072860 3300026121 Bacteria 3038
256 Ga0207683_10177295 3300026121 Bacteria 1932
257 Ga0207683_10480304 3300026121 Bacteria 1147
258 Ga0207698_10498369 3300026142 Bacteria 1185
259 Ga0209588_1027981 3300027671 Bacteria 1794
260 Ga0207428_10028564 3300027907 Bacteria 4633
261 Ga0207428_10115186 3300027907 Bacteria 2065
262 Ga0268266_10061901 3300028379 Bacteria 3228
263 Ga0268266_10388870 3300028379 Bacteria 1317
264 Ga0268265_10267664 3300028380 Bacteria 1523
265 Ga0268264_10025873 3300028381 Bacteria 4792
266 Ga0268264_10039267 3300028381 Bacteria 3910
267 Ga0268264_10320863 3300028381 Bacteria 1465
268 Ga0265332_10011597 3300031238 Bacteria 3915
269 Ga0265329_10049534 3300031242 Unclassified 1338
270 Ga0265340_10042810 3300031247 Bacteria 2221
271 Ga0265339_10000679 3300031249 Bacteria 26306
272 Ga0265339_10013976 3300031249 Bacteria 4854
273 Ga0265313_10000123 3300031595 Bacteria 77230
274 Ga0307411_10435509 3300032005 Bacteria 1093
275 Ga0373926_0076127 3300035083 Bacteria 1237
276 Ga0373944_0073118 3300035089 Bacteria 1120
277 Ga0373960_0031972 3300035121 Bacteria 1475
278 Ga0373943_0025199 3300035170 Bacteria 2779
279 Ga0373943_0037973 3300035170 Bacteria 2313
280 Ga0373946_0008672 3300035171 Bacteria 3733
281 Ga0373946_0054796 3300035171 Bacteria 1679
282 Ga0373931_0006808 3300035691 Bacteria 5370
283 Ga0373935_0211587 3300035692 Bacteria 1344
284 Ga0373935_0217338 3300035692 Bacteria 1326
285 Ga0373935_0368334 3300035692 Bacteria 1027
286 Ga0373927_0055661 3300035695 Bacteria 2558
287 Ga0373927_0191322 3300035695 Bacteria 1342
288 Ga0373947_0029376 3300035725 Unclassified 3226
289 Ga0373925_0019178 3300037068 Unclassified 4974
290 Ga0373925_0225617 3300037068 Bacteria 1496
291 Ga0373925_0305051 3300037068 Bacteria 1286
292 Ga0373925_0413334 3300037068 Bacteria 1101
293 Ga0395898_0380761 3300037466 Bacteria 1345
294 Ga0395901_0304635 3300038443 Bacteria 1651
295 Ga0436361_0430694 3300039447 Bacteria 4834
296 Ga0439453_0001720 3300041408 Bacteria 2882
297 Ga0439453_0016783 3300041408 Bacteria 1280
298 Ga0439460_0051642 3300042461 Bacteria 1234
299 Ga0495627_059037 3300046453 Bacteria 1138
300 Ga0495603_0094319 3300046455 Bacteria 1748
301 Ga0495590_0074795 3300046457 Bacteria 1191
302 Ga0495629_0194777 3300046459 Bacteria 1402
303 Ga0495580_0036156 3300046472 Bacteria 3547
304 Ga0495582_0041758 3300046473 Bacteria 2527
305 Ga0495582_0147566 3300046473 Bacteria 1335
306 Ga0495584_0051007 3300046491 Bacteria 2084
307 Ga0495584_0056979 3300046491 Bacteria 1966
308 Ga0495584_0081952 3300046491 Bacteria 1624
309 Ga0495585_0110231 3300046492 Bacteria 1464
310 Ga0495594_0212400 3300046499 Bacteria 1103
311 Ga0495596_0060132 3300046500 Bacteria 1480
312 Ga0495596_0070292 3300046500 Bacteria 1360
313 Ga0495618_0124057 3300046514 Bacteria 1654
314 Ga0495631_0080931 3300046518 Bacteria 1401
315 Ga0495637_0078924 3300046520 Bacteria 1315
316 Ga0495644_0050040 3300046523 Bacteria 1568
317 Ga0495663_0038060 3300046525 Bacteria 1453
318 Ga0495663_0057674 3300046525 Bacteria 1215
319 Ga0495663_0067289 3300046525 Bacteria 1135
320 Ga0495666_0017245 3300046526 Bacteria 3597
321 Ga0495652_0389307 3300046529 Bacteria 990
322 Ga0495640_0062930 3300046533 Bacteria 2515
323 Ga0495598_0008449 3300046537 Bacteria 2399
324 Ga0495598_0012861 3300046537 Bacteria 2064
325 Ga0495598_0051878 3300046537 Bacteria 1237
326 Ga0495598_0075057 3300046537 Bacteria 1073
327 Ga0495609_0126729 3300046538 Bacteria 1095
328 Ga0495621_0019156 3300046539 Bacteria 2232
329 Ga0495633_0037935 3300046558 Bacteria 2304
330 Ga0495633_0110979 3300046558 Bacteria 1271
331 Ga0495667_0250884 3300046559 Bacteria 1126
332 Ga0495656_0108892 3300046615 Bacteria 1292
333 Ga0495611_0048808 3300046648 Bacteria 1903
334 Ga0495659_0022591 3300046664 Bacteria 2131
335 Ga0495659_0064468 3300046664 Bacteria 1360
336 Ga0495661_0122892 3300046665 Bacteria 1431
337 Ga0495588_0085094 3300046674 Bacteria 1653
338 Ga0495658_0006243 3300046683 Bacteria 5857
339 Ga0495658_0087411 3300046683 Bacteria 1841
340 Ga0495658_0091217 3300046683 Bacteria 1804
341 Ga0495669_0152504 3300046684 Bacteria 1094
342 Ga0495613_0069769 3300046689 Bacteria 2562
343 Ga0495670_0051904 3300046691 Bacteria 2052
344 Ga0495670_0128572 3300046691 Bacteria 1319
345 Ga0495670_0166745 3300046691 Bacteria 1159
346 Ga0495671_0108836 3300046692 Bacteria 1353
347 Ga0495589_0040736 3300046794 Bacteria 2319
348 Ga0495589_0090317 3300046794 Bacteria 1487
349 Ga0495589_0098721 3300046794 Bacteria 1414
350 Ga0495636_0136504 3300047318 Bacteria 1093
351 Ga0495674_0162351 3300047319 Bacteria 1869
352 Ga0495674_0526366 3300047319 Bacteria 943
353 Ga0495676_0306648 3300047321 Bacteria 1069
354 Ga0495683_0079582 3300047323 Bacteria 1600
355 Ga0495677_0092465 3300047445 Bacteria 1140
356 Ga0495685_091655 3300047447 Bacteria 1007
357 Ga0495684_0072688 3300047471 Bacteria 2613
358 Ga0495615_0058019 3300048090 Bacteria 1014
359 Ga0495626_0125790 3300048091 Bacteria 1098
360 Ga0496100_0038155 3300048903 Bacteria 3042
361 Ga0496100_0055218 3300048903 Bacteria 2594
362 Ga0496101_0022079 3300048904 Bacteria 4378
363 Ga0496101_0198461 3300048904 Bacteria 1550
364 Ga0496102_0019096 3300048905 Bacteria 6034
365 Ga0496102_0125945 3300048905 Bacteria 2394
366 Ga0496102_0242597 3300048905 Bacteria 1699
367 Ga0496102_0459107 3300048905 Bacteria 1195
368 Ga0496103_0004835 3300048906 Bacteria 8136
369 Ga0496103_0075776 3300048906 Unclassified 2110
370 Ga0496103_0099679 3300048906 Bacteria 1838
371 Ga0496103_0132243 3300048906 Bacteria 1594
372 Ga0496104_0000703 3300048907 Bacteria 28736
373 Ga0496104_0000880 3300048907 Bacteria 25856
374 Ga0496104_0004090 3300048907 Bacteria 12659
375 Ga0496104_0029241 3300048907 Bacteria 5111
376 Ga0496104_0072178 3300048907 Bacteria 3282
377 Ga0496104_0079071 3300048907 Bacteria 3134
378 Ga0496104_0221976 3300048907 Bacteria 1802
379 Ga0496104_0269042 3300048907 Bacteria 1617
380 Ga0496105_0001416 3300048908 Bacteria 16859
381 Ga0496105_0005841 3300048908 Bacteria 9390
382 Ga0496105_0009051 3300048908 Bacteria 7769
383 Ga0496105_0036046 3300048908 Bacteria 4074
384 Ga0496105_0121407 3300048908 Bacteria 2154
385 Ga0496105_0124712 3300048908 Bacteria 2123
386 Ga0496105_0274653 3300048908 Bacteria 1360
387 Ga0496106_0085860 3300048909 Unclassified 2423
388 Ga0496106_0161863 3300048909 Bacteria 1770
389 Ga0496106_0267882 3300048909 Bacteria 1367
390 Ga0496107_0059643 3300048910 Bacteria 2761
391 Ga0496107_0185270 3300048910 Bacteria 1546
392 Ga0496108_0000522 3300048911 Bacteria 30076
393 Ga0496108_0013373 3300048911 Bacteria 6692
394 Ga0496108_0058567 3300048911 Bacteria 3238
395 Ga0496108_0068365 3300048911 Bacteria 2997
396 Ga0496108_0294944 3300048911 Bacteria 1412
397 Ga0496109_0000431 3300048912 Bacteria 36569
398 Ga0496109_0001714 3300048912 Bacteria 18286
399 Ga0496110_0005160 3300048913 Bacteria 10210
400 Ga0496110_0013411 3300048913 Bacteria 6774
401 Ga0496110_0066810 3300048913 Bacteria 3180
402 Ga0496110_0259623 3300048913 Bacteria 1581
403 Ga0496111_0000072 3300048914 Bacteria 41891
404 Ga0496111_0006641 3300048914 Bacteria 7526
405 Ga0496111_0015087 3300048914 Bacteria 5294
406 Ga0496111_0465793 3300048914 Bacteria 932
407 Ga0496112_0038603 3300048915 Bacteria 4663
408 Ga0496112_0046855 3300048915 Bacteria 4241
409 Ga0496112_0054593 3300048915 Bacteria 3926
410 Ga0496112_0083842 3300048915 Bacteria 3153
411 Ga0496112_0109221 3300048915 Unclassified 2736
412 Ga0496112_0421028 3300048915 Bacteria 1274
413 Ga0496113_0000058 3300048916 Bacteria 47947
414 Ga0496113_0013772 3300048916 Bacteria 5493
415 Ga0496113_0146868 3300048916 Bacteria 1858
416 Ga0496113_0151251 3300048916 Bacteria 1831
417 Ga0496113_0403834 3300048916 Bacteria 1097
418 Ga0496114_0021817 3300048917 Bacteria 5211
419 Ga0496114_0093822 3300048917 Bacteria 2552
420 Ga0496114_0188882 3300048917 Bacteria 1802
421 Ga0496114_0215423 3300048917 Bacteria 1685
422 Ga0496114_0339355 3300048917 Bacteria 1328
423 Ga0496115_0007584 3300048918 Bacteria 7992
424 Ga0496115_0056180 3300048918 Bacteria 3163
425 Ga0496115_0451929 3300048918 Bacteria 1038
426 Ga0501031_0001402 3300049568 Bacteria 14899
427 Ga0501034_0136768 3300049571 Bacteria 2431
428 Ga0501036_0009279 3300049572 Bacteria 8085
429 Ga0501036_0213222 3300049572 Unclassified 1622
430 Ga0501037_0049472 3300049573 Bacteria 3077
431 Ga0501038_0051602 3300049574 Bacteria 3548
432 Ga0501038_0104952 3300049574 Bacteria 2348
433 Ga0501039_0019439 3300049575 Bacteria 5208
434 Ga0501041_0094242 3300049577 Unclassified 1849
435 Ga0501042_0044082 3300049578 Bacteria 3178
436 Ga0501046_0038560 3300049580 Bacteria 3833
437 Ga0501046_0080257 3300049580 Bacteria 2521
438 Ga0501048_0028075 3300049582 Bacteria 4086
439 Ga0501067_0032681 3300049583 Bacteria 2887
440 Ga0501069_0012334 3300049585 Bacteria 4541
441 Ga0501070_0264488 3300049586 Bacteria 1405
442 Ga0501074_0013084 3300049590 Bacteria 6031
443 Ga0501076_0267133 3300049592 Unclassified 1401
444 Ga0501080_0066965 3300049742 Bacteria 3340
445 Ga0501081_0035568 3300049743 Bacteria 3391
446 Ga0501035_0239508 3300049822 Unclassified 1544
447 Ga0501044_0000743 3300049823 Bacteria 39318
448 Ga0501045_0009824 3300049824 Bacteria 6697
449 Ga0501045_0331525 3300049824 Unclassified 1132
450 nmdc:mga03683_88413_c1 3300050489 Bacteria 1348
451 nmdc:mga03n38_18234_c1 3300050490 Bacteria 2767
452 nmdc:mga00v17_245251_c1 3300050491 Bacteria 1162
453 nmdc:mga00v17_43462_c1 3300050491 Bacteria 2706
454 nmdc:mga0yw44_129063_c1 3300050492 Bacteria 1635
455 nmdc:mga0yw44_12946_c1 3300050492 Bacteria 4370
456 nmdc:mga0yw44_144040_c1 3300050492 Bacteria 1550
457 nmdc:mga0yw44_26997_c1 3300050492 Bacteria 3285
458 nmdc:mga0yw44_3991_c1 3300050492 Bacteria 6667
459 nmdc:mga0k408_5583_c1 3300050493 Bacteria 6692
460 nmdc:mga0k408_99951_c1 3300050493 Bacteria 1710
461 nmdc:mga06z11_4603_c1 3300050494 Bacteria 5439
462 nmdc:mga06z11_83915_c1 3300050494 Bacteria 1715
463 nmdc:mga04h51_2554_c1 3300050495 Bacteria 4333
464 nmdc:mga07m45_13513_c1 3300050496 Bacteria 4335
465 nmdc:mga07m45_62070_c1 3300050496 Bacteria 2117
466 nmdc:mga05p37_10904_c1 3300050507 Bacteria 10791
467 nmdc:mga05p37_291126_c1 3300050507 Bacteria 1944
468 nmdc:mga05p37_46637_c1 3300050507 Bacteria 5328
469 nmdc:mga05p37_9046_c1 3300050507 Bacteria 11775
470 nmdc:mga09592_61288_c1 3300050508 Bacteria 3182
471 nmdc:mga06r32_175750_c1 3300050510 Bacteria 2125
472 nmdc:mga06r32_558384_c1 3300050510 Bacteria 1118
473 nmdc:mga08y16_106466_c1 3300050511 Bacteria 2919
474 nmdc:mga08y16_40575_c1 3300050511 Bacteria 4877
475 nmdc:mga08y16_87087_c1 3300050511 Bacteria 3254
476 nmdc:mga0n895_149999_c1 3300050512 Bacteria 2361
477 nmdc:mga0n895_173642_c1 3300050512 Bacteria 2187
478 nmdc:mga0n895_28787_c1 3300050512 Bacteria 5289
479 nmdc:mga0n895_73514_c1 3300050512 Bacteria 3394
480 nmdc:mga0rr50_158265_c1 3300050513 Bacteria 1836
481 nmdc:mga0rr50_167769_c1 3300050513 Bacteria 1786
482 nmdc:mga0rr50_431642_c1 3300050513 Bacteria 1115
483 nmdc:mga08x19_70228_c1 3300050514 Bacteria 2282
484 Ga0495601_0119864 3300053077 Bacteria 1708
485 Ga0495655_0039055 3300053083 Bacteria 1201
486 Ga0495619_0028162 3300053085 Bacteria 3623
487 Ga0495619_0347005 3300053085 Bacteria 1027
488 Ga0500562_010698 3300053108 Bacteria 2327
489 Ga0500616_0032045 3300053153 Bacteria 2875
490 Ga0500636_0010368 3300053177 Bacteria 5435
491 Ga0501084_0307352 3300054114 Unclassified 1339
492 Ga0501082_0469575 3300060353 Bacteria 1099
493 2881418414 2881412998 Bacteria 6492157
494 nmdc:mga03683_2749_c1
495 JGI25151J46595_10000174
496 JGI25153J46596_10001063
497 Ga0070690_100012374
498 Ga0070690_100030283
499 Ga0070690_100182793
500 Ga0070690_100282460
501 Ga0070677_10006262
502 Ga0068869_100070352
503 Ga0068869_100141636
504 Ga0070666_10036663
505 Ga0070680_100006895
506 Ga0070682_100172605
507 Ga0068868_100022271
508 Ga0068868_100293789
509 Ga0070660_100162996
510 Ga0070660_100279827
511 Ga0070689_100000399
512 Ga0070689_100112986
513 Ga0070687_100022958
514 Ga0070687_100024719
515 Ga0070668_100374993
516 Ga0070669_100022370
517 Ga0070669_100093918
518 Ga0070675_100061399
519 Ga0070675_100090937
520 Ga0070675_100154117
521 Ga0070675_100435506
522 Ga0070671_100057079
523 Ga0070671_100361934
524 Ga0070671_100466702
525 Ga0070674_100000456
526 Ga0070674_100061862
527 Ga0070674_100065663
528 Ga0070674_100303185
529 Ga0070674_100408800
530 Ga0070673_100021267
531 Ga0070673_100026117
532 Ga0070688_100036078
533 Ga0070667_100054149
534 Ga0070713_100132591
535 Ga0070710_10162843
536 Ga0070705_100135682
537 Ga0070705_100137973
538 Ga0070708_100241131
539 Ga0070663_100091026
540 Ga0070678_100198470
541 Ga0070678_100276396
542 Ga0070678_100439399
543 Ga0070662_100379767
544 Ga0070681_10010946
545 Ga0070681_10093671
546 Ga0068867_100329261
547 Ga0070679_100006669
548 Ga0070679_100346295
549 Ga0070684_100072837
550 Ga0068853_100088285
551 Ga0070672_100019484
552 Ga0070672_100322245
553 Ga0070672_100334118
554 Ga0070686_100025852
555 Ga0070696_100065316
556 Ga0070665_100151156
557 Ga0070665_100284387
558 Ga0070704_100088338
559 Ga0070664_100052836
560 Ga0068857_100091041
561 Ga0068854_100192572
562 Ga0068854_100411030
563 Ga0068856_100347986
564 Ga0070702_100005470
565 Ga0070702_100013931
566 Ga0070702_100215925
567 Ga0068852_100089534
568 Ga0068859_100039153
569 Ga0068859_100621021
570 Ga0068864_100185808
571 Ga0068864_100309195
572 Ga0068861_100034295
573 Ga0068861_100384697
574 Ga0068861_100421960
575 Ga0068863_100133497
576 Ga0068858_100213895
577 Ga0068858_100419553
578 Ga0068860_100002602
579 Ga0068862_100032297
580 Ga0081455_10007642
581 Ga0081455_10022722
582 Ga0081455_10153933
583 Ga0070717_10043255
584 Ga0075365_10198145
585 Ga0075368_10000446
586 Ga0075363_100009123
587 Ga0075363_100024940
588 Ga0075364_10020154
589 Ga0075364_10130350
590 Ga0075367_10042250
591 Ga0075367_10069352
592 Ga0075369_10010036
593 Ga0075366_10007051
594 Ga0075366_10017761
595 Ga0097621_100342110
596 Ga0097621_100422497
597 Ga0075370_10017630
598 Ga0075370_10065646
599 Ga0068871_100338739
600 Ga0075428_100037046
601 Ga0075428_100194514
602 Ga0075428_100257969
603 Ga0075430_100031661
604 Ga0075430_100193820
605 Ga0075431_100166885
606 Ga0075433_10085196
607 Ga0075434_100046319
608 Ga0075434_100091942
609 Ga0075429_100040939
610 Ga0075429_100058775
611 Ga0075429_100145198
612 Ga0068865_100014574
613 Ga0097620_100039153
614 Ga0097620_100621021
615 Ga0099795_10000249
616 Ga0111539_10004683
617 Ga0111539_10030025
618 Ga0111539_10067349
619 Ga0111539_10105844
620 Ga0111539_10111822
621 Ga0111539_10335673
622 Ga0111539_10353354
623 Ga0105245_10029905
624 Ga0105245_10643408
625 Ga0105247_10134011
626 Ga0114129_10011697
627 Ga0114129_10042892
628 Ga0114129_10215863
629 Ga0105243_10048140
630 Ga0105243_10055735
631 Ga0105242_10497668
632 Ga0105248_10045028
633 Ga0105248_10553433
634 Ga0105249_10023992
635 Ga0105249_10374618
636 Ga0105239_10095875
637 Ga0105239_10219214
638 Ga0105246_10342809
639 Ga0157378_10370449
640 Ga0163162_10031945
641 Ga0157375_10226912
642 Ga0157375_10433369
643 Ga0157375_10646918
644 Ga0163163_10044944
645 Ga0163163_10133306
646 Ga0157380_10020339
647 Ga0157380_10103896
648 Ga0157380_10133356
649 Ga0157380_10190646
650 Ga0157380_10192375
651 Ga0157380_10412028
652 Ga0157380_10434098
653 Ga0157377_10008215
654 Ga0157377_10073627
655 Ga0157377_10212568
656 Ga0157379_10024104
657 Ga0157379_10197930
658 Ga0157379_10226459
659 Ga0157376_10116344
660 Ga0157376_10145750
661 Ga0163161_10060219
662 Ga0163161_10105980
663 Ga0213872_10027557
664 Ga0209758_1000079
665 Ga0209758_1029447
666 Ga0207697_10094320
667 Ga0207656_10055429
668 Ga0207682_10005754
669 Ga0207682_10011152
670 Ga0207710_10026883
671 Ga0207688_10008894
672 Ga0207688_10015657
673 Ga0207688_10030538
674 Ga0207688_10069110
675 Ga0207647_10011378
676 Ga0207685_10052672
677 Ga0207645_10039283
678 Ga0207645_10047531
679 Ga0207643_10033499
680 Ga0207643_10105979
681 Ga0207684_10098847
682 Ga0207707_10062009
683 Ga0207663_10020536
684 Ga0207663_10304106
685 Ga0207660_10202275
686 Ga0207662_10000773
687 Ga0207662_10019325
688 Ga0207662_10124100
689 Ga0207657_10008032
690 Ga0207681_10074176
691 Ga0207650_10001141
692 Ga0207659_10039339
693 Ga0207659_10159225
694 Ga0207687_10099029
695 Ga0207687_10432134
696 Ga0207687_10453412
697 Ga0207700_10096853
698 Ga0207644_10033628
699 Ga0207706_10009235
700 Ga0207706_10017536
701 Ga0207706_10422094
702 Ga0207686_10139133
703 Ga0207709_10293819
704 Ga0207670_10000333
705 Ga0207670_10066213
706 Ga0207670_10245928
707 Ga0207669_10015535
708 Ga0207669_10142168
709 Ga0207704_10099884
710 Ga0207691_10031106
711 Ga0207691_10092481
712 Ga0207691_10118514
713 Ga0207691_10126828
714 Ga0207691_10230151
715 Ga0207711_10059249
716 Ga0207679_10098357
717 Ga0207679_10107306
718 Ga0207712_10170907
719 Ga0207668_10070186
720 Ga0207668_10231865
721 Ga0207658_10048315
722 Ga0207658_10116812
723 Ga0207703_10292255
724 Ga0207703_10476027
725 Ga0207639_10133413
726 Ga0207678_10146956
727 Ga0207678_10597034
728 Ga0207708_10003986
729 Ga0207708_10055841
730 Ga0207708_10209810
731 Ga0207702_10126805
732 Ga0207641_10128207
733 Ga0207648_10026075
734 Ga0207648_10034821
735 Ga0207676_10038846
736 Ga0207676_10203890
737 Ga0207676_10236315
738 Ga0207674_10149238
739 Ga0207675_100012385
740 Ga0207675_100200797
741 Ga0207675_100339225
742 Ga0207675_100427733
743 Ga0207675_100441040
744 Ga0207675_100508272
745 Ga0207683_10014072
746 Ga0207683_10021976
747 Ga0207683_10040848
748 Ga0207683_10072860
749 Ga0207683_10177295
750 Ga0207683_10480304
751 Ga0207698_10498369
752 Ga0209588_1027981
753 Ga0207428_10028564
754 Ga0207428_10115186
755 Ga0268266_10061901
756 Ga0268266_10388870
757 Ga0268265_10267664
758 Ga0268264_10025873
759 Ga0268264_10039267
760 Ga0268264_10320863
761 Ga0265332_10011597
762 Ga0265329_10049534
763 Ga0265340_10042810
764 Ga0265339_10000679
765 Ga0265339_10013976
766 Ga0265313_10000123
767 Ga0307411_10435509
768 Ga0373926_0076127
769 Ga0373944_0073118
770 Ga0373960_0031972
771 Ga0373943_0025199
772 Ga0373943_0037973
773 Ga0373946_0008672
774 Ga0373946_0054796
775 Ga0373931_0006808
776 Ga0373935_0211587
777 Ga0373935_0217338
778 Ga0373935_0368334
779 Ga0373927_0055661
780 Ga0373927_0191322
781 Ga0373947_0029376
782 Ga0373925_0019178
783 Ga0373925_0225617
784 Ga0373925_0305051
785 Ga0373925_0413334
786 Ga0395898_0380761
787 Ga0395901_0304635
788 Ga0436361_0430694
789 Ga0439453_0001720
790 Ga0439453_0016783
791 Ga0439460_0051642
792 Ga0495627_059037
793 Ga0495603_0094319
794 Ga0495590_0074795
795 Ga0495629_0194777
796 Ga0495580_0036156
797 Ga0495582_0041758
798 Ga0495582_0147566
799 Ga0495584_0051007
800 Ga0495584_0056979
801 Ga0495584_0081952
802 Ga0495585_0110231
803 Ga0495594_0212400
804 Ga0495596_0060132
805 Ga0495596_0070292
806 Ga0495618_0124057
807 Ga0495631_0080931
808 Ga0495637_0078924
809 Ga0495644_0050040
810 Ga0495663_0038060
811 Ga0495663_0057674
812 Ga0495663_0067289
813 Ga0495666_0017245
814 Ga0495652_0389307
815 Ga0495640_0062930
816 Ga0495598_0008449
817 Ga0495598_0012861
818 Ga0495598_0051878
819 Ga0495598_0075057
820 Ga0495609_0126729
821 Ga0495621_0019156
822 Ga0495633_0037935
823 Ga0495633_0110979
824 Ga0495667_0250884
825 Ga0495656_0108892
826 Ga0495611_0048808
827 Ga0495659_0022591
828 Ga0495659_0064468
829 Ga0495661_0122892
830 Ga0495588_0085094
831 Ga0495658_0006243
832 Ga0495658_0087411
833 Ga0495658_0091217
834 Ga0495669_0152504
835 Ga0495613_0069769
836 Ga0495670_0051904
837 Ga0495670_0128572
838 Ga0495670_0166745
839 Ga0495671_0108836
840 Ga0495589_0040736
841 Ga0495589_0090317
842 Ga0495589_0098721
843 Ga0495636_0136504
844 Ga0495674_0162351
845 Ga0495674_0526366
846 Ga0495676_0306648
847 Ga0495683_0079582
848 Ga0495677_0092465
849 Ga0495685_091655
850 Ga0495684_0072688
851 Ga0495615_0058019
852 Ga0495626_0125790
853 Ga0496100_0038155
854 Ga0496100_0055218
855 Ga0496101_0022079
856 Ga0496101_0198461
857 Ga0496102_0019096
858 Ga0496102_0125945
859 Ga0496102_0242597
860 Ga0496102_0459107
861 Ga0496103_0004835
862 Ga0496103_0075776
863 Ga0496103_0099679
864 Ga0496103_0132243
865 Ga0496104_0000703
866 Ga0496104_0000880
867 Ga0496104_0004090
868 Ga0496104_0029241
869 Ga0496104_0072178
870 Ga0496104_0079071
871 Ga0496104_0221976
872 Ga0496104_0269042
873 Ga0496105_0001416
874 Ga0496105_0005841
875 Ga0496105_0009051
876 Ga0496105_0036046
877 Ga0496105_0121407
878 Ga0496105_0124712
879 Ga0496105_0274653
880 Ga0496106_0085860
881 Ga0496106_0161863
882 Ga0496106_0267882
883 Ga0496107_0059643
884 Ga0496107_0185270
885 Ga0496108_0000522
886 Ga0496108_0013373
887 Ga0496108_0058567
888 Ga0496108_0068365
889 Ga0496108_0294944
890 Ga0496109_0000431
891 Ga0496109_0001714
892 Ga0496110_0005160
893 Ga0496110_0013411
894 Ga0496110_0066810
895 Ga0496110_0259623
896 Ga0496111_0000072
897 Ga0496111_0006641
898 Ga0496111_0015087
899 Ga0496111_0465793
900 Ga0496112_0038603
901 Ga0496112_0046855
902 Ga0496112_0054593
903 Ga0496112_0083842
904 Ga0496112_0109221
905 Ga0496112_0421028
906 Ga0496113_0000058
907 Ga0496113_0013772
908 Ga0496113_0146868
909 Ga0496113_0151251
910 Ga0496113_0403834
911 Ga0496114_0021817
912 Ga0496114_0093822
913 Ga0496114_0188882
914 Ga0496114_0215423
915 Ga0496114_0339355
916 Ga0496115_0007584
917 Ga0496115_0056180
918 Ga0496115_0451929
919 Ga0501031_0001402
920 Ga0501034_0136768
921 Ga0501036_0009279
922 Ga0501036_0213222
923 Ga0501037_0049472
924 Ga0501038_0051602
925 Ga0501038_0104952
926 Ga0501039_0019439
927 Ga0501041_0094242
928 Ga0501042_0044082
929 Ga0501046_0038560
930 Ga0501046_0080257
931 Ga0501048_0028075
932 Ga0501067_0032681
933 Ga0501069_0012334
934 Ga0501070_0264488
935 Ga0501074_0013084
936 Ga0501076_0267133
937 Ga0501080_0066965
938 Ga0501081_0035568
939 Ga0501035_0239508
940 Ga0501044_0000743
941 Ga0501045_0009824
942 Ga0501045_0331525
943 nmdc:mga03683_88413_c1
944 nmdc:mga03n38_18234_c1
945 nmdc:mga00v17_245251_c1
946 nmdc:mga00v17_43462_c1
947 nmdc:mga0yw44_129063_c1
948 nmdc:mga0yw44_12946_c1
949 nmdc:mga0yw44_144040_c1
950 nmdc:mga0yw44_26997_c1
951 nmdc:mga0yw44_3991_c1
952 nmdc:mga0k408_5583_c1
953 nmdc:mga0k408_99951_c1
954 nmdc:mga06z11_4603_c1
955 nmdc:mga06z11_83915_c1
956 nmdc:mga04h51_2554_c1
957 nmdc:mga07m45_13513_c1
958 nmdc:mga07m45_62070_c1
959 nmdc:mga05p37_10904_c1
960 nmdc:mga05p37_291126_c1
961 nmdc:mga05p37_46637_c1
962 nmdc:mga05p37_9046_c1
963 nmdc:mga09592_61288_c1
964 nmdc:mga06r32_175750_c1
965 nmdc:mga06r32_558384_c1
966 nmdc:mga08y16_106466_c1
967 nmdc:mga08y16_40575_c1
968 nmdc:mga08y16_87087_c1
969 nmdc:mga0n895_149999_c1
970 nmdc:mga0n895_173642_c1
971 nmdc:mga0n895_28787_c1
972 nmdc:mga0n895_73514_c1
973 nmdc:mga0rr50_158265_c1
974 nmdc:mga0rr50_167769_c1
975 nmdc:mga0rr50_431642_c1
976 nmdc:mga08x19_70228_c1
977 Ga0495601_0119864
978 Ga0495655_0039055
979 Ga0495619_0028162
980 Ga0495619_0347005
981 Ga0500562_010698
982 Ga0500616_0032045
983 Ga0500636_0010368
984 Ga0501084_0307352
985 Ga0501082_0469575
986 2881418414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

95

371

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9565 28 322
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9551 28 316
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9525 28 324
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9513 31 324
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.941 28 322
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9391 126 242 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.939 28 322 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9317 28 324 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9315 126 249 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9263 28 324 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9675 36 322
AF-A0A356HRF1-F1-model_v4 deleted 0.9667 62 322
AF-A0A1F4D0A5-F1-model_v4 MFS transporter 0.9638 38 324
AF-C5TCY3-F1-model_v4 Extra-cytoplasmic solute receptor 0.9631 48 324
AF-A0A4P5U036-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9629 19 324

Map