F454486

General Info

Members Datasets Scaffolds Average Seq Length
493 311 472 263

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000202|Ga0496125_0000202_62004_63011
Length 301
Sequence MPLIRPRNQNRQLPLKFPKARAQRGLRDRAGQHAYQQENLMAPPRAYWKGSLKLSLVSCPVVLYPASTTVEKTRFHMINTETGNRLKEKEQKGRGYEISKGEFIPIEKDELEAVQIESNHTIDIDNFVPRDEIDKRFLNNPYYIAPDGKAGIDAFAVIRDAMKDKDRVALARIVLTNREHIIAIEPLGKGLLGTTLRYPYEVRDEEDYFDDIKSPKISKDMIDLAAHILDSKASHFDPSKFKDEYEDALKALVKRKAAGKPVKVVEKAEKPDNVISLMDALQQSLKGGKATPAPARQRKAS

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
3 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
4 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
5 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
6 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
7 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
8 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
9 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
10 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
11 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
12 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
13 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
14 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
15 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
16 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
17 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
107 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
108 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
109 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
271 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
272 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
277 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
278 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
279 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
280 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
281 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
282 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
283 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
286 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
287 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
288 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
289 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
290 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
293 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
294 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
295 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
298 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
299 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
300 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
301 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
302 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
303 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
306 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
307 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
308 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
309 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
310 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
311 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0
Isolates 4.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.4
Nodule 2.84
Rhizoplane 7.91
Rhizosphere 64.5
Stem 0
Stem Tuber 0
Unclassified 10.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005104 3300001989 Bacteria 4998
2 JGI24737J22298_10010310 3300001990 Bacteria 3088
3 JGI24735J21928_10019161 3300002067 Bacteria 2104
4 JGI25406J46586_10000022 3300003203 Bacteria 79225
5 JGI25153J46596_10016040 3300003215 Bacteria 3022
6 JGI25153J46596_10039982 3300003215 Bacteria 1459
7 Ga0055526_1035353 3300003771 Bacteria 1348
8 Ga0070658_10066416 3300005327 Bacteria 2946
9 Ga0070658_10244141 3300005327 Bacteria 1523
10 Ga0070658_10373897 3300005327 Bacteria 1222
11 Ga0070683_100012441 3300005329 Bacteria 7396
12 Ga0070666_10113905 3300005335 Bacteria 1872
13 Ga0068868_100078846 3300005338 Bacteria 2637
14 Ga0070660_100007797 3300005339 Bacteria 7466
15 Ga0070661_100099322 3300005344 Bacteria 2163
16 Ga0070661_100315818 3300005344 Bacteria 1219
17 Ga0070668_100060403 3300005347 Bacteria 2935
18 Ga0070668_100142629 3300005347 Bacteria 1932
19 Ga0070668_100154419 3300005347 Bacteria 1859
20 Ga0070668_100252451 3300005347 Bacteria 1465
21 Ga0070668_100298536 3300005347 Bacteria 1350
22 Ga0070669_100244156 3300005353 Bacteria 1428
23 Ga0070675_100120270 3300005354 Bacteria 2231
24 Ga0070675_100351008 3300005354 Bacteria 1308
25 Ga0070671_100064182 3300005355 Bacteria 3059
26 Ga0070673_100238526 3300005364 Bacteria 1580
27 Ga0070673_100600535 3300005364 Bacteria 1004
28 Ga0070659_100104182 3300005366 Bacteria 2285
29 Ga0070659_100215172 3300005366 Bacteria 1584
30 Ga0070659_100265151 3300005366 Bacteria 1426
31 Ga0070667_100184008 3300005367 Bacteria 1848
32 Ga0070709_10002912 3300005434 Bacteria 9229
33 Ga0070713_100007596 3300005436 Bacteria 7625
34 Ga0070710_10009090 3300005437 Bacteria 4858
35 Ga0070711_100030214 3300005439 Bacteria 3584
36 Ga0070711_100067968 3300005439 Bacteria 2502
37 Ga0070700_100163246 3300005441 Bacteria 1535
38 Ga0070694_100055074 3300005444 Bacteria 2696
39 Ga0070708_100243206 3300005445 Bacteria 1690
40 Ga0070663_100000663 3300005455 Bacteria 18514
41 Ga0070663_100003769 3300005455 Bacteria 8803
42 Ga0070663_100040125 3300005455 Bacteria 3275
43 Ga0070663_100164918 3300005455 Bacteria 1708
44 Ga0070663_100250412 3300005455 Bacteria 1402
45 Ga0070678_100092117 3300005456 Bacteria 2328
46 Ga0070662_100081310 3300005457 Bacteria 2413
47 Ga0070681_10172223 3300005458 Bacteria 2087
48 Ga0070681_10602518 3300005458 Bacteria 1013
49 Ga0070685_10145761 3300005466 Bacteria 1496
50 Ga0070706_100287173 3300005467 Bacteria 1535
51 Ga0070698_100083435 3300005471 Bacteria 3185
52 Ga0070698_100317043 3300005471 Bacteria 1490
53 Ga0070679_100655314 3300005530 Bacteria 992
54 Ga0070684_100039051 3300005535 Bacteria 4081
55 Ga0070684_100048283 3300005535 Bacteria 3693
56 Ga0070697_100007535 3300005536 Bacteria 8473
57 Ga0068853_100000617 3300005539 Bacteria 24377
58 Ga0068853_100068160 3300005539 Bacteria 3092
59 Ga0068853_100109748 3300005539 Bacteria 2449
60 Ga0068853_100221923 3300005539 Bacteria 1726
61 Ga0070686_100224390 3300005544 Bacteria 1360
62 Ga0070695_100087857 3300005545 Bacteria 2069
63 Ga0070665_100013563 3300005548 Bacteria 8199
64 Ga0070665_100047511 3300005548 Bacteria 4308
65 Ga0070665_100132035 3300005548 Bacteria 2499
66 Ga0068855_100006225 3300005563 Bacteria 14541
67 Ga0068855_100037802 3300005563 Bacteria 5738
68 Ga0068855_100100549 3300005563 Bacteria 3329
69 Ga0068855_100125949 3300005563 Bacteria 2929
70 Ga0070664_100132154 3300005564 Bacteria 2193
71 Ga0068857_100018827 3300005577 Bacteria 6060
72 Ga0068857_100124322 3300005577 Bacteria 2324
73 Ga0068856_100097944 3300005614 Bacteria 2922
74 Ga0068856_100137559 3300005614 Bacteria 2448
75 Ga0070702_100346537 3300005615 Bacteria 1045
76 Ga0068852_100015459 3300005616 Bacteria 5922
77 Ga0068852_100097459 3300005616 Bacteria 2645
78 Ga0068852_100141797 3300005616 Bacteria 2225
79 Ga0068852_100372410 3300005616 Bacteria 1399
80 Ga0068859_100051481 3300005617 Bacteria 4139
81 Ga0068859_100321040 3300005617 Bacteria 1643
82 Ga0068864_100032278 3300005618 Bacteria 4448
83 Ga0068864_100098457 3300005618 Bacteria 2590
84 Ga0068861_100028571 3300005719 Bacteria 4070
85 Ga0068861_100057268 3300005719 Bacteria 2976
86 Ga0068870_10009958 3300005840 Bacteria 4344
87 Ga0068863_100708512 3300005841 Bacteria 1001
88 Ga0068860_100011349 3300005843 Bacteria 8779
89 Ga0068860_100091348 3300005843 Bacteria 2900
90 Ga0068860_100659481 3300005843 Bacteria 1054
91 Ga0068862_100030852 3300005844 Bacteria 4519
92 Ga0068862_100078109 3300005844 Bacteria 2867
93 Ga0068862_100458088 3300005844 Bacteria 1203
94 Ga0081455_10005273 3300005937 Bacteria 14201
95 Ga0081455_10006252 3300005937 Bacteria 12820
96 Ga0081455_10059000 3300005937 Bacteria 3243
97 Ga0081455_10067418 3300005937 Bacteria 2982
98 Ga0081455_10302620 3300005937 Bacteria 1146
99 Ga0081540_1002589 3300005983 Bacteria 14689
100 Ga0081540_1030499 3300005983 Bacteria 2985
101 Ga0081540_1066450 3300005983 Bacteria 1690
102 Ga0081539_10000172 3300005985 Bacteria 151505
103 Ga0081539_10000945 3300005985 Bacteria 54444
104 Ga0075365_10034919 3300006038 Bacteria 3250
105 Ga0075365_10266043 3300006038 Bacteria 1206
106 Ga0075364_10057141 3300006051 Bacteria 2555
107 Ga0070715_10094976 3300006163 Bacteria 1380
108 Ga0070712_100019838 3300006175 Bacteria 4393
109 Ga0075367_10053817 3300006178 Bacteria 2386
110 Ga0075367_10077821 3300006178 Bacteria 2002
111 Ga0075369_10008562 3300006186 Bacteria 3940
112 Ga0097621_100425206 3300006237 Bacteria 1193
113 Ga0075370_10011867 3300006353 Bacteria 4588
114 Ga0075370_10037897 3300006353 Bacteria 2712
115 Ga0075370_10099098 3300006353 Bacteria 1685
116 Ga0068865_100014151 3300006881 Bacteria 5064
117 Ga0068865_100130119 3300006881 Bacteria 1885
118 Ga0097620_100051481 3300006931 Bacteria 4139
119 Ga0097620_100321036 3300006931 Bacteria 1643
120 Ga0099795_10058733 3300007788 Bacteria 1421
121 Ga0105240_10002493 3300009093 Bacteria 29572
122 Ga0105240_10007678 3300009093 Bacteria 15611
123 Ga0105240_10031852 3300009093 Bacteria 6832
124 Ga0105240_10112264 3300009093 Bacteria 3295
125 Ga0105240_10298194 3300009093 Bacteria 1845
126 Ga0111539_10010306 3300009094 Bacteria 11766
127 Ga0111539_10892380 3300009094 Bacteria 1034
128 Ga0105245_10003690 3300009098 Bacteria 13668
129 Ga0105245_10472345 3300009098 Bacteria 1266
130 Ga0105243_10076554 3300009148 Bacteria 2719
131 Ga0105241_10017796 3300009174 Bacteria 5227
132 Ga0105241_10142548 3300009174 Bacteria 1953
133 Ga0105242_10191096 3300009176 Bacteria 1813
134 Ga0105248_10022671 3300009177 Bacteria 6968
135 Ga0105237_10014161 3300009545 Bacteria 8349
136 Ga0105237_10090912 3300009545 Bacteria 3042
137 Ga0105237_10106896 3300009545 Bacteria 2790
138 Ga0105237_10110932 3300009545 Bacteria 2735
139 Ga0105238_10009195 3300009551 Bacteria 9889
140 Ga0105238_10023571 3300009551 Bacteria 6271
141 Ga0105239_10008059 3300010375 Bacteria 12026
142 Ga0105239_10077241 3300010375 Bacteria 3664
143 Ga0105239_10093697 3300010375 Bacteria 3316
144 Ga0105239_10154481 3300010375 Bacteria 2562
145 Ga0105239_10175567 3300010375 Bacteria 2396
146 Ga0105239_10282165 3300010375 Bacteria 1870
147 Ga0105239_10455782 3300010375 Bacteria 1451
148 Ga0105246_10230845 3300011119 Bacteria 1457
149 Ga0105246_10375712 3300011119 Bacteria 1173
150 Ga0157370_10039231 3300013104 Bacteria 4577
151 Ga0157370_10095838 3300013104 Bacteria 2784
152 Ga0157369_10026130 3300013105 Bacteria 6478
153 Ga0157369_10251775 3300013105 Bacteria 1843
154 Ga0157374_10350904 3300013296 Bacteria 1466
155 Ga0157378_10067838 3300013297 Bacteria 3198
156 Ga0163162_10051849 3300013306 Bacteria 4118
157 Ga0163162_10483173 3300013306 Bacteria 1370
158 Ga0157375_10130039 3300013308 Bacteria 2636
159 Ga0157375_10373901 3300013308 Bacteria 1591
160 Ga0157375_10499496 3300013308 Bacteria 1380
161 Ga0163163_10043849 3300014325 Bacteria 4387
162 Ga0157379_10065900 3300014968 Bacteria 3238
163 Ga0157379_10198204 3300014968 Bacteria 1815
164 Ga0157376_10012280 3300014969 Bacteria 6352
165 Ga0157376_10089441 3300014969 Bacteria 2662
166 Ga0163161_10088836 3300017792 Bacteria 2284
167 Ga0214544_1000001 3300021320 Bacteria 783667
168 Ga0214542_1000005 3300021321 Bacteria 389646
169 Ga0214545_1000003 3300021324 Bacteria 720274
170 Ga0214543_1000002 3300021327 Bacteria 712733
171 Ga0213874_10015554 3300021377 Bacteria 2009
172 Ga0213871_10002801 3300021441 Bacteria 3264
173 Ga0209564_1001859 3300025295 Bacteria 19125
174 Ga0209758_1009334 3300025297 Bacteria 6121
175 Ga0209758_1011836 3300025297 Bacteria 4981
176 Ga0207688_10020870 3300025901 Bacteria 3576
177 Ga0207680_10132585 3300025903 Bacteria 1644
178 Ga0207647_10000241 3300025904 Bacteria 44805
179 Ga0207647_10023979 3300025904 Bacteria 4028
180 Ga0207699_10004047 3300025906 Bacteria 7017
181 Ga0207643_10094495 3300025908 Bacteria 1747
182 Ga0207705_10234204 3300025909 Bacteria 1397
183 Ga0207707_10008927 3300025912 Bacteria 8705
184 Ga0207695_10000006 3300025913 Bacteria 1135309
185 Ga0207695_10047230 3300025913 Bacteria 4558
186 Ga0207695_10074532 3300025913 Bacteria 3456
187 Ga0207695_10101156 3300025913 Bacteria 2877
188 Ga0207693_10027516 3300025915 Bacteria 4495
189 Ga0207663_10046990 3300025916 Bacteria 2663
190 Ga0207663_10075689 3300025916 Bacteria 2185
191 Ga0207657_10014599 3300025919 Bacteria 7655
192 Ga0207649_10223121 3300025920 Bacteria 1344
193 Ga0207649_10273823 3300025920 Bacteria 1225
194 Ga0207652_10008142 3300025921 Bacteria 8418
195 Ga0207681_10407318 3300025923 Bacteria 1099
196 Ga0207694_10030264 3300025924 Bacteria 4134
197 Ga0207650_10336242 3300025925 Bacteria 1239
198 Ga0207659_10306307 3300025926 Bacteria 1306
199 Ga0207687_10011456 3300025927 Bacteria 5796
200 Ga0207700_10090940 3300025928 Bacteria 2410
201 Ga0207664_10414680 3300025929 Bacteria 1199
202 Ga0207690_10093677 3300025932 Bacteria 2129
203 Ga0207690_10197413 3300025932 Bacteria 1526
204 Ga0207706_10022384 3300025933 Bacteria 5672
205 Ga0207706_10061184 3300025933 Bacteria 3316
206 Ga0207706_10218264 3300025933 Bacteria 1670
207 Ga0207709_10039995 3300025935 Bacteria 2805
208 Ga0207704_10079732 3300025938 Bacteria 2111
209 Ga0207704_10144874 3300025938 Bacteria 1667
210 Ga0207704_10148953 3300025938 Bacteria 1648
211 Ga0207691_10113679 3300025940 Bacteria 2406
212 Ga0207691_10194302 3300025940 Bacteria 1769
213 Ga0207689_10018707 3300025942 Bacteria 5842
214 Ga0207689_10043962 3300025942 Bacteria 3693
215 Ga0207679_10046207 3300025945 Bacteria 3155
216 Ga0207679_10355398 3300025945 Bacteria 1278
217 Ga0207667_10089491 3300025949 Bacteria 3182
218 Ga0207712_10147037 3300025961 Bacteria 1816
219 Ga0207668_10025989 3300025972 Bacteria 3796
220 Ga0207668_10103358 3300025972 Bacteria 2121
221 Ga0207668_10289679 3300025972 Bacteria 1346
222 Ga0207677_10067123 3300026023 Bacteria 2511
223 Ga0207703_10218310 3300026035 Bacteria 1703
224 Ga0207639_10105506 3300026041 Bacteria 2286
225 Ga0207639_10256787 3300026041 Bacteria 1526
226 Ga0207639_10283003 3300026041 Bacteria 1459
227 Ga0207678_10002185 3300026067 Bacteria 17669
228 Ga0207678_10157232 3300026067 Bacteria 1941
229 Ga0207678_10181029 3300026067 Bacteria 1800
230 Ga0207678_10276986 3300026067 Bacteria 1439
231 Ga0207641_10681685 3300026088 Bacteria 1011
232 Ga0207674_10068039 3300026116 Bacteria 3585
233 Ga0207674_10104186 3300026116 Bacteria 2816
234 Ga0207674_10145157 3300026116 Bacteria 2331
235 Ga0207675_100026109 3300026118 Bacteria 5437
236 Ga0207675_100034894 3300026118 Bacteria 4690
237 Ga0207683_10051733 3300026121 Bacteria 3599
238 Ga0207683_10082242 3300026121 Bacteria 2860
239 Ga0207683_10225271 3300026121 Bacteria 1709
240 Ga0207698_10055781 3300026142 Bacteria 3047
241 Ga0207698_10148672 3300026142 Bacteria 2030
242 Ga0207698_10354800 3300026142 Bacteria 1386
243 Ga0207698_10399754 3300026142 Bacteria 1313
244 Ga0209389_1000083 3300027296 Bacteria 88461
245 Ga0209589_1000097 3300027357 Bacteria 88461
246 Ga0209489_100105 3300027361 Bacteria 118979
247 Ga0268266_10000519 3300028379 Bacteria 54346
248 Ga0268266_10034062 3300028379 Bacteria 4330
249 Ga0268266_10060931 3300028379 Bacteria 3253
250 Ga0268266_10516093 3300028379 Bacteria 1142
251 Ga0268265_10013905 3300028380 Bacteria 5478
252 Ga0268264_10042871 3300028381 Bacteria 3747
253 Ga0268264_10088591 3300028381 Bacteria 2664
254 Ga0268264_10201015 3300028381 Bacteria 1823
255 Ga0265334_10026828 3300028573 Bacteria 2323
256 Ga0307515_10022211 3300028794 Bacteria 11193
257 Ga0307515_10223403 3300028794 Bacteria 1695
258 Ga0265330_10002705 3300031235 Bacteria 9571
259 Ga0265330_10039751 3300031235 Bacteria 2089
260 Ga0265330_10043019 3300031235 Bacteria 2000
261 Ga0265332_10037682 3300031238 Bacteria 2096
262 Ga0265340_10001835 3300031247 Bacteria 12142
263 Ga0265331_10055600 3300031250 Bacteria 1882
264 Ga0307509_10241021 3300031507 Bacteria 1601
265 Ga0307508_10015229 3300031616 Bacteria 7008
266 Ga0307508_10106518 3300031616 Bacteria 2402
267 Ga0265314_10204251 3300031711 Bacteria 1165
268 Ga0307412_10401242 3300031911 Bacteria 1116
269 Ga0307411_10561008 3300032005 Bacteria 976
270 Ga0307510_10041641 3300033180 Bacteria 5017
271 Ga0307510_10132460 3300033180 Bacteria 2161
272 Ga0373953_0089016 3300035117 Bacteria 1290
273 Ga0373924_0018339 3300035410 Bacteria 2695
274 Ga0373927_0052079 3300035695 Bacteria 2648
275 Ga0373947_0302372 3300035725 Bacteria 1067
276 Ga0373937_0463604 3300036401 Bacteria 1203
277 Ga0373925_0249083 3300037068 Bacteria 1424
278 Ga0395900_0107743 3300037418 Bacteria 2863
279 Ga0395898_0204681 3300037466 Bacteria 1883
280 Ga0395898_0812129 3300037466 Bacteria 875
281 Ga0395905_0129738 3300037471 Bacteria 2371
282 Ga0436364_0350531 3300037853 Bacteria 5930
283 Ga0395901_0568965 3300038443 Bacteria 1146
284 Ga0436365_1008789 3300039437 Bacteria 1230
285 Ga0436365_1084521 3300039437 Bacteria 1095
286 Ga0436360_0561872 3300039438 Bacteria 1934
287 Ga0436360_0872836 3300039438 Bacteria 3724
288 Ga0436361_0978240 3300039447 Bacteria 3630
289 Ga0436363_0300553 3300039450 Bacteria 4994
290 Ga0436362_0839238 3300039453 Bacteria 3422
291 Ga0466972_0058478 3300044658 Bacteria 1851
292 Ga0466963_0220525 3300044694 Bacteria 1328
293 Ga0466970_0068050 3300044765 Bacteria 1913
294 Ga0466957_0017412 3300044842 Bacteria 4208
295 Ga0466959_0012080 3300045049 Bacteria 6231
296 Ga0466967_0042506 3300045976 Bacteria 3928
297 Ga0466967_0047439 3300045976 Bacteria 3745
298 Ga0495617_014516 3300046452 Bacteria 2677
299 Ga0495617_069073 3300046452 Bacteria 1162
300 Ga0495603_0038657 3300046455 Bacteria 2861
301 Ga0495590_0020864 3300046457 Bacteria 2325
302 Ga0495638_0016825 3300046460 Bacteria 4889
303 Ga0495638_0073036 3300046460 Bacteria 2094
304 Ga0495641_0081943 3300046461 Bacteria 1445
305 Ga0495651_0107839 3300046462 Bacteria 2063
306 Ga0495605_0037001 3300046474 Bacteria 2458
307 Ga0495662_0151121 3300046476 Bacteria 1144
308 Ga0495664_0264218 3300046477 Bacteria 1040
309 Ga0495585_0066597 3300046492 Bacteria 1972
310 Ga0495594_0073696 3300046499 Bacteria 1901
311 Ga0495596_0078923 3300046500 Bacteria 1278
312 Ga0495596_0087876 3300046500 Bacteria 1206
313 Ga0495607_0021535 3300046501 Bacteria 4055
314 Ga0495632_0166876 3300046519 Bacteria 1012
315 Ga0495637_0026429 3300046520 Bacteria 2606
316 Ga0495648_0001062 3300046524 Bacteria 27872
317 Ga0495598_0050970 3300046537 Bacteria 1246
318 Ga0495621_0115318 3300046539 Bacteria 1034
319 Ga0495622_0126806 3300046557 Bacteria 1164
320 Ga0495667_0052845 3300046559 Bacteria 2676
321 Ga0495656_0027037 3300046615 Bacteria 2289
322 Ga0495625_0164488 3300046660 Bacteria 1484
323 Ga0495659_0100451 3300046664 Bacteria 1120
324 Ga0495599_0059415 3300046678 Bacteria 2392
325 Ga0495670_0011640 3300046691 Bacteria 4329
326 Ga0495670_0083699 3300046691 Bacteria 1627
327 Ga0495600_0229069 3300046809 Bacteria 1187
328 Ga0495581_0100442 3300047315 Bacteria 1681
329 Ga0495672_0058324 3300047320 Bacteria 2238
330 Ga0495676_0096883 3300047321 Bacteria 2192
331 Ga0495677_0043534 3300047445 Bacteria 1646
332 Ga0495681_0134695 3300047470 Bacteria 1049
333 Ga0495684_0385043 3300047471 Bacteria 988
334 Ga0495686_0004829 3300047472 Bacteria 10882
335 Ga0495626_0085913 3300048091 Bacteria 1391
336 Ga0496100_0065534 3300048903 Bacteria 2407
337 Ga0496101_0194807 3300048904 Bacteria 1565
338 Ga0496101_0254955 3300048904 Bacteria 1367
339 Ga0496102_0006054 3300048905 Bacteria 10309
340 Ga0496102_0086765 3300048905 Bacteria 2891
341 Ga0496102_0236791 3300048905 Bacteria 1721
342 Ga0496102_0432184 3300048905 Bacteria 1236
343 Ga0496104_0004602 3300048907 Bacteria 12026
344 Ga0496104_0005128 3300048907 Bacteria 11437
345 Ga0496104_0299997 3300048907 Bacteria 1519
346 Ga0496105_0004236 3300048908 Bacteria 10783
347 Ga0496105_0082363 3300048908 Bacteria 2658
348 Ga0496106_0000711 3300048909 Bacteria 23960
349 Ga0496106_0004766 3300048909 Bacteria 10027
350 Ga0496106_0043979 3300048909 Bacteria 3353
351 Ga0496107_0001289 3300048910 Bacteria 15330
352 Ga0496107_0043041 3300048910 Bacteria 3244
353 Ga0496107_0166911 3300048910 Bacteria 1632
354 Ga0496108_0002311 3300048911 Bacteria 15264
355 Ga0496108_0002638 3300048911 Bacteria 14372
356 Ga0496108_0015938 3300048911 Bacteria 6127
357 Ga0496109_0000199 3300048912 Bacteria 59773
358 Ga0496109_0061716 3300048912 Bacteria 3427
359 Ga0496109_0209708 3300048912 Bacteria 1832
360 Ga0496109_0316017 3300048912 Bacteria 1474
361 Ga0496110_0006468 3300048913 Bacteria 9285
362 Ga0496110_0012653 3300048913 Bacteria 6943
363 Ga0496110_0047003 3300048913 Bacteria 3777
364 Ga0496110_0220451 3300048913 Bacteria 1725
365 Ga0496112_0001162 3300048915 Bacteria 19679
366 Ga0496112_0036409 3300048915 Bacteria 4801
367 Ga0496112_0050178 3300048915 Bacteria 4091
368 Ga0496113_0077821 3300048916 Bacteria 2537
369 Ga0496114_0116723 3300048917 Bacteria 2292
370 Ga0496114_0307068 3300048917 Bacteria 1401
371 Ga0496115_0011470 3300048918 Bacteria 6645
372 Ga0496115_0036128 3300048918 Bacteria 3911
373 Ga0496115_0051481 3300048918 Bacteria 3302
374 Ga0496116_0008464 3300048919 Bacteria 8917
375 Ga0496117_0129873 3300048920 Bacteria 1529
376 Ga0496118_0122894 3300048921 Bacteria 1687
377 Ga0496120_0139559 3300048923 Bacteria 1232
378 Ga0496121_0010221 3300048924 Bacteria 10624
379 Ga0496121_0025787 3300048924 Bacteria 5563
380 Ga0496121_0040809 3300048924 Bacteria 4066
381 Ga0496121_0068945 3300048924 Bacteria 2858
382 Ga0496121_0069924 3300048924 Bacteria 2830
383 Ga0496121_0130152 3300048924 Bacteria 1885
384 Ga0496121_0235847 3300048924 Bacteria 1278
385 Ga0496122_0018566 3300048925 Bacteria 6414
386 Ga0496122_0126518 3300048925 Bacteria 1634
387 Ga0496123_0021074 3300048926 Bacteria 5078
388 Ga0496123_0044387 3300048926 Bacteria 3040
389 Ga0496124_0138572 3300048927 Bacteria 1923
390 Ga0496125_0000202 3300048928 Bacteria 125963
391 Ga0496125_0007880 3300048928 Bacteria 11249
392 Ga0496125_0064216 3300048928 Bacteria 2919
393 Ga0496125_0069626 3300048928 Bacteria 2759
394 Ga0496126_0002882 3300048929 Bacteria 22445
395 Ga0496126_0043094 3300048929 Bacteria 4166
396 Ga0496126_0047285 3300048929 Bacteria 3940
397 Ga0496126_0135855 3300048929 Bacteria 2121
398 Ga0496126_0186116 3300048929 Bacteria 1761
399 Ga0496126_0249555 3300048929 Bacteria 1479
400 Ga0501031_0043832 3300049568 Bacteria 2919
401 Ga0501033_0360288 3300049570 Bacteria 1018
402 Ga0501038_0049739 3300049574 Bacteria 3624
403 Ga0501046_0193212 3300049580 Bacteria 1517
404 Ga0501047_0103136 3300049581 Bacteria 2732
405 Ga0501047_0379285 3300049581 Bacteria 1248
406 Ga0501067_0068917 3300049583 Bacteria 1959
407 Ga0501070_0008301 3300049586 Bacteria 8777
408 Ga0501070_0041853 3300049586 Bacteria 3815
409 Ga0501074_0085507 3300049590 Bacteria 2260
410 Ga0501080_0121480 3300049742 Bacteria 2420
411 Ga0501035_0030449 3300049822 Bacteria 4919
412 Ga0501044_0070899 3300049823 Bacteria 3544
413 Ga0501044_0236711 3300049823 Bacteria 1771
414 nmdc:mga03n38_113375_c1 3300050490 Bacteria 1323
415 nmdc:mga00v17_10118_c1 3300050491 Bacteria 5139
416 nmdc:mga00v17_4318_c1 3300050491 Bacteria 7381
417 nmdc:mga0yw44_13187_c1 3300050492 Bacteria 4015
418 nmdc:mga06z11_288915_c1 3300050494 Bacteria 973
419 nmdc:mga06z11_6494_c1 3300050494 Bacteria 4763
420 nmdc:mga04h51_123446_c1 3300050495 Bacteria 967
421 nmdc:mga07m45_16975_c1 3300050496 Bacteria 3903
422 nmdc:mga07m45_49555_c1 3300050496 Bacteria 2364
423 nmdc:mga08y16_88450_c1 3300050511 Bacteria 3228
424 nmdc:mga0n895_157074_c1 3300050512 Bacteria 2305
425 nmdc:mga0n895_239981_c1 3300050512 Bacteria 1839
426 Ga0500635_0030255 3300053080 Bacteria 1744
427 Ga0500643_045547 3300053087 Bacteria 1270
428 Ga0500581_008974 3300053089 Bacteria 4837
429 Ga0500651_0026121 3300053093 Bacteria 3667
430 Ga0500651_0091081 3300053093 Bacteria 1877
431 Ga0500566_0003241 3300053094 Bacteria 9731
432 Ga0500566_0006566 3300053094 Bacteria 6894
433 Ga0500641_0028899 3300053096 Bacteria 2168
434 Ga0500648_104648 3300053097 Bacteria 1570
435 Ga0500650_0001750 3300053098 Bacteria 6754
436 Ga0500554_009463 3300053102 Bacteria 2334
437 Ga0500554_010368 3300053102 Bacteria 2268
438 Ga0500556_0000011 3300053104 Bacteria 253393
439 Ga0500562_033346 3300053108 Bacteria 1360
440 Ga0500562_060258 3300053108 Bacteria 1019
441 Ga0500569_003519 3300053109 Bacteria 3209
442 Ga0500572_000429 3300053111 Bacteria 14783
443 Ga0500591_059693 3300053115 Bacteria 1762
444 Ga0500595_010192 3300053119 Bacteria 3745
445 Ga0500595_017224 3300053119 Bacteria 2672
446 Ga0500608_010156 3300053122 Bacteria 4031
447 Ga0500614_042497 3300053123 Bacteria 1161
448 Ga0500642_0000030 3300053130 Bacteria 115114
449 Ga0500652_001175 3300053131 Bacteria 8356
450 Ga0500559_0000272 3300053136 Bacteria 40384
451 Ga0500559_0009412 3300053136 Bacteria 4229
452 Ga0500561_0045485 3300053137 Bacteria 1177
453 Ga0500568_0003414 3300053139 Bacteria 8863
454 Ga0500577_0000137 3300053142 Bacteria 17738
455 Ga0500586_004716 3300053145 Bacteria 3378
456 Ga0500603_000241 3300053150 Bacteria 14295
457 Ga0500603_003006 3300053150 Bacteria 3638
458 Ga0500604_0000888 3300053151 Bacteria 8260
459 Ga0500616_0000026 3300053153 Bacteria 454314
460 Ga0500616_0000028 3300053153 Bacteria 435722
461 Ga0500622_0006554 3300053156 Bacteria 6722
462 Ga0500627_0020750 3300053158 Bacteria 2639
463 Ga0500630_003701 3300053159 Bacteria 7421
464 Ga0500633_0034335 3300053160 Bacteria 1663
465 Ga0500634_0058771 3300053161 Bacteria 2047
466 Ga0500639_000076 3300053163 Bacteria 45936
467 Ga0500637_0000449 3300053178 Bacteria 15821
468 Ga0500645_083513 3300053730 Bacteria 910
469 Ga0500609_005796 3300053731 Bacteria 1689
470 Ga0500596_000689 3300053735 Bacteria 6581
471 Ga0500601_002532 3300053737 Bacteria 1958
472 Ga0500661_000404 3300055283 Bacteria 7983

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0096883 Ga0495676_0096883_20_799 204
2 3300050512 nmdc:mga0n895_157074_c1 nmdc:mga0n895_157074_c1_1537_2289 212
3 3300005530 Ga0070679_100655314 Ga0070679_1006553141 213
4 3300003215 JGI25153J46596_10039982 JGI25153J46596_100399822 216
5 3300025297 Ga0209758_1009334 Ga0209758_10093344 216
6 3300005366 Ga0070659_100215172 Ga0070659_1002151722 219
7 3300005539 Ga0068853_100068160 Ga0068853_1000681605 219
8 3300037466 Ga0395898_0812129 Ga0395898_0812129_35_814 219
9 3300050494 nmdc:mga06z11_288915_c1 nmdc:mga06z11_288915_c1_135_962 219
10 3300048921 Ga0496118_0122894 Ga0496118_0122894_30_809 221
11 3300025904 Ga0207647_10023979 Ga0207647_100239792 223
12 3300005347 Ga0070668_100154419 Ga0070668_1001544192 231
13 3300005455 Ga0070663_100250412 Ga0070663_1002504122 231
14 3300006178 Ga0075367_10053817 Ga0075367_100538172 231
15 3300006353 Ga0075370_10011867 Ga0075370_100118671 231
16 3300005617 Ga0068859_100051481 Ga0068859_1000514815 233
17 3300005843 Ga0068860_100091348 Ga0068860_1000913482 233
18 3300005844 Ga0068862_100078109 Ga0068862_1000781093 233
19 3300006931 Ga0097620_100051481 Ga0097620_1000514812 233
20 3300025942 Ga0207689_10018707 Ga0207689_100187073 234
21 3300028381 Ga0268264_10042871 Ga0268264_100428712 234
22 3300048924 Ga0496121_0130152 Ga0496121_0130152_935_1816 234
23 3300048910 Ga0496107_0043041 Ga0496107_0043041_1503_2402 236
24 3300048911 Ga0496108_0015938 Ga0496108_0015938_2747_3646 236
25 3300050491 nmdc:mga00v17_10118_c1 nmdc:mga00v17_10118_c1_2456_3355 236
26 3300009098 Ga0105245_10472345 Ga0105245_104723451 238
27 3300009176 Ga0105242_10191096 Ga0105242_101910961 238
28 3300009177 Ga0105248_10022671 Ga0105248_100226713 238
29 3300009545 Ga0105237_10090912 Ga0105237_100909123 238
30 3300010375 Ga0105239_10093697 Ga0105239_100936973 238
31 3300014968 Ga0157379_10065900 Ga0157379_100659002 238
32 3300014969 Ga0157376_10089441 Ga0157376_100894413 238
33 3300048915 Ga0496112_0050178 Ga0496112_0050178_1077_1976 238
34 3300048916 Ga0496113_0077821 Ga0496113_0077821_1309_2208 238
35 3300050512 nmdc:mga0n895_239981_c1 nmdc:mga0n895_239981_c1_338_1237 238
36 3300053119 Ga0500595_010192 Ga0500595_010192_2821_3708 239
37 3300005347 Ga0070668_100060403 Ga0070668_1000604033 240
38 3300005354 Ga0070675_100120270 Ga0070675_1001202703 240
39 3300005458 Ga0070681_10172223 Ga0070681_101722232 240
40 3300005840 Ga0068870_10009958 Ga0068870_100099583 240
41 3300005844 Ga0068862_100030852 Ga0068862_1000308523 240
42 3300006881 Ga0068865_100130119 Ga0068865_1001301193 240
43 3300003203 JGI25406J46586_10000022 JGI25406J46586_1000002247 241
44 3300005353 Ga0070669_100244156 Ga0070669_1002441561 241
45 3300005719 Ga0068861_100028571 Ga0068861_1000285715 241
46 3300005985 Ga0081539_10000172 Ga0081539_1000017254 241
47 3300006051 Ga0075364_10057141 Ga0075364_100571412 241
48 3300006186 Ga0075369_10008562 Ga0075369_100085623 241
49 3300009094 Ga0111539_10010306 Ga0111539_100103067 241
50 3300013308 Ga0157375_10373901 Ga0157375_103739012 241
51 3300025908 Ga0207643_10094495 Ga0207643_100944952 241
52 3300025923 Ga0207681_10407318 Ga0207681_104073181 241
53 3300025926 Ga0207659_10306307 Ga0207659_103063072 241
54 3300025933 Ga0207706_10022384 Ga0207706_100223842 241
55 3300025935 Ga0207709_10039995 Ga0207709_100399953 241
56 3300025938 Ga0207704_10079732 Ga0207704_100797322 241
57 3300025940 Ga0207691_10113679 Ga0207691_101136793 241
58 3300025972 Ga0207668_10103358 Ga0207668_101033583 241
59 3300025972 Ga0207668_10289679 Ga0207668_102896792 241
60 3300026118 Ga0207675_100026109 Ga0207675_1000261092 241
61 3300026121 Ga0207683_10225271 Ga0207683_102252712 241
62 3300028380 Ga0268265_10013905 Ga0268265_100139053 241
63 3300028381 Ga0268264_10201015 Ga0268264_102010152 241
64 3300028794 Ga0307515_10223403 Ga0307515_102234032 241
65 3300048919 Ga0496116_0008464 Ga0496116_0008464_5335_6222 241
66 3300048920 Ga0496117_0129873 Ga0496117_0129873_401_1288 241
67 3300048924 Ga0496121_0025787 Ga0496121_0025787_61_948 241
68 3300048925 Ga0496122_0126518 Ga0496122_0126518_591_1478 241
69 3300048928 Ga0496125_0064216 Ga0496125_0064216_1307_2194 241
70 3300048929 Ga0496126_0002882 Ga0496126_0002882_10363_11241 241
71 3300048929 Ga0496126_0043094 Ga0496126_0043094_2920_3795 241
72 3300050491 nmdc:mga00v17_4318_c1 nmdc:mga00v17_4318_c1_644_1531 241
73 3300050511 nmdc:mga08y16_88450_c1 nmdc:mga08y16_88450_c1_1171_2049 241
74 3300053104 Ga0500556_0000011 Ga0500556_0000011_217686_218573 241
75 3300005335 Ga0070666_10113905 Ga0070666_101139052 242
76 3300005466 Ga0070685_10145761 Ga0070685_101457612 242
77 3300005548 Ga0070665_100132035 Ga0070665_1001320352 242
78 3300005617 Ga0068859_100321040 Ga0068859_1003210402 242
79 3300005843 Ga0068860_100659481 Ga0068860_1006594811 242
80 3300006931 Ga0097620_100321036 Ga0097620_1003210362 242
81 3300025903 Ga0207680_10132585 Ga0207680_101325852 242
82 3300025925 Ga0207650_10336242 Ga0207650_103362421 242
83 3300026035 Ga0207703_10218310 Ga0207703_102183102 242
84 3300028379 Ga0268266_10000519 Ga0268266_100005199 242
85 3300028381 Ga0268264_10088591 Ga0268264_100885912 242
86 3300046452 Ga0495617_014516 Ga0495617_014516_1726_2619 242
87 3300046461 Ga0495641_0081943 Ga0495641_0081943_499_1392 242
88 3300046691 Ga0495670_0083699 Ga0495670_0083699_310_1188 242
89 3300053160 Ga0500633_0034335 Ga0500633_0034335_54_947 242
90 3300005616 Ga0068852_100372410 Ga0068852_1003724102 243
91 3300009093 Ga0105240_10298194 Ga0105240_102981942 243
92 3300013104 Ga0157370_10039231 Ga0157370_100392311 243
93 3300013105 Ga0157369_10251775 Ga0157369_102517751 243
94 3300013308 Ga0157375_10499496 Ga0157375_104994961 243
95 3300025913 Ga0207695_10047230 Ga0207695_100472301 243
96 3300026121 Ga0207683_10051733 Ga0207683_100517333 243
97 3300026142 Ga0207698_10399754 Ga0207698_103997541 243
98 3300031235 Ga0265330_10002705 Ga0265330_100027053 243
99 3300031247 Ga0265340_10001835 Ga0265340_100018355 243
100 3300031911 Ga0307412_10401242 Ga0307412_104012421 243
101 3300033180 Ga0307510_10041641 Ga0307510_100416413 243
102 3300037466 Ga0395898_0204681 Ga0395898_0204681_940_1845 243
103 3300038443 Ga0395901_0568965 Ga0395901_0568965_148_1053 243
104 3300046460 Ga0495638_0073036 Ga0495638_0073036_452_1345 243
105 3300046660 Ga0495625_0164488 Ga0495625_0164488_337_1230 243
106 3300048091 Ga0495626_0085913 Ga0495626_0085913_406_1284 243
107 3300048929 Ga0496126_0186116 Ga0496126_0186116_841_1728 243
108 3300053145 Ga0500586_004716 Ga0500586_004716_412_1308 243
109 3300053153 Ga0500616_0000028 Ga0500616_0000028_174134_175003 243
110 3300005844 Ga0068862_100458088 Ga0068862_1004580881 244
111 3300005937 Ga0081455_10067418 Ga0081455_100674182 244
112 3300006353 Ga0075370_10099098 Ga0075370_100990981 244
113 3300031616 Ga0307508_10015229 Ga0307508_100152292 244
114 3300046452 Ga0495617_069073 Ga0495617_069073_89_973 244
115 3300046500 Ga0495596_0087876 Ga0495596_0087876_106_999 244
116 3300046519 Ga0495632_0166876 Ga0495632_0166876_10_903 244
117 3300047470 Ga0495681_0134695 Ga0495681_0134695_31_924 244
118 3300053093 Ga0500651_0091081 Ga0500651_0091081_259_1137 244
119 3300053108 Ga0500562_033346 Ga0500562_033346_117_995 244
120 3300053161 Ga0500634_0058771 Ga0500634_0058771_941_1819 244
121 3300053731 Ga0500609_005796 Ga0500609_005796_25_903 244
122 3300005347 Ga0070668_100298536 Ga0070668_1002985361 245
123 3300005355 Ga0070671_100064182 Ga0070671_1000641823 245
124 3300005364 Ga0070673_100238526 Ga0070673_1002385262 245
125 3300005367 Ga0070667_100184008 Ga0070667_1001840082 245
126 3300005455 Ga0070663_100040125 Ga0070663_1000401253 245
127 3300005457 Ga0070662_100081310 Ga0070662_1000813102 245
128 3300005471 Ga0070698_100083435 Ga0070698_1000834353 245
129 3300005544 Ga0070686_100224390 Ga0070686_1002243901 245
130 3300005545 Ga0070695_100087857 Ga0070695_1000878573 245
131 3300005615 Ga0070702_100346537 Ga0070702_1003465371 245
132 3300005719 Ga0068861_100057268 Ga0068861_1000572682 245
133 3300005843 Ga0068860_100011349 Ga0068860_1000113492 245
134 3300006881 Ga0068865_100014151 Ga0068865_1000141512 245
135 3300009148 Ga0105243_10076554 Ga0105243_100765541 245
136 3300010375 Ga0105239_10455782 Ga0105239_104557822 245
137 3300017792 Ga0163161_10088836 Ga0163161_100888363 245
138 3300025933 Ga0207706_10061184 Ga0207706_100611843 245
139 3300025938 Ga0207704_10148953 Ga0207704_101489532 245
140 3300025942 Ga0207689_10043962 Ga0207689_100439622 245
141 3300025961 Ga0207712_10147037 Ga0207712_101470372 245
142 3300025972 Ga0207668_10025989 Ga0207668_100259892 245
143 3300026118 Ga0207675_100034894 Ga0207675_1000348942 245
144 3300037418 Ga0395900_0107743 Ga0395900_0107743_1542_2390 245
145 3300046457 Ga0495590_0020864 Ga0495590_0020864_751_1629 245
146 3300046474 Ga0495605_0037001 Ga0495605_0037001_40_918 245
147 3300046492 Ga0495585_0066597 Ga0495585_0066597_529_1407 245
148 3300046500 Ga0495596_0078923 Ga0495596_0078923_45_923 245
149 3300046539 Ga0495621_0115318 Ga0495621_0115318_68_946 245
150 3300046615 Ga0495656_0027037 Ga0495656_0027037_1075_1953 245
151 3300047445 Ga0495677_0043534 Ga0495677_0043534_463_1341 245
152 3300048905 Ga0496102_0236791 Ga0496102_0236791_613_1491 245
153 3300048923 Ga0496120_0139559 Ga0496120_0139559_325_1209 245
154 3300048924 Ga0496121_0235847 Ga0496121_0235847_331_1209 245
155 3300048927 Ga0496124_0138572 Ga0496124_0138572_867_1745 245
156 3300050490 nmdc:mga03n38_113375_c1 nmdc:mga03n38_113375_c1_195_1073 245
157 3300050496 nmdc:mga07m45_49555_c1 nmdc:mga07m45_49555_c1_247_1125 245
158 3300053130 Ga0500642_0000030 Ga0500642_0000030_64499_65386 245
159 3300053137 Ga0500561_0045485 Ga0500561_0045485_195_1073 245
160 3300053153 Ga0500616_0000026 Ga0500616_0000026_128319_129206 245
161 3300005338 Ga0068868_100078846 Ga0068868_1000788461 246
162 3300005455 Ga0070663_100003769 Ga0070663_1000037692 246
163 3300005937 Ga0081455_10302620 Ga0081455_103026201 246
164 3300028794 Ga0307515_10022211 Ga0307515_100222112 246
165 3300046664 Ga0495659_0100451 Ga0495659_0100451_176_1060 246
166 3300053131 Ga0500652_001175 Ga0500652_001175_7131_8021 246
167 3300005364 Ga0070673_100600535 Ga0070673_1006005351 247
168 3300005445 Ga0070708_100243206 Ga0070708_1002432061 247
169 3300005467 Ga0070706_100287173 Ga0070706_1002871732 247
170 3300005471 Ga0070698_100317043 Ga0070698_1003170432 247
171 3300026023 Ga0207677_10067123 Ga0207677_100671232 247
172 3300031711 Ga0265314_10204251 Ga0265314_102042511 247
173 3300048924 Ga0496121_0010221 Ga0496121_0010221_8628_9524 247
174 3300050494 nmdc:mga06z11_6494_c1 nmdc:mga06z11_6494_c1_2075_2959 247
175 3300050495 nmdc:mga04h51_123446_c1 nmdc:mga04h51_123446_c1_19_903 247
176 3300053737 Ga0500601_002532 Ga0500601_002532_147_1121 247
177 3300005444 Ga0070694_100055074 Ga0070694_1000550742 248
178 3300048903 Ga0496100_0065534 Ga0496100_0065534_810_1691 248
179 3300048912 Ga0496109_0316017 Ga0496109_0316017_241_1110 248
180 3300048913 Ga0496110_0220451 Ga0496110_0220451_637_1506 248
181 3300005354 Ga0070675_100351008 Ga0070675_1003510081 249
182 3300005441 Ga0070700_100163246 Ga0070700_1001632462 249
183 3300025940 Ga0207691_10194302 Ga0207691_101943022 249
184 3300026067 Ga0207678_10181029 Ga0207678_101810292 249
185 3300032005 Ga0307411_10561008 Ga0307411_105610081 249
186 3300053094 Ga0500566_0006566 Ga0500566_0006566_5757_6731 249
187 3300053102 Ga0500554_009463 Ga0500554_009463_1322_2197 249
188 3300053111 Ga0500572_000429 Ga0500572_000429_9149_10123 249
189 3300053115 Ga0500591_059693 Ga0500591_059693_151_1125 249
190 3300053122 Ga0500608_010156 Ga0500608_010156_1220_2194 249
191 3300053123 Ga0500614_042497 Ga0500614_042497_44_1018 249
192 3300053136 Ga0500559_0009412 Ga0500559_0009412_1994_2968 249
193 3300053150 Ga0500603_000241 Ga0500603_000241_8536_9510 249
194 3300053159 Ga0500630_003701 Ga0500630_003701_4391_5365 249
195 3300053163 Ga0500639_000076 Ga0500639_000076_4764_5738 249
196 3300053730 Ga0500645_083513 Ga0500645_083513_69_893 249
197 3300053735 Ga0500596_000689 Ga0500596_000689_2319_3293 249
198 3300055283 Ga0500661_000404 Ga0500661_000404_4803_5678 249
199 3300005327 Ga0070658_10066416 Ga0070658_100664162 250
200 3300005535 Ga0070684_100048283 Ga0070684_1000482834 250
201 3300005539 Ga0068853_100109748 Ga0068853_1001097484 250
202 3300005548 Ga0070665_100047511 Ga0070665_1000475113 250
203 3300005563 Ga0068855_100037802 Ga0068855_1000378026 250
204 3300005618 Ga0068864_100032278 Ga0068864_1000322783 250
205 3300005841 Ga0068863_100708512 Ga0068863_1007085121 250
206 3300005937 Ga0081455_10005273 Ga0081455_100052738 250
207 3300005983 Ga0081540_1030499 Ga0081540_10304992 250
208 3300009093 Ga0105240_10112264 Ga0105240_101122642 250
209 3300009098 Ga0105245_10003690 Ga0105245_100036906 250
210 3300010375 Ga0105239_10175567 Ga0105239_101755672 250
211 3300013297 Ga0157378_10067838 Ga0157378_100678384 250
212 3300013306 Ga0163162_10051849 Ga0163162_100518492 250
213 3300013308 Ga0157375_10130039 Ga0157375_101300392 250
214 3300014325 Ga0163163_10043849 Ga0163163_100438492 250
215 3300014969 Ga0157376_10012280 Ga0157376_100122802 250
216 3300025901 Ga0207688_10020870 Ga0207688_100208702 250
217 3300025927 Ga0207687_10011456 Ga0207687_100114562 250
218 3300025938 Ga0207704_10144874 Ga0207704_101448742 250
219 3300025945 Ga0207679_10046207 Ga0207679_100462072 250
220 3300026041 Ga0207639_10256787 Ga0207639_102567872 250
221 3300026088 Ga0207641_10681685 Ga0207641_106816851 250
222 3300026121 Ga0207683_10082242 Ga0207683_100822424 250
223 3300028379 Ga0268266_10034062 Ga0268266_100340622 250
224 3300039447 Ga0436361_0978240 Ga0436361_0978240_1353_2234 250
225 3300047315 Ga0495581_0100442 Ga0495581_0100442_341_1234 250
226 3300048904 Ga0496101_0254955 Ga0496101_0254955_208_1092 250
227 3300048905 Ga0496102_0006054 Ga0496102_0006054_64_948 250
228 3300048907 Ga0496104_0005128 Ga0496104_0005128_9059_9943 250
229 3300048908 Ga0496105_0004236 Ga0496105_0004236_8322_9206 250
230 3300048909 Ga0496106_0000711 Ga0496106_0000711_18978_19862 250
231 3300048910 Ga0496107_0001289 Ga0496107_0001289_9412_10296 250
232 3300048911 Ga0496108_0002638 Ga0496108_0002638_10126_11010 250
233 3300048912 Ga0496109_0061716 Ga0496109_0061716_1741_2625 250
234 3300048913 Ga0496110_0047003 Ga0496110_0047003_1497_2381 250
235 3300048918 Ga0496115_0011470 Ga0496115_0011470_1752_2636 250
236 3300048924 Ga0496121_0040809 Ga0496121_0040809_2046_2945 250
237 3300053142 Ga0500577_0000137 Ga0500577_0000137_12496_13395 250
238 3300045976 Ga0466967_0047439 Ga0466967_0047439_2566_3447 251
239 3300048909 Ga0496106_0004766 Ga0496106_0004766_229_1110 251
240 3300048910 Ga0496107_0166911 Ga0496107_0166911_93_974 251
241 3300048911 Ga0496108_0002311 Ga0496108_0002311_13102_13983 251
242 3300048912 Ga0496109_0000199 Ga0496109_0000199_48695_49576 251
243 3300048913 Ga0496110_0006468 Ga0496110_0006468_5489_6370 251
244 3300048915 Ga0496112_0001162 Ga0496112_0001162_10548_11429 251
245 3300028573 Ga0265334_10026828 Ga0265334_100268282 253
246 3300037471 Ga0395905_0129738 Ga0395905_0129738_1173_2057 254
247 3300037853 Ga0436364_0350531 Ga0436364_0350531_92_988 254
248 3300047320 Ga0495672_0058324 Ga0495672_0058324_474_1349 254
249 3300005983 Ga0081540_1002589 Ga0081540_10025897 255
250 3300010375 Ga0105239_10154481 Ga0105239_101544812 255
251 3300011119 Ga0105246_10230845 Ga0105246_102308452 255
252 3300003215 JGI25153J46596_10016040 JGI25153J46596_100160402 256
253 3300005347 Ga0070668_100142629 Ga0070668_1001426292 256
254 3300006178 Ga0075367_10077821 Ga0075367_100778211 256
255 3300025297 Ga0209758_1011836 Ga0209758_10118362 256
256 3300031235 Ga0265330_10043019 Ga0265330_100430191 256
257 3300031238 Ga0265332_10037682 Ga0265332_100376823 256
258 3300048926 Ga0496123_0044387 Ga0496123_0044387_990_1874 256
259 3300005434 Ga0070709_10002912 Ga0070709_100029126 257
260 3300005436 Ga0070713_100007596 Ga0070713_1000075965 257
261 3300005439 Ga0070711_100030214 Ga0070711_1000302143 257
262 3300006163 Ga0070715_10094976 Ga0070715_100949761 257
263 3300006175 Ga0070712_100019838 Ga0070712_1000198384 257
264 3300025906 Ga0207699_10004047 Ga0207699_100040475 257
265 3300025915 Ga0207693_10027516 Ga0207693_100275162 257
266 3300025916 Ga0207663_10075689 Ga0207663_100756892 257
267 3300046460 Ga0495638_0016825 Ga0495638_0016825_1297_2184 257
268 3300046501 Ga0495607_0021535 Ga0495607_0021535_2998_3885 257
269 3300046520 Ga0495637_0026429 Ga0495637_0026429_687_1574 257
270 3300046537 Ga0495598_0050970 Ga0495598_0050970_68_946 257
271 3300046691 Ga0495670_0011640 Ga0495670_0011640_582_1469 257
272 3300047472 Ga0495686_0004829 Ga0495686_0004829_7487_8374 257
273 3300048917 Ga0496114_0116723 Ga0496114_0116723_34_918 257
274 3300048925 Ga0496122_0018566 Ga0496122_0018566_2765_3652 257
275 3300048926 Ga0496123_0021074 Ga0496123_0021074_3659_4546 257
276 3300048928 Ga0496125_0007880 Ga0496125_0007880_10245_11132 257
277 3300048929 Ga0496126_0249555 Ga0496126_0249555_167_1054 257
278 3300053087 Ga0500643_045547 Ga0500643_045547_71_958 257
279 3300053089 Ga0500581_008974 Ga0500581_008974_1944_2831 257
280 3300053093 Ga0500651_0026121 Ga0500651_0026121_266_1153 257
281 3300053096 Ga0500641_0028899 Ga0500641_0028899_287_1174 257
282 3300053098 Ga0500650_0001750 Ga0500650_0001750_4914_5801 257
283 3300053108 Ga0500562_060258 Ga0500562_060258_121_1008 257
284 3300053109 Ga0500569_003519 Ga0500569_003519_2024_2911 257
285 3300053139 Ga0500568_0003414 Ga0500568_0003414_3591_4478 257
286 3300053151 Ga0500604_0000888 Ga0500604_0000888_2902_3789 257
287 3300053158 Ga0500627_0020750 Ga0500627_0020750_1671_2558 257
288 3300039437 Ga0436365_1008789 Ga0436365_1008789_79_963 258
289 3300044765 Ga0466970_0068050 Ga0466970_0068050_352_1236 258
290 3300048904 Ga0496101_0194807 Ga0496101_0194807_290_1174 259
291 3300048907 Ga0496104_0299997 Ga0496104_0299997_178_1062 259
292 3300048928 Ga0496125_0000202 Ga0496125_0000202_62004_63011 259
293 3300049570 Ga0501033_0360288 Ga0501033_0360288_127_1008 259
294 3300049580 Ga0501046_0193212 Ga0501046_0193212_250_1131 259
295 3300049581 Ga0501047_0103136 Ga0501047_0103136_1580_2461 259
296 3300049586 Ga0501070_0008301 Ga0501070_0008301_6056_6937 259
297 3300049590 Ga0501074_0085507 Ga0501074_0085507_1289_2170 259
298 3300049742 Ga0501080_0121480 Ga0501080_0121480_478_1359 259
299 3300049823 Ga0501044_0236711 Ga0501044_0236711_373_1254 259
300 3300005458 Ga0070681_10602518 Ga0070681_106025181 260
301 3300044842 Ga0466957_0017412 Ga0466957_0017412_1174_2058 260
302 3300045049 Ga0466959_0012080 Ga0466959_0012080_4049_4933 260
303 3300005327 Ga0070658_10244141 Ga0070658_102441412 261
304 3300005437 Ga0070710_10009090 Ga0070710_100090902 261
305 3300005937 Ga0081455_10006252 Ga0081455_1000625211 261
306 3300005937 Ga0081455_10059000 Ga0081455_100590002 261
307 3300047471 Ga0495684_0385043 Ga0495684_0385043_19_867 261
308 3300031507 Ga0307509_10241021 Ga0307509_102410211 262
309 3300033180 Ga0307510_10132460 Ga0307510_101324602 262
310 3300046455 Ga0495603_0038657 Ga0495603_0038657_1715_2593 262
311 3300053080 Ga0500635_0030255 Ga0500635_0030255_181_1059 262
312 3300053102 Ga0500554_010368 Ga0500554_010368_1047_1925 262
313 3300053150 Ga0500603_003006 Ga0500603_003006_2512_3390 262
314 3300053178 Ga0500637_0000449 Ga0500637_0000449_14705_15583 262
315 3300031616 Ga0307508_10106518 Ga0307508_101065184 264
316 3300046477 Ga0495664_0264218 Ga0495664_0264218_15_899 264
317 3300048912 Ga0496109_0209708 Ga0496109_0209708_963_1790 264
318 3300048915 Ga0496112_0036409 Ga0496112_0036409_38_916 264
319 3300005983 Ga0081540_1066450 Ga0081540_10664502 265
320 3300048924 Ga0496121_0069924 Ga0496121_0069924_723_1622 265
321 3300048929 Ga0496126_0047285 Ga0496126_0047285_2633_3532 265
322 3300049583 Ga0501067_0068917 Ga0501067_0068917_341_1222 265
323 3300005366 Ga0070659_100104182 Ga0070659_1001041822 266
324 3300005536 Ga0070697_100007535 Ga0070697_1000075356 266
325 3300005563 Ga0068855_100125949 Ga0068855_1001259493 266
326 3300005614 Ga0068856_100097944 Ga0068856_1000979442 266
327 3300005616 Ga0068852_100097459 Ga0068852_1000974592 266
328 3300046476 Ga0495662_0151121 Ga0495662_0151121_227_1111 266
329 3300046557 Ga0495622_0126806 Ga0495622_0126806_221_1108 266
330 3300053094 Ga0500566_0003241 Ga0500566_0003241_5050_5937 266
331 3300053136 Ga0500559_0000272 Ga0500559_0000272_30217_31104 266
332 3300025932 Ga0207690_10093677 Ga0207690_100936772 267
333 3300025949 Ga0207667_10089491 Ga0207667_100894912 267
334 3300026142 Ga0207698_10354800 Ga0207698_103548002 267
335 3300028379 Ga0268266_10516093 Ga0268266_105160931 267
336 3300035117 Ga0373953_0089016 Ga0373953_0089016_89_988 267
337 3300035410 Ga0373924_0018339 Ga0373924_0018339_1780_2679 267
338 3300036401 Ga0373937_0463604 Ga0373937_0463604_126_1025 267
339 3300046678 Ga0495599_0059415 Ga0495599_0059415_856_1755 267
340 3300048924 Ga0496121_0068945 Ga0496121_0068945_1442_2317 267
341 3300035725 Ga0373947_0302372 Ga0373947_0302372_21_899 268
342 3300046524 Ga0495648_0001062 Ga0495648_0001062_20607_21491 268
343 3300021320 Ga0214544_1000001 Ga0214544_1000001162 269
344 3300021321 Ga0214542_1000005 Ga0214542_1000005162 269
345 3300021324 Ga0214545_1000003 Ga0214545_1000003602 269
346 3300021327 Ga0214543_1000002 Ga0214543_1000002163 269
347 3300035695 Ga0373927_0052079 Ga0373927_0052079_1186_2064 269
348 3300044658 Ga0466972_0058478 Ga0466972_0058478_89_1021 269
349 3300044694 Ga0466963_0220525 Ga0466963_0220525_221_1102 269
350 3300045976 Ga0466967_0042506 Ga0466967_0042506_2430_3311 269
351 3300046499 Ga0495594_0073696 Ga0495594_0073696_960_1838 269
352 3300027296 Ga0209389_1000083 Ga0209389_100008354 270
353 3300027357 Ga0209589_1000097 Ga0209589_100009754 270
354 3300027361 Ga0209489_100105 Ga0209489_10010580 270
355 3300003771 Ga0055526_1035353 Ga0055526_10353532 271
356 3300005327 Ga0070658_10373897 Ga0070658_103738972 271
357 3300005577 Ga0068857_100018827 Ga0068857_1000188272 271
358 3300005616 Ga0068852_100015459 Ga0068852_1000154595 271
359 3300005985 Ga0081539_10000945 Ga0081539_1000094526 271
360 3300009545 Ga0105237_10110932 Ga0105237_101109323 271
361 3300025295 Ga0209564_1001859 Ga0209564_10018592 271
362 3300025909 Ga0207705_10234204 Ga0207705_102342042 271
363 3300026116 Ga0207674_10068039 Ga0207674_100680392 271
364 3300049822 Ga0501035_0030449 Ga0501035_0030449_3814_4698 271
365 3300053119 Ga0500595_017224 Ga0500595_017224_369_1247 271
366 3300005439 Ga0070711_100067968 Ga0070711_1000679682 272
367 3300005455 Ga0070663_100164918 Ga0070663_1001649182 272
368 3300005618 Ga0068864_100098457 Ga0068864_1000984572 272
369 3300010375 Ga0105239_10282165 Ga0105239_102821652 272
370 3300011119 Ga0105246_10375712 Ga0105246_103757122 272
371 3300013296 Ga0157374_10350904 Ga0157374_103509042 272
372 3300013306 Ga0163162_10483173 Ga0163162_104831731 272
373 3300014968 Ga0157379_10198204 Ga0157379_101982042 272
374 3300025916 Ga0207663_10046990 Ga0207663_100469902 272
375 3300026067 Ga0207678_10157232 Ga0207678_101572322 272
376 3300048905 Ga0496102_0086765 Ga0496102_0086765_793_1674 272
377 3300048905 Ga0496102_0432184 Ga0496102_0432184_22_906 272
378 3300048907 Ga0496104_0004602 Ga0496104_0004602_473_1354 272
379 3300048909 Ga0496106_0043979 Ga0496106_0043979_1446_2327 272
380 3300048913 Ga0496110_0012653 Ga0496110_0012653_2892_3773 272
381 3300048918 Ga0496115_0036128 Ga0496115_0036128_1501_2382 272
382 3300048929 Ga0496126_0135855 Ga0496126_0135855_133_1014 272
383 3300031250 Ga0265331_10055600 Ga0265331_100556002 273
384 3300046462 Ga0495651_0107839 Ga0495651_0107839_707_1594 273
385 3300046559 Ga0495667_0052845 Ga0495667_0052845_1536_2423 273
386 3300046809 Ga0495600_0229069 Ga0495600_0229069_16_903 273
387 3300048928 Ga0496125_0069626 Ga0496125_0069626_1205_2092 273
388 3300049568 Ga0501031_0043832 Ga0501031_0043832_1716_2600 274
389 3300049574 Ga0501038_0049739 Ga0501038_0049739_2620_3504 274
390 3300049581 Ga0501047_0379285 Ga0501047_0379285_37_921 274
391 3300049586 Ga0501070_0041853 Ga0501070_0041853_2292_3176 274
392 3300049823 Ga0501044_0070899 Ga0501044_0070899_435_1319 274
393 3300005329 Ga0070683_100012441 Ga0070683_1000124412 275
394 3300005366 Ga0070659_100265151 Ga0070659_1002651512 275
395 3300005535 Ga0070684_100039051 Ga0070684_1000390512 275
396 3300005539 Ga0068853_100000617 Ga0068853_10000061713 275
397 3300005563 Ga0068855_100006225 Ga0068855_1000062253 275
398 3300005577 Ga0068857_100124322 Ga0068857_1001243222 275
399 3300009093 Ga0105240_10031852 Ga0105240_100318522 275
400 3300009545 Ga0105237_10014161 Ga0105237_100141615 275
401 3300009551 Ga0105238_10023571 Ga0105238_100235715 275
402 3300013104 Ga0157370_10095838 Ga0157370_100958382 275
403 3300013105 Ga0157369_10026130 Ga0157369_100261305 275
404 3300025912 Ga0207707_10008927 Ga0207707_100089274 275
405 3300025913 Ga0207695_10074532 Ga0207695_100745323 275
406 3300025921 Ga0207652_10008142 Ga0207652_100081422 275
407 3300025924 Ga0207694_10030264 Ga0207694_100302642 275
408 3300025928 Ga0207700_10090940 Ga0207700_100909402 275
409 3300025929 Ga0207664_10414680 Ga0207664_104146802 275
410 3300025932 Ga0207690_10197413 Ga0207690_101974133 275
411 3300026041 Ga0207639_10105506 Ga0207639_101055062 275
412 3300026116 Ga0207674_10145157 Ga0207674_101451573 275
413 3300026142 Ga0207698_10055781 Ga0207698_100557812 275
414 3300005339 Ga0070660_100007797 Ga0070660_1000077975 276
415 3300007788 Ga0099795_10058733 Ga0099795_100587331 276
416 3300021377 Ga0213874_10015554 Ga0213874_100155543 276
417 3300025919 Ga0207657_10014599 Ga0207657_100145995 276
418 3300039437 Ga0436365_1084521 Ga0436365_1084521_37_936 276
419 3300039450 Ga0436363_0300553 Ga0436363_0300553_1282_2169 276
420 iso_pu_bacteria 2824679649 2824680952 276
421 iso_pu_bacteria 2922393267 2922401178 276
422 3300039438 Ga0436360_0872836 Ga0436360_0872836_1600_2481 277
423 3300039453 Ga0436362_0839238 Ga0436362_0839238_507_1388 277
424 iso_pu_bacteria 2617270741 2617373316 278
425 iso_pu_bacteria 2744054633 2745081021 278
426 iso_pu_bacteria 2824732956 2824734755 278
427 iso_pu_bacteria 2824746037 2824747671 278
428 iso_pu_bacteria 2881665667 2881667464 278
429 iso_pu_bacteria 2908775508 2908781773 278
430 iso_pu_bacteria 3005483717 3005487532 278
431 3300021441 Ga0213871_10002801 Ga0213871_100028013 279
432 3300053097 Ga0500648_104648 Ga0500648_104648_288_1175 279
433 iso_pu_bacteria 2602042107 2603862472 279
434 iso_pu_bacteria 2721755755 2723848318 279
435 iso_pu_bacteria 2791355199 2793079601 279
436 iso_pu_bacteria 2857524615 2857530574 279
437 iso_pu_bacteria 2874604998 2874607468 279
438 iso_pu_bacteria 2885383462 2885385941 279
439 iso_pu_bacteria 2893066018 2893069543 279
440 iso_pu_bacteria 2919073203 2919077332 279
441 iso_pu_bacteria 3005594810 3005596345 279
442 iso_pu_bacteria 8006964411 8006969619 279
443 iso_pu_bacteria 8006984368 8006988739 279
444 iso_pu_bacteria 8006994254 8006998699 279
445 3300005347 Ga0070668_100252451 Ga0070668_1002524512 280
446 3300006237 Ga0097621_100425206 Ga0097621_1004252062 280
447 3300006038 Ga0075365_10266043 Ga0075365_102660431 281
448 3300031235 Ga0265330_10039751 Ga0265330_100397511 281
449 3300037068 Ga0373925_0249083 Ga0373925_0249083_180_1061 281
450 3300009093 Ga0105240_10002493 Ga0105240_1000249320 282
451 3300009174 Ga0105241_10017796 Ga0105241_100177963 282
452 3300025913 Ga0207695_10000006 Ga0207695_100000061029 282
453 3300039438 Ga0436360_0561872 Ga0436360_0561872_270_1151 282
454 3300053156 Ga0500622_0006554 Ga0500622_0006554_2951_3838 282
455 3300005344 Ga0070661_100099322 Ga0070661_1000993221 283
456 3300005455 Ga0070663_100000663 Ga0070663_10000066311 283
457 3300005456 Ga0070678_100092117 Ga0070678_1000921172 283
458 3300005548 Ga0070665_100013563 Ga0070665_1000135638 283
459 3300005564 Ga0070664_100132154 Ga0070664_1001321542 283
460 3300006038 Ga0075365_10034919 Ga0075365_100349192 283
461 3300006353 Ga0075370_10037897 Ga0075370_100378972 283
462 3300009094 Ga0111539_10892380 Ga0111539_108923801 283
463 3300010375 Ga0105239_10008059 Ga0105239_100080597 283
464 3300025920 Ga0207649_10223121 Ga0207649_102231212 283
465 3300025945 Ga0207679_10355398 Ga0207679_103553982 283
466 3300026067 Ga0207678_10002185 Ga0207678_100021855 283
467 3300026142 Ga0207698_10148672 Ga0207698_101486723 283
468 3300028379 Ga0268266_10060931 Ga0268266_100609312 283
469 3300048908 Ga0496105_0082363 Ga0496105_0082363_1040_1939 283
470 3300048917 Ga0496114_0307068 Ga0496114_0307068_160_1059 283
471 3300048918 Ga0496115_0051481 Ga0496115_0051481_821_1720 283
472 3300050492 nmdc:mga0yw44_13187_c1 nmdc:mga0yw44_13187_c1_778_1677 283
473 3300050496 nmdc:mga07m45_16975_c1 nmdc:mga07m45_16975_c1_551_1450 283
474 3300001989 JGI24739J22299_10005104 JGI24739J22299_100051042 291
475 3300001990 JGI24737J22298_10010310 JGI24737J22298_100103102 291
476 3300002067 JGI24735J21928_10019161 JGI24735J21928_100191613 291
477 3300005344 Ga0070661_100315818 Ga0070661_1003158181 291
478 3300005539 Ga0068853_100221923 Ga0068853_1002219232 291
479 3300005563 Ga0068855_100100549 Ga0068855_1001005492 291
480 3300005614 Ga0068856_100137559 Ga0068856_1001375592 291
481 3300005616 Ga0068852_100141797 Ga0068852_1001417972 291
482 3300009093 Ga0105240_10007678 Ga0105240_100076789 291
483 3300009174 Ga0105241_10142548 Ga0105241_101425482 291
484 3300009545 Ga0105237_10106896 Ga0105237_101068963 291
485 3300009551 Ga0105238_10009195 Ga0105238_100091955 291
486 3300010375 Ga0105239_10077241 Ga0105239_100772414 291
487 3300025904 Ga0207647_10000241 Ga0207647_100002419 291
488 3300025913 Ga0207695_10101156 Ga0207695_101011563 291
489 3300025920 Ga0207649_10273823 Ga0207649_102738231 291
490 3300025933 Ga0207706_10218264 Ga0207706_102182643 291
491 3300026041 Ga0207639_10283003 Ga0207639_102830032 291
492 3300026067 Ga0207678_10276986 Ga0207678_102769862 291
493 3300026116 Ga0207674_10104186 Ga0207674_101041862 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02735

Ku

Ku70/Ku80 beta-barrel domain

53

224

0.91

Feature Viewer

pLDDT pTM Quality
67.95 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map