F454486
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 493 | 311 | 472 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0000202|Ga0496125_0000202_62004_63011 |
| Length | 301 |
| Sequence | MPLIRPRNQNRQLPLKFPKARAQRGLRDRAGQHAYQQENLMAPPRAYWKGSLKLSLVSCPVVLYPASTTVEKTRFHMINTETGNRLKEKEQKGRGYEISKGEFIPIEKDELEAVQIESNHTIDIDNFVPRDEIDKRFLNNPYYIAPDGKAGIDAFAVIRDAMKDKDRVALARIVLTNREHIIAIEPLGKGLLGTTLRYPYEVRDEEDYFDDIKSPKISKDMIDLAAHILDSKASHFDPSKFKDEYEDALKALVKRKAAGKPVKVVEKAEKPDNVISLMDALQQSLKGGKATPAPARQRKAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 2 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 3 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 4 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 5 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 6 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 7 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 8 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 9 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 10 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 11 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 12 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 13 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 14 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 15 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 16 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 17 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 18 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 19 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 20 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 21 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 22 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 107 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 108 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 109 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 110 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 111 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 166 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 244 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 247 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 248 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 249 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 263 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 265 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 266 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 267 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 271 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 272 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 273 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 274 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 275 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 276 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 277 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 278 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 279 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 280 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 281 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 282 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 283 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 284 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 285 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 286 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 287 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 288 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 289 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 290 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 291 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 293 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 294 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 296 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 297 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 298 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 300 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 301 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 302 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 303 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 304 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 305 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 306 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 308 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 309 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 310 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 311 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.93 |
| Metatranscriptomes | 0 |
| Isolates | 4.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.4 |
| Nodule | 2.84 |
| Rhizoplane | 7.91 |
| Rhizosphere | 64.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10005104 | 3300001989 | Bacteria | 4998 |
| 2 | JGI24737J22298_10010310 | 3300001990 | Bacteria | 3088 |
| 3 | JGI24735J21928_10019161 | 3300002067 | Bacteria | 2104 |
| 4 | JGI25406J46586_10000022 | 3300003203 | Bacteria | 79225 |
| 5 | JGI25153J46596_10016040 | 3300003215 | Bacteria | 3022 |
| 6 | JGI25153J46596_10039982 | 3300003215 | Bacteria | 1459 |
| 7 | Ga0055526_1035353 | 3300003771 | Bacteria | 1348 |
| 8 | Ga0070658_10066416 | 3300005327 | Bacteria | 2946 |
| 9 | Ga0070658_10244141 | 3300005327 | Bacteria | 1523 |
| 10 | Ga0070658_10373897 | 3300005327 | Bacteria | 1222 |
| 11 | Ga0070683_100012441 | 3300005329 | Bacteria | 7396 |
| 12 | Ga0070666_10113905 | 3300005335 | Bacteria | 1872 |
| 13 | Ga0068868_100078846 | 3300005338 | Bacteria | 2637 |
| 14 | Ga0070660_100007797 | 3300005339 | Bacteria | 7466 |
| 15 | Ga0070661_100099322 | 3300005344 | Bacteria | 2163 |
| 16 | Ga0070661_100315818 | 3300005344 | Bacteria | 1219 |
| 17 | Ga0070668_100060403 | 3300005347 | Bacteria | 2935 |
| 18 | Ga0070668_100142629 | 3300005347 | Bacteria | 1932 |
| 19 | Ga0070668_100154419 | 3300005347 | Bacteria | 1859 |
| 20 | Ga0070668_100252451 | 3300005347 | Bacteria | 1465 |
| 21 | Ga0070668_100298536 | 3300005347 | Bacteria | 1350 |
| 22 | Ga0070669_100244156 | 3300005353 | Bacteria | 1428 |
| 23 | Ga0070675_100120270 | 3300005354 | Bacteria | 2231 |
| 24 | Ga0070675_100351008 | 3300005354 | Bacteria | 1308 |
| 25 | Ga0070671_100064182 | 3300005355 | Bacteria | 3059 |
| 26 | Ga0070673_100238526 | 3300005364 | Bacteria | 1580 |
| 27 | Ga0070673_100600535 | 3300005364 | Bacteria | 1004 |
| 28 | Ga0070659_100104182 | 3300005366 | Bacteria | 2285 |
| 29 | Ga0070659_100215172 | 3300005366 | Bacteria | 1584 |
| 30 | Ga0070659_100265151 | 3300005366 | Bacteria | 1426 |
| 31 | Ga0070667_100184008 | 3300005367 | Bacteria | 1848 |
| 32 | Ga0070709_10002912 | 3300005434 | Bacteria | 9229 |
| 33 | Ga0070713_100007596 | 3300005436 | Bacteria | 7625 |
| 34 | Ga0070710_10009090 | 3300005437 | Bacteria | 4858 |
| 35 | Ga0070711_100030214 | 3300005439 | Bacteria | 3584 |
| 36 | Ga0070711_100067968 | 3300005439 | Bacteria | 2502 |
| 37 | Ga0070700_100163246 | 3300005441 | Bacteria | 1535 |
| 38 | Ga0070694_100055074 | 3300005444 | Bacteria | 2696 |
| 39 | Ga0070708_100243206 | 3300005445 | Bacteria | 1690 |
| 40 | Ga0070663_100000663 | 3300005455 | Bacteria | 18514 |
| 41 | Ga0070663_100003769 | 3300005455 | Bacteria | 8803 |
| 42 | Ga0070663_100040125 | 3300005455 | Bacteria | 3275 |
| 43 | Ga0070663_100164918 | 3300005455 | Bacteria | 1708 |
| 44 | Ga0070663_100250412 | 3300005455 | Bacteria | 1402 |
| 45 | Ga0070678_100092117 | 3300005456 | Bacteria | 2328 |
| 46 | Ga0070662_100081310 | 3300005457 | Bacteria | 2413 |
| 47 | Ga0070681_10172223 | 3300005458 | Bacteria | 2087 |
| 48 | Ga0070681_10602518 | 3300005458 | Bacteria | 1013 |
| 49 | Ga0070685_10145761 | 3300005466 | Bacteria | 1496 |
| 50 | Ga0070706_100287173 | 3300005467 | Bacteria | 1535 |
| 51 | Ga0070698_100083435 | 3300005471 | Bacteria | 3185 |
| 52 | Ga0070698_100317043 | 3300005471 | Bacteria | 1490 |
| 53 | Ga0070679_100655314 | 3300005530 | Bacteria | 992 |
| 54 | Ga0070684_100039051 | 3300005535 | Bacteria | 4081 |
| 55 | Ga0070684_100048283 | 3300005535 | Bacteria | 3693 |
| 56 | Ga0070697_100007535 | 3300005536 | Bacteria | 8473 |
| 57 | Ga0068853_100000617 | 3300005539 | Bacteria | 24377 |
| 58 | Ga0068853_100068160 | 3300005539 | Bacteria | 3092 |
| 59 | Ga0068853_100109748 | 3300005539 | Bacteria | 2449 |
| 60 | Ga0068853_100221923 | 3300005539 | Bacteria | 1726 |
| 61 | Ga0070686_100224390 | 3300005544 | Bacteria | 1360 |
| 62 | Ga0070695_100087857 | 3300005545 | Bacteria | 2069 |
| 63 | Ga0070665_100013563 | 3300005548 | Bacteria | 8199 |
| 64 | Ga0070665_100047511 | 3300005548 | Bacteria | 4308 |
| 65 | Ga0070665_100132035 | 3300005548 | Bacteria | 2499 |
| 66 | Ga0068855_100006225 | 3300005563 | Bacteria | 14541 |
| 67 | Ga0068855_100037802 | 3300005563 | Bacteria | 5738 |
| 68 | Ga0068855_100100549 | 3300005563 | Bacteria | 3329 |
| 69 | Ga0068855_100125949 | 3300005563 | Bacteria | 2929 |
| 70 | Ga0070664_100132154 | 3300005564 | Bacteria | 2193 |
| 71 | Ga0068857_100018827 | 3300005577 | Bacteria | 6060 |
| 72 | Ga0068857_100124322 | 3300005577 | Bacteria | 2324 |
| 73 | Ga0068856_100097944 | 3300005614 | Bacteria | 2922 |
| 74 | Ga0068856_100137559 | 3300005614 | Bacteria | 2448 |
| 75 | Ga0070702_100346537 | 3300005615 | Bacteria | 1045 |
| 76 | Ga0068852_100015459 | 3300005616 | Bacteria | 5922 |
| 77 | Ga0068852_100097459 | 3300005616 | Bacteria | 2645 |
| 78 | Ga0068852_100141797 | 3300005616 | Bacteria | 2225 |
| 79 | Ga0068852_100372410 | 3300005616 | Bacteria | 1399 |
| 80 | Ga0068859_100051481 | 3300005617 | Bacteria | 4139 |
| 81 | Ga0068859_100321040 | 3300005617 | Bacteria | 1643 |
| 82 | Ga0068864_100032278 | 3300005618 | Bacteria | 4448 |
| 83 | Ga0068864_100098457 | 3300005618 | Bacteria | 2590 |
| 84 | Ga0068861_100028571 | 3300005719 | Bacteria | 4070 |
| 85 | Ga0068861_100057268 | 3300005719 | Bacteria | 2976 |
| 86 | Ga0068870_10009958 | 3300005840 | Bacteria | 4344 |
| 87 | Ga0068863_100708512 | 3300005841 | Bacteria | 1001 |
| 88 | Ga0068860_100011349 | 3300005843 | Bacteria | 8779 |
| 89 | Ga0068860_100091348 | 3300005843 | Bacteria | 2900 |
| 90 | Ga0068860_100659481 | 3300005843 | Bacteria | 1054 |
| 91 | Ga0068862_100030852 | 3300005844 | Bacteria | 4519 |
| 92 | Ga0068862_100078109 | 3300005844 | Bacteria | 2867 |
| 93 | Ga0068862_100458088 | 3300005844 | Bacteria | 1203 |
| 94 | Ga0081455_10005273 | 3300005937 | Bacteria | 14201 |
| 95 | Ga0081455_10006252 | 3300005937 | Bacteria | 12820 |
| 96 | Ga0081455_10059000 | 3300005937 | Bacteria | 3243 |
| 97 | Ga0081455_10067418 | 3300005937 | Bacteria | 2982 |
| 98 | Ga0081455_10302620 | 3300005937 | Bacteria | 1146 |
| 99 | Ga0081540_1002589 | 3300005983 | Bacteria | 14689 |
| 100 | Ga0081540_1030499 | 3300005983 | Bacteria | 2985 |
| 101 | Ga0081540_1066450 | 3300005983 | Bacteria | 1690 |
| 102 | Ga0081539_10000172 | 3300005985 | Bacteria | 151505 |
| 103 | Ga0081539_10000945 | 3300005985 | Bacteria | 54444 |
| 104 | Ga0075365_10034919 | 3300006038 | Bacteria | 3250 |
| 105 | Ga0075365_10266043 | 3300006038 | Bacteria | 1206 |
| 106 | Ga0075364_10057141 | 3300006051 | Bacteria | 2555 |
| 107 | Ga0070715_10094976 | 3300006163 | Bacteria | 1380 |
| 108 | Ga0070712_100019838 | 3300006175 | Bacteria | 4393 |
| 109 | Ga0075367_10053817 | 3300006178 | Bacteria | 2386 |
| 110 | Ga0075367_10077821 | 3300006178 | Bacteria | 2002 |
| 111 | Ga0075369_10008562 | 3300006186 | Bacteria | 3940 |
| 112 | Ga0097621_100425206 | 3300006237 | Bacteria | 1193 |
| 113 | Ga0075370_10011867 | 3300006353 | Bacteria | 4588 |
| 114 | Ga0075370_10037897 | 3300006353 | Bacteria | 2712 |
| 115 | Ga0075370_10099098 | 3300006353 | Bacteria | 1685 |
| 116 | Ga0068865_100014151 | 3300006881 | Bacteria | 5064 |
| 117 | Ga0068865_100130119 | 3300006881 | Bacteria | 1885 |
| 118 | Ga0097620_100051481 | 3300006931 | Bacteria | 4139 |
| 119 | Ga0097620_100321036 | 3300006931 | Bacteria | 1643 |
| 120 | Ga0099795_10058733 | 3300007788 | Bacteria | 1421 |
| 121 | Ga0105240_10002493 | 3300009093 | Bacteria | 29572 |
| 122 | Ga0105240_10007678 | 3300009093 | Bacteria | 15611 |
| 123 | Ga0105240_10031852 | 3300009093 | Bacteria | 6832 |
| 124 | Ga0105240_10112264 | 3300009093 | Bacteria | 3295 |
| 125 | Ga0105240_10298194 | 3300009093 | Bacteria | 1845 |
| 126 | Ga0111539_10010306 | 3300009094 | Bacteria | 11766 |
| 127 | Ga0111539_10892380 | 3300009094 | Bacteria | 1034 |
| 128 | Ga0105245_10003690 | 3300009098 | Bacteria | 13668 |
| 129 | Ga0105245_10472345 | 3300009098 | Bacteria | 1266 |
| 130 | Ga0105243_10076554 | 3300009148 | Bacteria | 2719 |
| 131 | Ga0105241_10017796 | 3300009174 | Bacteria | 5227 |
| 132 | Ga0105241_10142548 | 3300009174 | Bacteria | 1953 |
| 133 | Ga0105242_10191096 | 3300009176 | Bacteria | 1813 |
| 134 | Ga0105248_10022671 | 3300009177 | Bacteria | 6968 |
| 135 | Ga0105237_10014161 | 3300009545 | Bacteria | 8349 |
| 136 | Ga0105237_10090912 | 3300009545 | Bacteria | 3042 |
| 137 | Ga0105237_10106896 | 3300009545 | Bacteria | 2790 |
| 138 | Ga0105237_10110932 | 3300009545 | Bacteria | 2735 |
| 139 | Ga0105238_10009195 | 3300009551 | Bacteria | 9889 |
| 140 | Ga0105238_10023571 | 3300009551 | Bacteria | 6271 |
| 141 | Ga0105239_10008059 | 3300010375 | Bacteria | 12026 |
| 142 | Ga0105239_10077241 | 3300010375 | Bacteria | 3664 |
| 143 | Ga0105239_10093697 | 3300010375 | Bacteria | 3316 |
| 144 | Ga0105239_10154481 | 3300010375 | Bacteria | 2562 |
| 145 | Ga0105239_10175567 | 3300010375 | Bacteria | 2396 |
| 146 | Ga0105239_10282165 | 3300010375 | Bacteria | 1870 |
| 147 | Ga0105239_10455782 | 3300010375 | Bacteria | 1451 |
| 148 | Ga0105246_10230845 | 3300011119 | Bacteria | 1457 |
| 149 | Ga0105246_10375712 | 3300011119 | Bacteria | 1173 |
| 150 | Ga0157370_10039231 | 3300013104 | Bacteria | 4577 |
| 151 | Ga0157370_10095838 | 3300013104 | Bacteria | 2784 |
| 152 | Ga0157369_10026130 | 3300013105 | Bacteria | 6478 |
| 153 | Ga0157369_10251775 | 3300013105 | Bacteria | 1843 |
| 154 | Ga0157374_10350904 | 3300013296 | Bacteria | 1466 |
| 155 | Ga0157378_10067838 | 3300013297 | Bacteria | 3198 |
| 156 | Ga0163162_10051849 | 3300013306 | Bacteria | 4118 |
| 157 | Ga0163162_10483173 | 3300013306 | Bacteria | 1370 |
| 158 | Ga0157375_10130039 | 3300013308 | Bacteria | 2636 |
| 159 | Ga0157375_10373901 | 3300013308 | Bacteria | 1591 |
| 160 | Ga0157375_10499496 | 3300013308 | Bacteria | 1380 |
| 161 | Ga0163163_10043849 | 3300014325 | Bacteria | 4387 |
| 162 | Ga0157379_10065900 | 3300014968 | Bacteria | 3238 |
| 163 | Ga0157379_10198204 | 3300014968 | Bacteria | 1815 |
| 164 | Ga0157376_10012280 | 3300014969 | Bacteria | 6352 |
| 165 | Ga0157376_10089441 | 3300014969 | Bacteria | 2662 |
| 166 | Ga0163161_10088836 | 3300017792 | Bacteria | 2284 |
| 167 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 168 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 169 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 170 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 171 | Ga0213874_10015554 | 3300021377 | Bacteria | 2009 |
| 172 | Ga0213871_10002801 | 3300021441 | Bacteria | 3264 |
| 173 | Ga0209564_1001859 | 3300025295 | Bacteria | 19125 |
| 174 | Ga0209758_1009334 | 3300025297 | Bacteria | 6121 |
| 175 | Ga0209758_1011836 | 3300025297 | Bacteria | 4981 |
| 176 | Ga0207688_10020870 | 3300025901 | Bacteria | 3576 |
| 177 | Ga0207680_10132585 | 3300025903 | Bacteria | 1644 |
| 178 | Ga0207647_10000241 | 3300025904 | Bacteria | 44805 |
| 179 | Ga0207647_10023979 | 3300025904 | Bacteria | 4028 |
| 180 | Ga0207699_10004047 | 3300025906 | Bacteria | 7017 |
| 181 | Ga0207643_10094495 | 3300025908 | Bacteria | 1747 |
| 182 | Ga0207705_10234204 | 3300025909 | Bacteria | 1397 |
| 183 | Ga0207707_10008927 | 3300025912 | Bacteria | 8705 |
| 184 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 185 | Ga0207695_10047230 | 3300025913 | Bacteria | 4558 |
| 186 | Ga0207695_10074532 | 3300025913 | Bacteria | 3456 |
| 187 | Ga0207695_10101156 | 3300025913 | Bacteria | 2877 |
| 188 | Ga0207693_10027516 | 3300025915 | Bacteria | 4495 |
| 189 | Ga0207663_10046990 | 3300025916 | Bacteria | 2663 |
| 190 | Ga0207663_10075689 | 3300025916 | Bacteria | 2185 |
| 191 | Ga0207657_10014599 | 3300025919 | Bacteria | 7655 |
| 192 | Ga0207649_10223121 | 3300025920 | Bacteria | 1344 |
| 193 | Ga0207649_10273823 | 3300025920 | Bacteria | 1225 |
| 194 | Ga0207652_10008142 | 3300025921 | Bacteria | 8418 |
| 195 | Ga0207681_10407318 | 3300025923 | Bacteria | 1099 |
| 196 | Ga0207694_10030264 | 3300025924 | Bacteria | 4134 |
| 197 | Ga0207650_10336242 | 3300025925 | Bacteria | 1239 |
| 198 | Ga0207659_10306307 | 3300025926 | Bacteria | 1306 |
| 199 | Ga0207687_10011456 | 3300025927 | Bacteria | 5796 |
| 200 | Ga0207700_10090940 | 3300025928 | Bacteria | 2410 |
| 201 | Ga0207664_10414680 | 3300025929 | Bacteria | 1199 |
| 202 | Ga0207690_10093677 | 3300025932 | Bacteria | 2129 |
| 203 | Ga0207690_10197413 | 3300025932 | Bacteria | 1526 |
| 204 | Ga0207706_10022384 | 3300025933 | Bacteria | 5672 |
| 205 | Ga0207706_10061184 | 3300025933 | Bacteria | 3316 |
| 206 | Ga0207706_10218264 | 3300025933 | Bacteria | 1670 |
| 207 | Ga0207709_10039995 | 3300025935 | Bacteria | 2805 |
| 208 | Ga0207704_10079732 | 3300025938 | Bacteria | 2111 |
| 209 | Ga0207704_10144874 | 3300025938 | Bacteria | 1667 |
| 210 | Ga0207704_10148953 | 3300025938 | Bacteria | 1648 |
| 211 | Ga0207691_10113679 | 3300025940 | Bacteria | 2406 |
| 212 | Ga0207691_10194302 | 3300025940 | Bacteria | 1769 |
| 213 | Ga0207689_10018707 | 3300025942 | Bacteria | 5842 |
| 214 | Ga0207689_10043962 | 3300025942 | Bacteria | 3693 |
| 215 | Ga0207679_10046207 | 3300025945 | Bacteria | 3155 |
| 216 | Ga0207679_10355398 | 3300025945 | Bacteria | 1278 |
| 217 | Ga0207667_10089491 | 3300025949 | Bacteria | 3182 |
| 218 | Ga0207712_10147037 | 3300025961 | Bacteria | 1816 |
| 219 | Ga0207668_10025989 | 3300025972 | Bacteria | 3796 |
| 220 | Ga0207668_10103358 | 3300025972 | Bacteria | 2121 |
| 221 | Ga0207668_10289679 | 3300025972 | Bacteria | 1346 |
| 222 | Ga0207677_10067123 | 3300026023 | Bacteria | 2511 |
| 223 | Ga0207703_10218310 | 3300026035 | Bacteria | 1703 |
| 224 | Ga0207639_10105506 | 3300026041 | Bacteria | 2286 |
| 225 | Ga0207639_10256787 | 3300026041 | Bacteria | 1526 |
| 226 | Ga0207639_10283003 | 3300026041 | Bacteria | 1459 |
| 227 | Ga0207678_10002185 | 3300026067 | Bacteria | 17669 |
| 228 | Ga0207678_10157232 | 3300026067 | Bacteria | 1941 |
| 229 | Ga0207678_10181029 | 3300026067 | Bacteria | 1800 |
| 230 | Ga0207678_10276986 | 3300026067 | Bacteria | 1439 |
| 231 | Ga0207641_10681685 | 3300026088 | Bacteria | 1011 |
| 232 | Ga0207674_10068039 | 3300026116 | Bacteria | 3585 |
| 233 | Ga0207674_10104186 | 3300026116 | Bacteria | 2816 |
| 234 | Ga0207674_10145157 | 3300026116 | Bacteria | 2331 |
| 235 | Ga0207675_100026109 | 3300026118 | Bacteria | 5437 |
| 236 | Ga0207675_100034894 | 3300026118 | Bacteria | 4690 |
| 237 | Ga0207683_10051733 | 3300026121 | Bacteria | 3599 |
| 238 | Ga0207683_10082242 | 3300026121 | Bacteria | 2860 |
| 239 | Ga0207683_10225271 | 3300026121 | Bacteria | 1709 |
| 240 | Ga0207698_10055781 | 3300026142 | Bacteria | 3047 |
| 241 | Ga0207698_10148672 | 3300026142 | Bacteria | 2030 |
| 242 | Ga0207698_10354800 | 3300026142 | Bacteria | 1386 |
| 243 | Ga0207698_10399754 | 3300026142 | Bacteria | 1313 |
| 244 | Ga0209389_1000083 | 3300027296 | Bacteria | 88461 |
| 245 | Ga0209589_1000097 | 3300027357 | Bacteria | 88461 |
| 246 | Ga0209489_100105 | 3300027361 | Bacteria | 118979 |
| 247 | Ga0268266_10000519 | 3300028379 | Bacteria | 54346 |
| 248 | Ga0268266_10034062 | 3300028379 | Bacteria | 4330 |
| 249 | Ga0268266_10060931 | 3300028379 | Bacteria | 3253 |
| 250 | Ga0268266_10516093 | 3300028379 | Bacteria | 1142 |
| 251 | Ga0268265_10013905 | 3300028380 | Bacteria | 5478 |
| 252 | Ga0268264_10042871 | 3300028381 | Bacteria | 3747 |
| 253 | Ga0268264_10088591 | 3300028381 | Bacteria | 2664 |
| 254 | Ga0268264_10201015 | 3300028381 | Bacteria | 1823 |
| 255 | Ga0265334_10026828 | 3300028573 | Bacteria | 2323 |
| 256 | Ga0307515_10022211 | 3300028794 | Bacteria | 11193 |
| 257 | Ga0307515_10223403 | 3300028794 | Bacteria | 1695 |
| 258 | Ga0265330_10002705 | 3300031235 | Bacteria | 9571 |
| 259 | Ga0265330_10039751 | 3300031235 | Bacteria | 2089 |
| 260 | Ga0265330_10043019 | 3300031235 | Bacteria | 2000 |
| 261 | Ga0265332_10037682 | 3300031238 | Bacteria | 2096 |
| 262 | Ga0265340_10001835 | 3300031247 | Bacteria | 12142 |
| 263 | Ga0265331_10055600 | 3300031250 | Bacteria | 1882 |
| 264 | Ga0307509_10241021 | 3300031507 | Bacteria | 1601 |
| 265 | Ga0307508_10015229 | 3300031616 | Bacteria | 7008 |
| 266 | Ga0307508_10106518 | 3300031616 | Bacteria | 2402 |
| 267 | Ga0265314_10204251 | 3300031711 | Bacteria | 1165 |
| 268 | Ga0307412_10401242 | 3300031911 | Bacteria | 1116 |
| 269 | Ga0307411_10561008 | 3300032005 | Bacteria | 976 |
| 270 | Ga0307510_10041641 | 3300033180 | Bacteria | 5017 |
| 271 | Ga0307510_10132460 | 3300033180 | Bacteria | 2161 |
| 272 | Ga0373953_0089016 | 3300035117 | Bacteria | 1290 |
| 273 | Ga0373924_0018339 | 3300035410 | Bacteria | 2695 |
| 274 | Ga0373927_0052079 | 3300035695 | Bacteria | 2648 |
| 275 | Ga0373947_0302372 | 3300035725 | Bacteria | 1067 |
| 276 | Ga0373937_0463604 | 3300036401 | Bacteria | 1203 |
| 277 | Ga0373925_0249083 | 3300037068 | Bacteria | 1424 |
| 278 | Ga0395900_0107743 | 3300037418 | Bacteria | 2863 |
| 279 | Ga0395898_0204681 | 3300037466 | Bacteria | 1883 |
| 280 | Ga0395898_0812129 | 3300037466 | Bacteria | 875 |
| 281 | Ga0395905_0129738 | 3300037471 | Bacteria | 2371 |
| 282 | Ga0436364_0350531 | 3300037853 | Bacteria | 5930 |
| 283 | Ga0395901_0568965 | 3300038443 | Bacteria | 1146 |
| 284 | Ga0436365_1008789 | 3300039437 | Bacteria | 1230 |
| 285 | Ga0436365_1084521 | 3300039437 | Bacteria | 1095 |
| 286 | Ga0436360_0561872 | 3300039438 | Bacteria | 1934 |
| 287 | Ga0436360_0872836 | 3300039438 | Bacteria | 3724 |
| 288 | Ga0436361_0978240 | 3300039447 | Bacteria | 3630 |
| 289 | Ga0436363_0300553 | 3300039450 | Bacteria | 4994 |
| 290 | Ga0436362_0839238 | 3300039453 | Bacteria | 3422 |
| 291 | Ga0466972_0058478 | 3300044658 | Bacteria | 1851 |
| 292 | Ga0466963_0220525 | 3300044694 | Bacteria | 1328 |
| 293 | Ga0466970_0068050 | 3300044765 | Bacteria | 1913 |
| 294 | Ga0466957_0017412 | 3300044842 | Bacteria | 4208 |
| 295 | Ga0466959_0012080 | 3300045049 | Bacteria | 6231 |
| 296 | Ga0466967_0042506 | 3300045976 | Bacteria | 3928 |
| 297 | Ga0466967_0047439 | 3300045976 | Bacteria | 3745 |
| 298 | Ga0495617_014516 | 3300046452 | Bacteria | 2677 |
| 299 | Ga0495617_069073 | 3300046452 | Bacteria | 1162 |
| 300 | Ga0495603_0038657 | 3300046455 | Bacteria | 2861 |
| 301 | Ga0495590_0020864 | 3300046457 | Bacteria | 2325 |
| 302 | Ga0495638_0016825 | 3300046460 | Bacteria | 4889 |
| 303 | Ga0495638_0073036 | 3300046460 | Bacteria | 2094 |
| 304 | Ga0495641_0081943 | 3300046461 | Bacteria | 1445 |
| 305 | Ga0495651_0107839 | 3300046462 | Bacteria | 2063 |
| 306 | Ga0495605_0037001 | 3300046474 | Bacteria | 2458 |
| 307 | Ga0495662_0151121 | 3300046476 | Bacteria | 1144 |
| 308 | Ga0495664_0264218 | 3300046477 | Bacteria | 1040 |
| 309 | Ga0495585_0066597 | 3300046492 | Bacteria | 1972 |
| 310 | Ga0495594_0073696 | 3300046499 | Bacteria | 1901 |
| 311 | Ga0495596_0078923 | 3300046500 | Bacteria | 1278 |
| 312 | Ga0495596_0087876 | 3300046500 | Bacteria | 1206 |
| 313 | Ga0495607_0021535 | 3300046501 | Bacteria | 4055 |
| 314 | Ga0495632_0166876 | 3300046519 | Bacteria | 1012 |
| 315 | Ga0495637_0026429 | 3300046520 | Bacteria | 2606 |
| 316 | Ga0495648_0001062 | 3300046524 | Bacteria | 27872 |
| 317 | Ga0495598_0050970 | 3300046537 | Bacteria | 1246 |
| 318 | Ga0495621_0115318 | 3300046539 | Bacteria | 1034 |
| 319 | Ga0495622_0126806 | 3300046557 | Bacteria | 1164 |
| 320 | Ga0495667_0052845 | 3300046559 | Bacteria | 2676 |
| 321 | Ga0495656_0027037 | 3300046615 | Bacteria | 2289 |
| 322 | Ga0495625_0164488 | 3300046660 | Bacteria | 1484 |
| 323 | Ga0495659_0100451 | 3300046664 | Bacteria | 1120 |
| 324 | Ga0495599_0059415 | 3300046678 | Bacteria | 2392 |
| 325 | Ga0495670_0011640 | 3300046691 | Bacteria | 4329 |
| 326 | Ga0495670_0083699 | 3300046691 | Bacteria | 1627 |
| 327 | Ga0495600_0229069 | 3300046809 | Bacteria | 1187 |
| 328 | Ga0495581_0100442 | 3300047315 | Bacteria | 1681 |
| 329 | Ga0495672_0058324 | 3300047320 | Bacteria | 2238 |
| 330 | Ga0495676_0096883 | 3300047321 | Bacteria | 2192 |
| 331 | Ga0495677_0043534 | 3300047445 | Bacteria | 1646 |
| 332 | Ga0495681_0134695 | 3300047470 | Bacteria | 1049 |
| 333 | Ga0495684_0385043 | 3300047471 | Bacteria | 988 |
| 334 | Ga0495686_0004829 | 3300047472 | Bacteria | 10882 |
| 335 | Ga0495626_0085913 | 3300048091 | Bacteria | 1391 |
| 336 | Ga0496100_0065534 | 3300048903 | Bacteria | 2407 |
| 337 | Ga0496101_0194807 | 3300048904 | Bacteria | 1565 |
| 338 | Ga0496101_0254955 | 3300048904 | Bacteria | 1367 |
| 339 | Ga0496102_0006054 | 3300048905 | Bacteria | 10309 |
| 340 | Ga0496102_0086765 | 3300048905 | Bacteria | 2891 |
| 341 | Ga0496102_0236791 | 3300048905 | Bacteria | 1721 |
| 342 | Ga0496102_0432184 | 3300048905 | Bacteria | 1236 |
| 343 | Ga0496104_0004602 | 3300048907 | Bacteria | 12026 |
| 344 | Ga0496104_0005128 | 3300048907 | Bacteria | 11437 |
| 345 | Ga0496104_0299997 | 3300048907 | Bacteria | 1519 |
| 346 | Ga0496105_0004236 | 3300048908 | Bacteria | 10783 |
| 347 | Ga0496105_0082363 | 3300048908 | Bacteria | 2658 |
| 348 | Ga0496106_0000711 | 3300048909 | Bacteria | 23960 |
| 349 | Ga0496106_0004766 | 3300048909 | Bacteria | 10027 |
| 350 | Ga0496106_0043979 | 3300048909 | Bacteria | 3353 |
| 351 | Ga0496107_0001289 | 3300048910 | Bacteria | 15330 |
| 352 | Ga0496107_0043041 | 3300048910 | Bacteria | 3244 |
| 353 | Ga0496107_0166911 | 3300048910 | Bacteria | 1632 |
| 354 | Ga0496108_0002311 | 3300048911 | Bacteria | 15264 |
| 355 | Ga0496108_0002638 | 3300048911 | Bacteria | 14372 |
| 356 | Ga0496108_0015938 | 3300048911 | Bacteria | 6127 |
| 357 | Ga0496109_0000199 | 3300048912 | Bacteria | 59773 |
| 358 | Ga0496109_0061716 | 3300048912 | Bacteria | 3427 |
| 359 | Ga0496109_0209708 | 3300048912 | Bacteria | 1832 |
| 360 | Ga0496109_0316017 | 3300048912 | Bacteria | 1474 |
| 361 | Ga0496110_0006468 | 3300048913 | Bacteria | 9285 |
| 362 | Ga0496110_0012653 | 3300048913 | Bacteria | 6943 |
| 363 | Ga0496110_0047003 | 3300048913 | Bacteria | 3777 |
| 364 | Ga0496110_0220451 | 3300048913 | Bacteria | 1725 |
| 365 | Ga0496112_0001162 | 3300048915 | Bacteria | 19679 |
| 366 | Ga0496112_0036409 | 3300048915 | Bacteria | 4801 |
| 367 | Ga0496112_0050178 | 3300048915 | Bacteria | 4091 |
| 368 | Ga0496113_0077821 | 3300048916 | Bacteria | 2537 |
| 369 | Ga0496114_0116723 | 3300048917 | Bacteria | 2292 |
| 370 | Ga0496114_0307068 | 3300048917 | Bacteria | 1401 |
| 371 | Ga0496115_0011470 | 3300048918 | Bacteria | 6645 |
| 372 | Ga0496115_0036128 | 3300048918 | Bacteria | 3911 |
| 373 | Ga0496115_0051481 | 3300048918 | Bacteria | 3302 |
| 374 | Ga0496116_0008464 | 3300048919 | Bacteria | 8917 |
| 375 | Ga0496117_0129873 | 3300048920 | Bacteria | 1529 |
| 376 | Ga0496118_0122894 | 3300048921 | Bacteria | 1687 |
| 377 | Ga0496120_0139559 | 3300048923 | Bacteria | 1232 |
| 378 | Ga0496121_0010221 | 3300048924 | Bacteria | 10624 |
| 379 | Ga0496121_0025787 | 3300048924 | Bacteria | 5563 |
| 380 | Ga0496121_0040809 | 3300048924 | Bacteria | 4066 |
| 381 | Ga0496121_0068945 | 3300048924 | Bacteria | 2858 |
| 382 | Ga0496121_0069924 | 3300048924 | Bacteria | 2830 |
| 383 | Ga0496121_0130152 | 3300048924 | Bacteria | 1885 |
| 384 | Ga0496121_0235847 | 3300048924 | Bacteria | 1278 |
| 385 | Ga0496122_0018566 | 3300048925 | Bacteria | 6414 |
| 386 | Ga0496122_0126518 | 3300048925 | Bacteria | 1634 |
| 387 | Ga0496123_0021074 | 3300048926 | Bacteria | 5078 |
| 388 | Ga0496123_0044387 | 3300048926 | Bacteria | 3040 |
| 389 | Ga0496124_0138572 | 3300048927 | Bacteria | 1923 |
| 390 | Ga0496125_0000202 | 3300048928 | Bacteria | 125963 |
| 391 | Ga0496125_0007880 | 3300048928 | Bacteria | 11249 |
| 392 | Ga0496125_0064216 | 3300048928 | Bacteria | 2919 |
| 393 | Ga0496125_0069626 | 3300048928 | Bacteria | 2759 |
| 394 | Ga0496126_0002882 | 3300048929 | Bacteria | 22445 |
| 395 | Ga0496126_0043094 | 3300048929 | Bacteria | 4166 |
| 396 | Ga0496126_0047285 | 3300048929 | Bacteria | 3940 |
| 397 | Ga0496126_0135855 | 3300048929 | Bacteria | 2121 |
| 398 | Ga0496126_0186116 | 3300048929 | Bacteria | 1761 |
| 399 | Ga0496126_0249555 | 3300048929 | Bacteria | 1479 |
| 400 | Ga0501031_0043832 | 3300049568 | Bacteria | 2919 |
| 401 | Ga0501033_0360288 | 3300049570 | Bacteria | 1018 |
| 402 | Ga0501038_0049739 | 3300049574 | Bacteria | 3624 |
| 403 | Ga0501046_0193212 | 3300049580 | Bacteria | 1517 |
| 404 | Ga0501047_0103136 | 3300049581 | Bacteria | 2732 |
| 405 | Ga0501047_0379285 | 3300049581 | Bacteria | 1248 |
| 406 | Ga0501067_0068917 | 3300049583 | Bacteria | 1959 |
| 407 | Ga0501070_0008301 | 3300049586 | Bacteria | 8777 |
| 408 | Ga0501070_0041853 | 3300049586 | Bacteria | 3815 |
| 409 | Ga0501074_0085507 | 3300049590 | Bacteria | 2260 |
| 410 | Ga0501080_0121480 | 3300049742 | Bacteria | 2420 |
| 411 | Ga0501035_0030449 | 3300049822 | Bacteria | 4919 |
| 412 | Ga0501044_0070899 | 3300049823 | Bacteria | 3544 |
| 413 | Ga0501044_0236711 | 3300049823 | Bacteria | 1771 |
| 414 | nmdc:mga03n38_113375_c1 | 3300050490 | Bacteria | 1323 |
| 415 | nmdc:mga00v17_10118_c1 | 3300050491 | Bacteria | 5139 |
| 416 | nmdc:mga00v17_4318_c1 | 3300050491 | Bacteria | 7381 |
| 417 | nmdc:mga0yw44_13187_c1 | 3300050492 | Bacteria | 4015 |
| 418 | nmdc:mga06z11_288915_c1 | 3300050494 | Bacteria | 973 |
| 419 | nmdc:mga06z11_6494_c1 | 3300050494 | Bacteria | 4763 |
| 420 | nmdc:mga04h51_123446_c1 | 3300050495 | Bacteria | 967 |
| 421 | nmdc:mga07m45_16975_c1 | 3300050496 | Bacteria | 3903 |
| 422 | nmdc:mga07m45_49555_c1 | 3300050496 | Bacteria | 2364 |
| 423 | nmdc:mga08y16_88450_c1 | 3300050511 | Bacteria | 3228 |
| 424 | nmdc:mga0n895_157074_c1 | 3300050512 | Bacteria | 2305 |
| 425 | nmdc:mga0n895_239981_c1 | 3300050512 | Bacteria | 1839 |
| 426 | Ga0500635_0030255 | 3300053080 | Bacteria | 1744 |
| 427 | Ga0500643_045547 | 3300053087 | Bacteria | 1270 |
| 428 | Ga0500581_008974 | 3300053089 | Bacteria | 4837 |
| 429 | Ga0500651_0026121 | 3300053093 | Bacteria | 3667 |
| 430 | Ga0500651_0091081 | 3300053093 | Bacteria | 1877 |
| 431 | Ga0500566_0003241 | 3300053094 | Bacteria | 9731 |
| 432 | Ga0500566_0006566 | 3300053094 | Bacteria | 6894 |
| 433 | Ga0500641_0028899 | 3300053096 | Bacteria | 2168 |
| 434 | Ga0500648_104648 | 3300053097 | Bacteria | 1570 |
| 435 | Ga0500650_0001750 | 3300053098 | Bacteria | 6754 |
| 436 | Ga0500554_009463 | 3300053102 | Bacteria | 2334 |
| 437 | Ga0500554_010368 | 3300053102 | Bacteria | 2268 |
| 438 | Ga0500556_0000011 | 3300053104 | Bacteria | 253393 |
| 439 | Ga0500562_033346 | 3300053108 | Bacteria | 1360 |
| 440 | Ga0500562_060258 | 3300053108 | Bacteria | 1019 |
| 441 | Ga0500569_003519 | 3300053109 | Bacteria | 3209 |
| 442 | Ga0500572_000429 | 3300053111 | Bacteria | 14783 |
| 443 | Ga0500591_059693 | 3300053115 | Bacteria | 1762 |
| 444 | Ga0500595_010192 | 3300053119 | Bacteria | 3745 |
| 445 | Ga0500595_017224 | 3300053119 | Bacteria | 2672 |
| 446 | Ga0500608_010156 | 3300053122 | Bacteria | 4031 |
| 447 | Ga0500614_042497 | 3300053123 | Bacteria | 1161 |
| 448 | Ga0500642_0000030 | 3300053130 | Bacteria | 115114 |
| 449 | Ga0500652_001175 | 3300053131 | Bacteria | 8356 |
| 450 | Ga0500559_0000272 | 3300053136 | Bacteria | 40384 |
| 451 | Ga0500559_0009412 | 3300053136 | Bacteria | 4229 |
| 452 | Ga0500561_0045485 | 3300053137 | Bacteria | 1177 |
| 453 | Ga0500568_0003414 | 3300053139 | Bacteria | 8863 |
| 454 | Ga0500577_0000137 | 3300053142 | Bacteria | 17738 |
| 455 | Ga0500586_004716 | 3300053145 | Bacteria | 3378 |
| 456 | Ga0500603_000241 | 3300053150 | Bacteria | 14295 |
| 457 | Ga0500603_003006 | 3300053150 | Bacteria | 3638 |
| 458 | Ga0500604_0000888 | 3300053151 | Bacteria | 8260 |
| 459 | Ga0500616_0000026 | 3300053153 | Bacteria | 454314 |
| 460 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 461 | Ga0500622_0006554 | 3300053156 | Bacteria | 6722 |
| 462 | Ga0500627_0020750 | 3300053158 | Bacteria | 2639 |
| 463 | Ga0500630_003701 | 3300053159 | Bacteria | 7421 |
| 464 | Ga0500633_0034335 | 3300053160 | Bacteria | 1663 |
| 465 | Ga0500634_0058771 | 3300053161 | Bacteria | 2047 |
| 466 | Ga0500639_000076 | 3300053163 | Bacteria | 45936 |
| 467 | Ga0500637_0000449 | 3300053178 | Bacteria | 15821 |
| 468 | Ga0500645_083513 | 3300053730 | Bacteria | 910 |
| 469 | Ga0500609_005796 | 3300053731 | Bacteria | 1689 |
| 470 | Ga0500596_000689 | 3300053735 | Bacteria | 6581 |
| 471 | Ga0500601_002532 | 3300053737 | Bacteria | 1958 |
| 472 | Ga0500661_000404 | 3300055283 | Bacteria | 7983 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047321 | Ga0495676_0096883 | Ga0495676_0096883_20_799 | 204 |
| 2 | 3300050512 | nmdc:mga0n895_157074_c1 | nmdc:mga0n895_157074_c1_1537_2289 | 212 |
| 3 | 3300005530 | Ga0070679_100655314 | Ga0070679_1006553141 | 213 |
| 4 | 3300003215 | JGI25153J46596_10039982 | JGI25153J46596_100399822 | 216 |
| 5 | 3300025297 | Ga0209758_1009334 | Ga0209758_10093344 | 216 |
| 6 | 3300005366 | Ga0070659_100215172 | Ga0070659_1002151722 | 219 |
| 7 | 3300005539 | Ga0068853_100068160 | Ga0068853_1000681605 | 219 |
| 8 | 3300037466 | Ga0395898_0812129 | Ga0395898_0812129_35_814 | 219 |
| 9 | 3300050494 | nmdc:mga06z11_288915_c1 | nmdc:mga06z11_288915_c1_135_962 | 219 |
| 10 | 3300048921 | Ga0496118_0122894 | Ga0496118_0122894_30_809 | 221 |
| 11 | 3300025904 | Ga0207647_10023979 | Ga0207647_100239792 | 223 |
| 12 | 3300005347 | Ga0070668_100154419 | Ga0070668_1001544192 | 231 |
| 13 | 3300005455 | Ga0070663_100250412 | Ga0070663_1002504122 | 231 |
| 14 | 3300006178 | Ga0075367_10053817 | Ga0075367_100538172 | 231 |
| 15 | 3300006353 | Ga0075370_10011867 | Ga0075370_100118671 | 231 |
| 16 | 3300005617 | Ga0068859_100051481 | Ga0068859_1000514815 | 233 |
| 17 | 3300005843 | Ga0068860_100091348 | Ga0068860_1000913482 | 233 |
| 18 | 3300005844 | Ga0068862_100078109 | Ga0068862_1000781093 | 233 |
| 19 | 3300006931 | Ga0097620_100051481 | Ga0097620_1000514812 | 233 |
| 20 | 3300025942 | Ga0207689_10018707 | Ga0207689_100187073 | 234 |
| 21 | 3300028381 | Ga0268264_10042871 | Ga0268264_100428712 | 234 |
| 22 | 3300048924 | Ga0496121_0130152 | Ga0496121_0130152_935_1816 | 234 |
| 23 | 3300048910 | Ga0496107_0043041 | Ga0496107_0043041_1503_2402 | 236 |
| 24 | 3300048911 | Ga0496108_0015938 | Ga0496108_0015938_2747_3646 | 236 |
| 25 | 3300050491 | nmdc:mga00v17_10118_c1 | nmdc:mga00v17_10118_c1_2456_3355 | 236 |
| 26 | 3300009098 | Ga0105245_10472345 | Ga0105245_104723451 | 238 |
| 27 | 3300009176 | Ga0105242_10191096 | Ga0105242_101910961 | 238 |
| 28 | 3300009177 | Ga0105248_10022671 | Ga0105248_100226713 | 238 |
| 29 | 3300009545 | Ga0105237_10090912 | Ga0105237_100909123 | 238 |
| 30 | 3300010375 | Ga0105239_10093697 | Ga0105239_100936973 | 238 |
| 31 | 3300014968 | Ga0157379_10065900 | Ga0157379_100659002 | 238 |
| 32 | 3300014969 | Ga0157376_10089441 | Ga0157376_100894413 | 238 |
| 33 | 3300048915 | Ga0496112_0050178 | Ga0496112_0050178_1077_1976 | 238 |
| 34 | 3300048916 | Ga0496113_0077821 | Ga0496113_0077821_1309_2208 | 238 |
| 35 | 3300050512 | nmdc:mga0n895_239981_c1 | nmdc:mga0n895_239981_c1_338_1237 | 238 |
| 36 | 3300053119 | Ga0500595_010192 | Ga0500595_010192_2821_3708 | 239 |
| 37 | 3300005347 | Ga0070668_100060403 | Ga0070668_1000604033 | 240 |
| 38 | 3300005354 | Ga0070675_100120270 | Ga0070675_1001202703 | 240 |
| 39 | 3300005458 | Ga0070681_10172223 | Ga0070681_101722232 | 240 |
| 40 | 3300005840 | Ga0068870_10009958 | Ga0068870_100099583 | 240 |
| 41 | 3300005844 | Ga0068862_100030852 | Ga0068862_1000308523 | 240 |
| 42 | 3300006881 | Ga0068865_100130119 | Ga0068865_1001301193 | 240 |
| 43 | 3300003203 | JGI25406J46586_10000022 | JGI25406J46586_1000002247 | 241 |
| 44 | 3300005353 | Ga0070669_100244156 | Ga0070669_1002441561 | 241 |
| 45 | 3300005719 | Ga0068861_100028571 | Ga0068861_1000285715 | 241 |
| 46 | 3300005985 | Ga0081539_10000172 | Ga0081539_1000017254 | 241 |
| 47 | 3300006051 | Ga0075364_10057141 | Ga0075364_100571412 | 241 |
| 48 | 3300006186 | Ga0075369_10008562 | Ga0075369_100085623 | 241 |
| 49 | 3300009094 | Ga0111539_10010306 | Ga0111539_100103067 | 241 |
| 50 | 3300013308 | Ga0157375_10373901 | Ga0157375_103739012 | 241 |
| 51 | 3300025908 | Ga0207643_10094495 | Ga0207643_100944952 | 241 |
| 52 | 3300025923 | Ga0207681_10407318 | Ga0207681_104073181 | 241 |
| 53 | 3300025926 | Ga0207659_10306307 | Ga0207659_103063072 | 241 |
| 54 | 3300025933 | Ga0207706_10022384 | Ga0207706_100223842 | 241 |
| 55 | 3300025935 | Ga0207709_10039995 | Ga0207709_100399953 | 241 |
| 56 | 3300025938 | Ga0207704_10079732 | Ga0207704_100797322 | 241 |
| 57 | 3300025940 | Ga0207691_10113679 | Ga0207691_101136793 | 241 |
| 58 | 3300025972 | Ga0207668_10103358 | Ga0207668_101033583 | 241 |
| 59 | 3300025972 | Ga0207668_10289679 | Ga0207668_102896792 | 241 |
| 60 | 3300026118 | Ga0207675_100026109 | Ga0207675_1000261092 | 241 |
| 61 | 3300026121 | Ga0207683_10225271 | Ga0207683_102252712 | 241 |
| 62 | 3300028380 | Ga0268265_10013905 | Ga0268265_100139053 | 241 |
| 63 | 3300028381 | Ga0268264_10201015 | Ga0268264_102010152 | 241 |
| 64 | 3300028794 | Ga0307515_10223403 | Ga0307515_102234032 | 241 |
| 65 | 3300048919 | Ga0496116_0008464 | Ga0496116_0008464_5335_6222 | 241 |
| 66 | 3300048920 | Ga0496117_0129873 | Ga0496117_0129873_401_1288 | 241 |
| 67 | 3300048924 | Ga0496121_0025787 | Ga0496121_0025787_61_948 | 241 |
| 68 | 3300048925 | Ga0496122_0126518 | Ga0496122_0126518_591_1478 | 241 |
| 69 | 3300048928 | Ga0496125_0064216 | Ga0496125_0064216_1307_2194 | 241 |
| 70 | 3300048929 | Ga0496126_0002882 | Ga0496126_0002882_10363_11241 | 241 |
| 71 | 3300048929 | Ga0496126_0043094 | Ga0496126_0043094_2920_3795 | 241 |
| 72 | 3300050491 | nmdc:mga00v17_4318_c1 | nmdc:mga00v17_4318_c1_644_1531 | 241 |
| 73 | 3300050511 | nmdc:mga08y16_88450_c1 | nmdc:mga08y16_88450_c1_1171_2049 | 241 |
| 74 | 3300053104 | Ga0500556_0000011 | Ga0500556_0000011_217686_218573 | 241 |
| 75 | 3300005335 | Ga0070666_10113905 | Ga0070666_101139052 | 242 |
| 76 | 3300005466 | Ga0070685_10145761 | Ga0070685_101457612 | 242 |
| 77 | 3300005548 | Ga0070665_100132035 | Ga0070665_1001320352 | 242 |
| 78 | 3300005617 | Ga0068859_100321040 | Ga0068859_1003210402 | 242 |
| 79 | 3300005843 | Ga0068860_100659481 | Ga0068860_1006594811 | 242 |
| 80 | 3300006931 | Ga0097620_100321036 | Ga0097620_1003210362 | 242 |
| 81 | 3300025903 | Ga0207680_10132585 | Ga0207680_101325852 | 242 |
| 82 | 3300025925 | Ga0207650_10336242 | Ga0207650_103362421 | 242 |
| 83 | 3300026035 | Ga0207703_10218310 | Ga0207703_102183102 | 242 |
| 84 | 3300028379 | Ga0268266_10000519 | Ga0268266_100005199 | 242 |
| 85 | 3300028381 | Ga0268264_10088591 | Ga0268264_100885912 | 242 |
| 86 | 3300046452 | Ga0495617_014516 | Ga0495617_014516_1726_2619 | 242 |
| 87 | 3300046461 | Ga0495641_0081943 | Ga0495641_0081943_499_1392 | 242 |
| 88 | 3300046691 | Ga0495670_0083699 | Ga0495670_0083699_310_1188 | 242 |
| 89 | 3300053160 | Ga0500633_0034335 | Ga0500633_0034335_54_947 | 242 |
| 90 | 3300005616 | Ga0068852_100372410 | Ga0068852_1003724102 | 243 |
| 91 | 3300009093 | Ga0105240_10298194 | Ga0105240_102981942 | 243 |
| 92 | 3300013104 | Ga0157370_10039231 | Ga0157370_100392311 | 243 |
| 93 | 3300013105 | Ga0157369_10251775 | Ga0157369_102517751 | 243 |
| 94 | 3300013308 | Ga0157375_10499496 | Ga0157375_104994961 | 243 |
| 95 | 3300025913 | Ga0207695_10047230 | Ga0207695_100472301 | 243 |
| 96 | 3300026121 | Ga0207683_10051733 | Ga0207683_100517333 | 243 |
| 97 | 3300026142 | Ga0207698_10399754 | Ga0207698_103997541 | 243 |
| 98 | 3300031235 | Ga0265330_10002705 | Ga0265330_100027053 | 243 |
| 99 | 3300031247 | Ga0265340_10001835 | Ga0265340_100018355 | 243 |
| 100 | 3300031911 | Ga0307412_10401242 | Ga0307412_104012421 | 243 |
| 101 | 3300033180 | Ga0307510_10041641 | Ga0307510_100416413 | 243 |
| 102 | 3300037466 | Ga0395898_0204681 | Ga0395898_0204681_940_1845 | 243 |
| 103 | 3300038443 | Ga0395901_0568965 | Ga0395901_0568965_148_1053 | 243 |
| 104 | 3300046460 | Ga0495638_0073036 | Ga0495638_0073036_452_1345 | 243 |
| 105 | 3300046660 | Ga0495625_0164488 | Ga0495625_0164488_337_1230 | 243 |
| 106 | 3300048091 | Ga0495626_0085913 | Ga0495626_0085913_406_1284 | 243 |
| 107 | 3300048929 | Ga0496126_0186116 | Ga0496126_0186116_841_1728 | 243 |
| 108 | 3300053145 | Ga0500586_004716 | Ga0500586_004716_412_1308 | 243 |
| 109 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_174134_175003 | 243 |
| 110 | 3300005844 | Ga0068862_100458088 | Ga0068862_1004580881 | 244 |
| 111 | 3300005937 | Ga0081455_10067418 | Ga0081455_100674182 | 244 |
| 112 | 3300006353 | Ga0075370_10099098 | Ga0075370_100990981 | 244 |
| 113 | 3300031616 | Ga0307508_10015229 | Ga0307508_100152292 | 244 |
| 114 | 3300046452 | Ga0495617_069073 | Ga0495617_069073_89_973 | 244 |
| 115 | 3300046500 | Ga0495596_0087876 | Ga0495596_0087876_106_999 | 244 |
| 116 | 3300046519 | Ga0495632_0166876 | Ga0495632_0166876_10_903 | 244 |
| 117 | 3300047470 | Ga0495681_0134695 | Ga0495681_0134695_31_924 | 244 |
| 118 | 3300053093 | Ga0500651_0091081 | Ga0500651_0091081_259_1137 | 244 |
| 119 | 3300053108 | Ga0500562_033346 | Ga0500562_033346_117_995 | 244 |
| 120 | 3300053161 | Ga0500634_0058771 | Ga0500634_0058771_941_1819 | 244 |
| 121 | 3300053731 | Ga0500609_005796 | Ga0500609_005796_25_903 | 244 |
| 122 | 3300005347 | Ga0070668_100298536 | Ga0070668_1002985361 | 245 |
| 123 | 3300005355 | Ga0070671_100064182 | Ga0070671_1000641823 | 245 |
| 124 | 3300005364 | Ga0070673_100238526 | Ga0070673_1002385262 | 245 |
| 125 | 3300005367 | Ga0070667_100184008 | Ga0070667_1001840082 | 245 |
| 126 | 3300005455 | Ga0070663_100040125 | Ga0070663_1000401253 | 245 |
| 127 | 3300005457 | Ga0070662_100081310 | Ga0070662_1000813102 | 245 |
| 128 | 3300005471 | Ga0070698_100083435 | Ga0070698_1000834353 | 245 |
| 129 | 3300005544 | Ga0070686_100224390 | Ga0070686_1002243901 | 245 |
| 130 | 3300005545 | Ga0070695_100087857 | Ga0070695_1000878573 | 245 |
| 131 | 3300005615 | Ga0070702_100346537 | Ga0070702_1003465371 | 245 |
| 132 | 3300005719 | Ga0068861_100057268 | Ga0068861_1000572682 | 245 |
| 133 | 3300005843 | Ga0068860_100011349 | Ga0068860_1000113492 | 245 |
| 134 | 3300006881 | Ga0068865_100014151 | Ga0068865_1000141512 | 245 |
| 135 | 3300009148 | Ga0105243_10076554 | Ga0105243_100765541 | 245 |
| 136 | 3300010375 | Ga0105239_10455782 | Ga0105239_104557822 | 245 |
| 137 | 3300017792 | Ga0163161_10088836 | Ga0163161_100888363 | 245 |
| 138 | 3300025933 | Ga0207706_10061184 | Ga0207706_100611843 | 245 |
| 139 | 3300025938 | Ga0207704_10148953 | Ga0207704_101489532 | 245 |
| 140 | 3300025942 | Ga0207689_10043962 | Ga0207689_100439622 | 245 |
| 141 | 3300025961 | Ga0207712_10147037 | Ga0207712_101470372 | 245 |
| 142 | 3300025972 | Ga0207668_10025989 | Ga0207668_100259892 | 245 |
| 143 | 3300026118 | Ga0207675_100034894 | Ga0207675_1000348942 | 245 |
| 144 | 3300037418 | Ga0395900_0107743 | Ga0395900_0107743_1542_2390 | 245 |
| 145 | 3300046457 | Ga0495590_0020864 | Ga0495590_0020864_751_1629 | 245 |
| 146 | 3300046474 | Ga0495605_0037001 | Ga0495605_0037001_40_918 | 245 |
| 147 | 3300046492 | Ga0495585_0066597 | Ga0495585_0066597_529_1407 | 245 |
| 148 | 3300046500 | Ga0495596_0078923 | Ga0495596_0078923_45_923 | 245 |
| 149 | 3300046539 | Ga0495621_0115318 | Ga0495621_0115318_68_946 | 245 |
| 150 | 3300046615 | Ga0495656_0027037 | Ga0495656_0027037_1075_1953 | 245 |
| 151 | 3300047445 | Ga0495677_0043534 | Ga0495677_0043534_463_1341 | 245 |
| 152 | 3300048905 | Ga0496102_0236791 | Ga0496102_0236791_613_1491 | 245 |
| 153 | 3300048923 | Ga0496120_0139559 | Ga0496120_0139559_325_1209 | 245 |
| 154 | 3300048924 | Ga0496121_0235847 | Ga0496121_0235847_331_1209 | 245 |
| 155 | 3300048927 | Ga0496124_0138572 | Ga0496124_0138572_867_1745 | 245 |
| 156 | 3300050490 | nmdc:mga03n38_113375_c1 | nmdc:mga03n38_113375_c1_195_1073 | 245 |
| 157 | 3300050496 | nmdc:mga07m45_49555_c1 | nmdc:mga07m45_49555_c1_247_1125 | 245 |
| 158 | 3300053130 | Ga0500642_0000030 | Ga0500642_0000030_64499_65386 | 245 |
| 159 | 3300053137 | Ga0500561_0045485 | Ga0500561_0045485_195_1073 | 245 |
| 160 | 3300053153 | Ga0500616_0000026 | Ga0500616_0000026_128319_129206 | 245 |
| 161 | 3300005338 | Ga0068868_100078846 | Ga0068868_1000788461 | 246 |
| 162 | 3300005455 | Ga0070663_100003769 | Ga0070663_1000037692 | 246 |
| 163 | 3300005937 | Ga0081455_10302620 | Ga0081455_103026201 | 246 |
| 164 | 3300028794 | Ga0307515_10022211 | Ga0307515_100222112 | 246 |
| 165 | 3300046664 | Ga0495659_0100451 | Ga0495659_0100451_176_1060 | 246 |
| 166 | 3300053131 | Ga0500652_001175 | Ga0500652_001175_7131_8021 | 246 |
| 167 | 3300005364 | Ga0070673_100600535 | Ga0070673_1006005351 | 247 |
| 168 | 3300005445 | Ga0070708_100243206 | Ga0070708_1002432061 | 247 |
| 169 | 3300005467 | Ga0070706_100287173 | Ga0070706_1002871732 | 247 |
| 170 | 3300005471 | Ga0070698_100317043 | Ga0070698_1003170432 | 247 |
| 171 | 3300026023 | Ga0207677_10067123 | Ga0207677_100671232 | 247 |
| 172 | 3300031711 | Ga0265314_10204251 | Ga0265314_102042511 | 247 |
| 173 | 3300048924 | Ga0496121_0010221 | Ga0496121_0010221_8628_9524 | 247 |
| 174 | 3300050494 | nmdc:mga06z11_6494_c1 | nmdc:mga06z11_6494_c1_2075_2959 | 247 |
| 175 | 3300050495 | nmdc:mga04h51_123446_c1 | nmdc:mga04h51_123446_c1_19_903 | 247 |
| 176 | 3300053737 | Ga0500601_002532 | Ga0500601_002532_147_1121 | 247 |
| 177 | 3300005444 | Ga0070694_100055074 | Ga0070694_1000550742 | 248 |
| 178 | 3300048903 | Ga0496100_0065534 | Ga0496100_0065534_810_1691 | 248 |
| 179 | 3300048912 | Ga0496109_0316017 | Ga0496109_0316017_241_1110 | 248 |
| 180 | 3300048913 | Ga0496110_0220451 | Ga0496110_0220451_637_1506 | 248 |
| 181 | 3300005354 | Ga0070675_100351008 | Ga0070675_1003510081 | 249 |
| 182 | 3300005441 | Ga0070700_100163246 | Ga0070700_1001632462 | 249 |
| 183 | 3300025940 | Ga0207691_10194302 | Ga0207691_101943022 | 249 |
| 184 | 3300026067 | Ga0207678_10181029 | Ga0207678_101810292 | 249 |
| 185 | 3300032005 | Ga0307411_10561008 | Ga0307411_105610081 | 249 |
| 186 | 3300053094 | Ga0500566_0006566 | Ga0500566_0006566_5757_6731 | 249 |
| 187 | 3300053102 | Ga0500554_009463 | Ga0500554_009463_1322_2197 | 249 |
| 188 | 3300053111 | Ga0500572_000429 | Ga0500572_000429_9149_10123 | 249 |
| 189 | 3300053115 | Ga0500591_059693 | Ga0500591_059693_151_1125 | 249 |
| 190 | 3300053122 | Ga0500608_010156 | Ga0500608_010156_1220_2194 | 249 |
| 191 | 3300053123 | Ga0500614_042497 | Ga0500614_042497_44_1018 | 249 |
| 192 | 3300053136 | Ga0500559_0009412 | Ga0500559_0009412_1994_2968 | 249 |
| 193 | 3300053150 | Ga0500603_000241 | Ga0500603_000241_8536_9510 | 249 |
| 194 | 3300053159 | Ga0500630_003701 | Ga0500630_003701_4391_5365 | 249 |
| 195 | 3300053163 | Ga0500639_000076 | Ga0500639_000076_4764_5738 | 249 |
| 196 | 3300053730 | Ga0500645_083513 | Ga0500645_083513_69_893 | 249 |
| 197 | 3300053735 | Ga0500596_000689 | Ga0500596_000689_2319_3293 | 249 |
| 198 | 3300055283 | Ga0500661_000404 | Ga0500661_000404_4803_5678 | 249 |
| 199 | 3300005327 | Ga0070658_10066416 | Ga0070658_100664162 | 250 |
| 200 | 3300005535 | Ga0070684_100048283 | Ga0070684_1000482834 | 250 |
| 201 | 3300005539 | Ga0068853_100109748 | Ga0068853_1001097484 | 250 |
| 202 | 3300005548 | Ga0070665_100047511 | Ga0070665_1000475113 | 250 |
| 203 | 3300005563 | Ga0068855_100037802 | Ga0068855_1000378026 | 250 |
| 204 | 3300005618 | Ga0068864_100032278 | Ga0068864_1000322783 | 250 |
| 205 | 3300005841 | Ga0068863_100708512 | Ga0068863_1007085121 | 250 |
| 206 | 3300005937 | Ga0081455_10005273 | Ga0081455_100052738 | 250 |
| 207 | 3300005983 | Ga0081540_1030499 | Ga0081540_10304992 | 250 |
| 208 | 3300009093 | Ga0105240_10112264 | Ga0105240_101122642 | 250 |
| 209 | 3300009098 | Ga0105245_10003690 | Ga0105245_100036906 | 250 |
| 210 | 3300010375 | Ga0105239_10175567 | Ga0105239_101755672 | 250 |
| 211 | 3300013297 | Ga0157378_10067838 | Ga0157378_100678384 | 250 |
| 212 | 3300013306 | Ga0163162_10051849 | Ga0163162_100518492 | 250 |
| 213 | 3300013308 | Ga0157375_10130039 | Ga0157375_101300392 | 250 |
| 214 | 3300014325 | Ga0163163_10043849 | Ga0163163_100438492 | 250 |
| 215 | 3300014969 | Ga0157376_10012280 | Ga0157376_100122802 | 250 |
| 216 | 3300025901 | Ga0207688_10020870 | Ga0207688_100208702 | 250 |
| 217 | 3300025927 | Ga0207687_10011456 | Ga0207687_100114562 | 250 |
| 218 | 3300025938 | Ga0207704_10144874 | Ga0207704_101448742 | 250 |
| 219 | 3300025945 | Ga0207679_10046207 | Ga0207679_100462072 | 250 |
| 220 | 3300026041 | Ga0207639_10256787 | Ga0207639_102567872 | 250 |
| 221 | 3300026088 | Ga0207641_10681685 | Ga0207641_106816851 | 250 |
| 222 | 3300026121 | Ga0207683_10082242 | Ga0207683_100822424 | 250 |
| 223 | 3300028379 | Ga0268266_10034062 | Ga0268266_100340622 | 250 |
| 224 | 3300039447 | Ga0436361_0978240 | Ga0436361_0978240_1353_2234 | 250 |
| 225 | 3300047315 | Ga0495581_0100442 | Ga0495581_0100442_341_1234 | 250 |
| 226 | 3300048904 | Ga0496101_0254955 | Ga0496101_0254955_208_1092 | 250 |
| 227 | 3300048905 | Ga0496102_0006054 | Ga0496102_0006054_64_948 | 250 |
| 228 | 3300048907 | Ga0496104_0005128 | Ga0496104_0005128_9059_9943 | 250 |
| 229 | 3300048908 | Ga0496105_0004236 | Ga0496105_0004236_8322_9206 | 250 |
| 230 | 3300048909 | Ga0496106_0000711 | Ga0496106_0000711_18978_19862 | 250 |
| 231 | 3300048910 | Ga0496107_0001289 | Ga0496107_0001289_9412_10296 | 250 |
| 232 | 3300048911 | Ga0496108_0002638 | Ga0496108_0002638_10126_11010 | 250 |
| 233 | 3300048912 | Ga0496109_0061716 | Ga0496109_0061716_1741_2625 | 250 |
| 234 | 3300048913 | Ga0496110_0047003 | Ga0496110_0047003_1497_2381 | 250 |
| 235 | 3300048918 | Ga0496115_0011470 | Ga0496115_0011470_1752_2636 | 250 |
| 236 | 3300048924 | Ga0496121_0040809 | Ga0496121_0040809_2046_2945 | 250 |
| 237 | 3300053142 | Ga0500577_0000137 | Ga0500577_0000137_12496_13395 | 250 |
| 238 | 3300045976 | Ga0466967_0047439 | Ga0466967_0047439_2566_3447 | 251 |
| 239 | 3300048909 | Ga0496106_0004766 | Ga0496106_0004766_229_1110 | 251 |
| 240 | 3300048910 | Ga0496107_0166911 | Ga0496107_0166911_93_974 | 251 |
| 241 | 3300048911 | Ga0496108_0002311 | Ga0496108_0002311_13102_13983 | 251 |
| 242 | 3300048912 | Ga0496109_0000199 | Ga0496109_0000199_48695_49576 | 251 |
| 243 | 3300048913 | Ga0496110_0006468 | Ga0496110_0006468_5489_6370 | 251 |
| 244 | 3300048915 | Ga0496112_0001162 | Ga0496112_0001162_10548_11429 | 251 |
| 245 | 3300028573 | Ga0265334_10026828 | Ga0265334_100268282 | 253 |
| 246 | 3300037471 | Ga0395905_0129738 | Ga0395905_0129738_1173_2057 | 254 |
| 247 | 3300037853 | Ga0436364_0350531 | Ga0436364_0350531_92_988 | 254 |
| 248 | 3300047320 | Ga0495672_0058324 | Ga0495672_0058324_474_1349 | 254 |
| 249 | 3300005983 | Ga0081540_1002589 | Ga0081540_10025897 | 255 |
| 250 | 3300010375 | Ga0105239_10154481 | Ga0105239_101544812 | 255 |
| 251 | 3300011119 | Ga0105246_10230845 | Ga0105246_102308452 | 255 |
| 252 | 3300003215 | JGI25153J46596_10016040 | JGI25153J46596_100160402 | 256 |
| 253 | 3300005347 | Ga0070668_100142629 | Ga0070668_1001426292 | 256 |
| 254 | 3300006178 | Ga0075367_10077821 | Ga0075367_100778211 | 256 |
| 255 | 3300025297 | Ga0209758_1011836 | Ga0209758_10118362 | 256 |
| 256 | 3300031235 | Ga0265330_10043019 | Ga0265330_100430191 | 256 |
| 257 | 3300031238 | Ga0265332_10037682 | Ga0265332_100376823 | 256 |
| 258 | 3300048926 | Ga0496123_0044387 | Ga0496123_0044387_990_1874 | 256 |
| 259 | 3300005434 | Ga0070709_10002912 | Ga0070709_100029126 | 257 |
| 260 | 3300005436 | Ga0070713_100007596 | Ga0070713_1000075965 | 257 |
| 261 | 3300005439 | Ga0070711_100030214 | Ga0070711_1000302143 | 257 |
| 262 | 3300006163 | Ga0070715_10094976 | Ga0070715_100949761 | 257 |
| 263 | 3300006175 | Ga0070712_100019838 | Ga0070712_1000198384 | 257 |
| 264 | 3300025906 | Ga0207699_10004047 | Ga0207699_100040475 | 257 |
| 265 | 3300025915 | Ga0207693_10027516 | Ga0207693_100275162 | 257 |
| 266 | 3300025916 | Ga0207663_10075689 | Ga0207663_100756892 | 257 |
| 267 | 3300046460 | Ga0495638_0016825 | Ga0495638_0016825_1297_2184 | 257 |
| 268 | 3300046501 | Ga0495607_0021535 | Ga0495607_0021535_2998_3885 | 257 |
| 269 | 3300046520 | Ga0495637_0026429 | Ga0495637_0026429_687_1574 | 257 |
| 270 | 3300046537 | Ga0495598_0050970 | Ga0495598_0050970_68_946 | 257 |
| 271 | 3300046691 | Ga0495670_0011640 | Ga0495670_0011640_582_1469 | 257 |
| 272 | 3300047472 | Ga0495686_0004829 | Ga0495686_0004829_7487_8374 | 257 |
| 273 | 3300048917 | Ga0496114_0116723 | Ga0496114_0116723_34_918 | 257 |
| 274 | 3300048925 | Ga0496122_0018566 | Ga0496122_0018566_2765_3652 | 257 |
| 275 | 3300048926 | Ga0496123_0021074 | Ga0496123_0021074_3659_4546 | 257 |
| 276 | 3300048928 | Ga0496125_0007880 | Ga0496125_0007880_10245_11132 | 257 |
| 277 | 3300048929 | Ga0496126_0249555 | Ga0496126_0249555_167_1054 | 257 |
| 278 | 3300053087 | Ga0500643_045547 | Ga0500643_045547_71_958 | 257 |
| 279 | 3300053089 | Ga0500581_008974 | Ga0500581_008974_1944_2831 | 257 |
| 280 | 3300053093 | Ga0500651_0026121 | Ga0500651_0026121_266_1153 | 257 |
| 281 | 3300053096 | Ga0500641_0028899 | Ga0500641_0028899_287_1174 | 257 |
| 282 | 3300053098 | Ga0500650_0001750 | Ga0500650_0001750_4914_5801 | 257 |
| 283 | 3300053108 | Ga0500562_060258 | Ga0500562_060258_121_1008 | 257 |
| 284 | 3300053109 | Ga0500569_003519 | Ga0500569_003519_2024_2911 | 257 |
| 285 | 3300053139 | Ga0500568_0003414 | Ga0500568_0003414_3591_4478 | 257 |
| 286 | 3300053151 | Ga0500604_0000888 | Ga0500604_0000888_2902_3789 | 257 |
| 287 | 3300053158 | Ga0500627_0020750 | Ga0500627_0020750_1671_2558 | 257 |
| 288 | 3300039437 | Ga0436365_1008789 | Ga0436365_1008789_79_963 | 258 |
| 289 | 3300044765 | Ga0466970_0068050 | Ga0466970_0068050_352_1236 | 258 |
| 290 | 3300048904 | Ga0496101_0194807 | Ga0496101_0194807_290_1174 | 259 |
| 291 | 3300048907 | Ga0496104_0299997 | Ga0496104_0299997_178_1062 | 259 |
| 292 | 3300048928 | Ga0496125_0000202 | Ga0496125_0000202_62004_63011 | 259 |
| 293 | 3300049570 | Ga0501033_0360288 | Ga0501033_0360288_127_1008 | 259 |
| 294 | 3300049580 | Ga0501046_0193212 | Ga0501046_0193212_250_1131 | 259 |
| 295 | 3300049581 | Ga0501047_0103136 | Ga0501047_0103136_1580_2461 | 259 |
| 296 | 3300049586 | Ga0501070_0008301 | Ga0501070_0008301_6056_6937 | 259 |
| 297 | 3300049590 | Ga0501074_0085507 | Ga0501074_0085507_1289_2170 | 259 |
| 298 | 3300049742 | Ga0501080_0121480 | Ga0501080_0121480_478_1359 | 259 |
| 299 | 3300049823 | Ga0501044_0236711 | Ga0501044_0236711_373_1254 | 259 |
| 300 | 3300005458 | Ga0070681_10602518 | Ga0070681_106025181 | 260 |
| 301 | 3300044842 | Ga0466957_0017412 | Ga0466957_0017412_1174_2058 | 260 |
| 302 | 3300045049 | Ga0466959_0012080 | Ga0466959_0012080_4049_4933 | 260 |
| 303 | 3300005327 | Ga0070658_10244141 | Ga0070658_102441412 | 261 |
| 304 | 3300005437 | Ga0070710_10009090 | Ga0070710_100090902 | 261 |
| 305 | 3300005937 | Ga0081455_10006252 | Ga0081455_1000625211 | 261 |
| 306 | 3300005937 | Ga0081455_10059000 | Ga0081455_100590002 | 261 |
| 307 | 3300047471 | Ga0495684_0385043 | Ga0495684_0385043_19_867 | 261 |
| 308 | 3300031507 | Ga0307509_10241021 | Ga0307509_102410211 | 262 |
| 309 | 3300033180 | Ga0307510_10132460 | Ga0307510_101324602 | 262 |
| 310 | 3300046455 | Ga0495603_0038657 | Ga0495603_0038657_1715_2593 | 262 |
| 311 | 3300053080 | Ga0500635_0030255 | Ga0500635_0030255_181_1059 | 262 |
| 312 | 3300053102 | Ga0500554_010368 | Ga0500554_010368_1047_1925 | 262 |
| 313 | 3300053150 | Ga0500603_003006 | Ga0500603_003006_2512_3390 | 262 |
| 314 | 3300053178 | Ga0500637_0000449 | Ga0500637_0000449_14705_15583 | 262 |
| 315 | 3300031616 | Ga0307508_10106518 | Ga0307508_101065184 | 264 |
| 316 | 3300046477 | Ga0495664_0264218 | Ga0495664_0264218_15_899 | 264 |
| 317 | 3300048912 | Ga0496109_0209708 | Ga0496109_0209708_963_1790 | 264 |
| 318 | 3300048915 | Ga0496112_0036409 | Ga0496112_0036409_38_916 | 264 |
| 319 | 3300005983 | Ga0081540_1066450 | Ga0081540_10664502 | 265 |
| 320 | 3300048924 | Ga0496121_0069924 | Ga0496121_0069924_723_1622 | 265 |
| 321 | 3300048929 | Ga0496126_0047285 | Ga0496126_0047285_2633_3532 | 265 |
| 322 | 3300049583 | Ga0501067_0068917 | Ga0501067_0068917_341_1222 | 265 |
| 323 | 3300005366 | Ga0070659_100104182 | Ga0070659_1001041822 | 266 |
| 324 | 3300005536 | Ga0070697_100007535 | Ga0070697_1000075356 | 266 |
| 325 | 3300005563 | Ga0068855_100125949 | Ga0068855_1001259493 | 266 |
| 326 | 3300005614 | Ga0068856_100097944 | Ga0068856_1000979442 | 266 |
| 327 | 3300005616 | Ga0068852_100097459 | Ga0068852_1000974592 | 266 |
| 328 | 3300046476 | Ga0495662_0151121 | Ga0495662_0151121_227_1111 | 266 |
| 329 | 3300046557 | Ga0495622_0126806 | Ga0495622_0126806_221_1108 | 266 |
| 330 | 3300053094 | Ga0500566_0003241 | Ga0500566_0003241_5050_5937 | 266 |
| 331 | 3300053136 | Ga0500559_0000272 | Ga0500559_0000272_30217_31104 | 266 |
| 332 | 3300025932 | Ga0207690_10093677 | Ga0207690_100936772 | 267 |
| 333 | 3300025949 | Ga0207667_10089491 | Ga0207667_100894912 | 267 |
| 334 | 3300026142 | Ga0207698_10354800 | Ga0207698_103548002 | 267 |
| 335 | 3300028379 | Ga0268266_10516093 | Ga0268266_105160931 | 267 |
| 336 | 3300035117 | Ga0373953_0089016 | Ga0373953_0089016_89_988 | 267 |
| 337 | 3300035410 | Ga0373924_0018339 | Ga0373924_0018339_1780_2679 | 267 |
| 338 | 3300036401 | Ga0373937_0463604 | Ga0373937_0463604_126_1025 | 267 |
| 339 | 3300046678 | Ga0495599_0059415 | Ga0495599_0059415_856_1755 | 267 |
| 340 | 3300048924 | Ga0496121_0068945 | Ga0496121_0068945_1442_2317 | 267 |
| 341 | 3300035725 | Ga0373947_0302372 | Ga0373947_0302372_21_899 | 268 |
| 342 | 3300046524 | Ga0495648_0001062 | Ga0495648_0001062_20607_21491 | 268 |
| 343 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001162 | 269 |
| 344 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005162 | 269 |
| 345 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003602 | 269 |
| 346 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002163 | 269 |
| 347 | 3300035695 | Ga0373927_0052079 | Ga0373927_0052079_1186_2064 | 269 |
| 348 | 3300044658 | Ga0466972_0058478 | Ga0466972_0058478_89_1021 | 269 |
| 349 | 3300044694 | Ga0466963_0220525 | Ga0466963_0220525_221_1102 | 269 |
| 350 | 3300045976 | Ga0466967_0042506 | Ga0466967_0042506_2430_3311 | 269 |
| 351 | 3300046499 | Ga0495594_0073696 | Ga0495594_0073696_960_1838 | 269 |
| 352 | 3300027296 | Ga0209389_1000083 | Ga0209389_100008354 | 270 |
| 353 | 3300027357 | Ga0209589_1000097 | Ga0209589_100009754 | 270 |
| 354 | 3300027361 | Ga0209489_100105 | Ga0209489_10010580 | 270 |
| 355 | 3300003771 | Ga0055526_1035353 | Ga0055526_10353532 | 271 |
| 356 | 3300005327 | Ga0070658_10373897 | Ga0070658_103738972 | 271 |
| 357 | 3300005577 | Ga0068857_100018827 | Ga0068857_1000188272 | 271 |
| 358 | 3300005616 | Ga0068852_100015459 | Ga0068852_1000154595 | 271 |
| 359 | 3300005985 | Ga0081539_10000945 | Ga0081539_1000094526 | 271 |
| 360 | 3300009545 | Ga0105237_10110932 | Ga0105237_101109323 | 271 |
| 361 | 3300025295 | Ga0209564_1001859 | Ga0209564_10018592 | 271 |
| 362 | 3300025909 | Ga0207705_10234204 | Ga0207705_102342042 | 271 |
| 363 | 3300026116 | Ga0207674_10068039 | Ga0207674_100680392 | 271 |
| 364 | 3300049822 | Ga0501035_0030449 | Ga0501035_0030449_3814_4698 | 271 |
| 365 | 3300053119 | Ga0500595_017224 | Ga0500595_017224_369_1247 | 271 |
| 366 | 3300005439 | Ga0070711_100067968 | Ga0070711_1000679682 | 272 |
| 367 | 3300005455 | Ga0070663_100164918 | Ga0070663_1001649182 | 272 |
| 368 | 3300005618 | Ga0068864_100098457 | Ga0068864_1000984572 | 272 |
| 369 | 3300010375 | Ga0105239_10282165 | Ga0105239_102821652 | 272 |
| 370 | 3300011119 | Ga0105246_10375712 | Ga0105246_103757122 | 272 |
| 371 | 3300013296 | Ga0157374_10350904 | Ga0157374_103509042 | 272 |
| 372 | 3300013306 | Ga0163162_10483173 | Ga0163162_104831731 | 272 |
| 373 | 3300014968 | Ga0157379_10198204 | Ga0157379_101982042 | 272 |
| 374 | 3300025916 | Ga0207663_10046990 | Ga0207663_100469902 | 272 |
| 375 | 3300026067 | Ga0207678_10157232 | Ga0207678_101572322 | 272 |
| 376 | 3300048905 | Ga0496102_0086765 | Ga0496102_0086765_793_1674 | 272 |
| 377 | 3300048905 | Ga0496102_0432184 | Ga0496102_0432184_22_906 | 272 |
| 378 | 3300048907 | Ga0496104_0004602 | Ga0496104_0004602_473_1354 | 272 |
| 379 | 3300048909 | Ga0496106_0043979 | Ga0496106_0043979_1446_2327 | 272 |
| 380 | 3300048913 | Ga0496110_0012653 | Ga0496110_0012653_2892_3773 | 272 |
| 381 | 3300048918 | Ga0496115_0036128 | Ga0496115_0036128_1501_2382 | 272 |
| 382 | 3300048929 | Ga0496126_0135855 | Ga0496126_0135855_133_1014 | 272 |
| 383 | 3300031250 | Ga0265331_10055600 | Ga0265331_100556002 | 273 |
| 384 | 3300046462 | Ga0495651_0107839 | Ga0495651_0107839_707_1594 | 273 |
| 385 | 3300046559 | Ga0495667_0052845 | Ga0495667_0052845_1536_2423 | 273 |
| 386 | 3300046809 | Ga0495600_0229069 | Ga0495600_0229069_16_903 | 273 |
| 387 | 3300048928 | Ga0496125_0069626 | Ga0496125_0069626_1205_2092 | 273 |
| 388 | 3300049568 | Ga0501031_0043832 | Ga0501031_0043832_1716_2600 | 274 |
| 389 | 3300049574 | Ga0501038_0049739 | Ga0501038_0049739_2620_3504 | 274 |
| 390 | 3300049581 | Ga0501047_0379285 | Ga0501047_0379285_37_921 | 274 |
| 391 | 3300049586 | Ga0501070_0041853 | Ga0501070_0041853_2292_3176 | 274 |
| 392 | 3300049823 | Ga0501044_0070899 | Ga0501044_0070899_435_1319 | 274 |
| 393 | 3300005329 | Ga0070683_100012441 | Ga0070683_1000124412 | 275 |
| 394 | 3300005366 | Ga0070659_100265151 | Ga0070659_1002651512 | 275 |
| 395 | 3300005535 | Ga0070684_100039051 | Ga0070684_1000390512 | 275 |
| 396 | 3300005539 | Ga0068853_100000617 | Ga0068853_10000061713 | 275 |
| 397 | 3300005563 | Ga0068855_100006225 | Ga0068855_1000062253 | 275 |
| 398 | 3300005577 | Ga0068857_100124322 | Ga0068857_1001243222 | 275 |
| 399 | 3300009093 | Ga0105240_10031852 | Ga0105240_100318522 | 275 |
| 400 | 3300009545 | Ga0105237_10014161 | Ga0105237_100141615 | 275 |
| 401 | 3300009551 | Ga0105238_10023571 | Ga0105238_100235715 | 275 |
| 402 | 3300013104 | Ga0157370_10095838 | Ga0157370_100958382 | 275 |
| 403 | 3300013105 | Ga0157369_10026130 | Ga0157369_100261305 | 275 |
| 404 | 3300025912 | Ga0207707_10008927 | Ga0207707_100089274 | 275 |
| 405 | 3300025913 | Ga0207695_10074532 | Ga0207695_100745323 | 275 |
| 406 | 3300025921 | Ga0207652_10008142 | Ga0207652_100081422 | 275 |
| 407 | 3300025924 | Ga0207694_10030264 | Ga0207694_100302642 | 275 |
| 408 | 3300025928 | Ga0207700_10090940 | Ga0207700_100909402 | 275 |
| 409 | 3300025929 | Ga0207664_10414680 | Ga0207664_104146802 | 275 |
| 410 | 3300025932 | Ga0207690_10197413 | Ga0207690_101974133 | 275 |
| 411 | 3300026041 | Ga0207639_10105506 | Ga0207639_101055062 | 275 |
| 412 | 3300026116 | Ga0207674_10145157 | Ga0207674_101451573 | 275 |
| 413 | 3300026142 | Ga0207698_10055781 | Ga0207698_100557812 | 275 |
| 414 | 3300005339 | Ga0070660_100007797 | Ga0070660_1000077975 | 276 |
| 415 | 3300007788 | Ga0099795_10058733 | Ga0099795_100587331 | 276 |
| 416 | 3300021377 | Ga0213874_10015554 | Ga0213874_100155543 | 276 |
| 417 | 3300025919 | Ga0207657_10014599 | Ga0207657_100145995 | 276 |
| 418 | 3300039437 | Ga0436365_1084521 | Ga0436365_1084521_37_936 | 276 |
| 419 | 3300039450 | Ga0436363_0300553 | Ga0436363_0300553_1282_2169 | 276 |
| 420 | iso_pu_bacteria | 2824679649 | 2824680952 | 276 |
| 421 | iso_pu_bacteria | 2922393267 | 2922401178 | 276 |
| 422 | 3300039438 | Ga0436360_0872836 | Ga0436360_0872836_1600_2481 | 277 |
| 423 | 3300039453 | Ga0436362_0839238 | Ga0436362_0839238_507_1388 | 277 |
| 424 | iso_pu_bacteria | 2617270741 | 2617373316 | 278 |
| 425 | iso_pu_bacteria | 2744054633 | 2745081021 | 278 |
| 426 | iso_pu_bacteria | 2824732956 | 2824734755 | 278 |
| 427 | iso_pu_bacteria | 2824746037 | 2824747671 | 278 |
| 428 | iso_pu_bacteria | 2881665667 | 2881667464 | 278 |
| 429 | iso_pu_bacteria | 2908775508 | 2908781773 | 278 |
| 430 | iso_pu_bacteria | 3005483717 | 3005487532 | 278 |
| 431 | 3300021441 | Ga0213871_10002801 | Ga0213871_100028013 | 279 |
| 432 | 3300053097 | Ga0500648_104648 | Ga0500648_104648_288_1175 | 279 |
| 433 | iso_pu_bacteria | 2602042107 | 2603862472 | 279 |
| 434 | iso_pu_bacteria | 2721755755 | 2723848318 | 279 |
| 435 | iso_pu_bacteria | 2791355199 | 2793079601 | 279 |
| 436 | iso_pu_bacteria | 2857524615 | 2857530574 | 279 |
| 437 | iso_pu_bacteria | 2874604998 | 2874607468 | 279 |
| 438 | iso_pu_bacteria | 2885383462 | 2885385941 | 279 |
| 439 | iso_pu_bacteria | 2893066018 | 2893069543 | 279 |
| 440 | iso_pu_bacteria | 2919073203 | 2919077332 | 279 |
| 441 | iso_pu_bacteria | 3005594810 | 3005596345 | 279 |
| 442 | iso_pu_bacteria | 8006964411 | 8006969619 | 279 |
| 443 | iso_pu_bacteria | 8006984368 | 8006988739 | 279 |
| 444 | iso_pu_bacteria | 8006994254 | 8006998699 | 279 |
| 445 | 3300005347 | Ga0070668_100252451 | Ga0070668_1002524512 | 280 |
| 446 | 3300006237 | Ga0097621_100425206 | Ga0097621_1004252062 | 280 |
| 447 | 3300006038 | Ga0075365_10266043 | Ga0075365_102660431 | 281 |
| 448 | 3300031235 | Ga0265330_10039751 | Ga0265330_100397511 | 281 |
| 449 | 3300037068 | Ga0373925_0249083 | Ga0373925_0249083_180_1061 | 281 |
| 450 | 3300009093 | Ga0105240_10002493 | Ga0105240_1000249320 | 282 |
| 451 | 3300009174 | Ga0105241_10017796 | Ga0105241_100177963 | 282 |
| 452 | 3300025913 | Ga0207695_10000006 | Ga0207695_100000061029 | 282 |
| 453 | 3300039438 | Ga0436360_0561872 | Ga0436360_0561872_270_1151 | 282 |
| 454 | 3300053156 | Ga0500622_0006554 | Ga0500622_0006554_2951_3838 | 282 |
| 455 | 3300005344 | Ga0070661_100099322 | Ga0070661_1000993221 | 283 |
| 456 | 3300005455 | Ga0070663_100000663 | Ga0070663_10000066311 | 283 |
| 457 | 3300005456 | Ga0070678_100092117 | Ga0070678_1000921172 | 283 |
| 458 | 3300005548 | Ga0070665_100013563 | Ga0070665_1000135638 | 283 |
| 459 | 3300005564 | Ga0070664_100132154 | Ga0070664_1001321542 | 283 |
| 460 | 3300006038 | Ga0075365_10034919 | Ga0075365_100349192 | 283 |
| 461 | 3300006353 | Ga0075370_10037897 | Ga0075370_100378972 | 283 |
| 462 | 3300009094 | Ga0111539_10892380 | Ga0111539_108923801 | 283 |
| 463 | 3300010375 | Ga0105239_10008059 | Ga0105239_100080597 | 283 |
| 464 | 3300025920 | Ga0207649_10223121 | Ga0207649_102231212 | 283 |
| 465 | 3300025945 | Ga0207679_10355398 | Ga0207679_103553982 | 283 |
| 466 | 3300026067 | Ga0207678_10002185 | Ga0207678_100021855 | 283 |
| 467 | 3300026142 | Ga0207698_10148672 | Ga0207698_101486723 | 283 |
| 468 | 3300028379 | Ga0268266_10060931 | Ga0268266_100609312 | 283 |
| 469 | 3300048908 | Ga0496105_0082363 | Ga0496105_0082363_1040_1939 | 283 |
| 470 | 3300048917 | Ga0496114_0307068 | Ga0496114_0307068_160_1059 | 283 |
| 471 | 3300048918 | Ga0496115_0051481 | Ga0496115_0051481_821_1720 | 283 |
| 472 | 3300050492 | nmdc:mga0yw44_13187_c1 | nmdc:mga0yw44_13187_c1_778_1677 | 283 |
| 473 | 3300050496 | nmdc:mga07m45_16975_c1 | nmdc:mga07m45_16975_c1_551_1450 | 283 |
| 474 | 3300001989 | JGI24739J22299_10005104 | JGI24739J22299_100051042 | 291 |
| 475 | 3300001990 | JGI24737J22298_10010310 | JGI24737J22298_100103102 | 291 |
| 476 | 3300002067 | JGI24735J21928_10019161 | JGI24735J21928_100191613 | 291 |
| 477 | 3300005344 | Ga0070661_100315818 | Ga0070661_1003158181 | 291 |
| 478 | 3300005539 | Ga0068853_100221923 | Ga0068853_1002219232 | 291 |
| 479 | 3300005563 | Ga0068855_100100549 | Ga0068855_1001005492 | 291 |
| 480 | 3300005614 | Ga0068856_100137559 | Ga0068856_1001375592 | 291 |
| 481 | 3300005616 | Ga0068852_100141797 | Ga0068852_1001417972 | 291 |
| 482 | 3300009093 | Ga0105240_10007678 | Ga0105240_100076789 | 291 |
| 483 | 3300009174 | Ga0105241_10142548 | Ga0105241_101425482 | 291 |
| 484 | 3300009545 | Ga0105237_10106896 | Ga0105237_101068963 | 291 |
| 485 | 3300009551 | Ga0105238_10009195 | Ga0105238_100091955 | 291 |
| 486 | 3300010375 | Ga0105239_10077241 | Ga0105239_100772414 | 291 |
| 487 | 3300025904 | Ga0207647_10000241 | Ga0207647_100002419 | 291 |
| 488 | 3300025913 | Ga0207695_10101156 | Ga0207695_101011563 | 291 |
| 489 | 3300025920 | Ga0207649_10273823 | Ga0207649_102738231 | 291 |
| 490 | 3300025933 | Ga0207706_10218264 | Ga0207706_102182643 | 291 |
| 491 | 3300026041 | Ga0207639_10283003 | Ga0207639_102830032 | 291 |
| 492 | 3300026067 | Ga0207678_10276986 | Ga0207678_102769862 | 291 |
| 493 | 3300026116 | Ga0207674_10104186 | Ga0207674_101041862 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar