F454440

General Info

Members Datasets Scaffolds Average Seq Length
493 198 493 329

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10243230|Ga0207708_102432301
Length 375
Sequence VPLRTAVIGVGHLGRQHARLHSTLAAEGQTSFVSVCDQNPETARSIAEERNVSWSTDWHELIGKVDAVSLAVPTVSHCEIACGLLEAGIHVLVEKPIARTIDEADRMIEAAATGHVLLQVGHLERFNPAMVALRPHVRNPVYFEIHRVGEFTARSLDIDVVLDLMIHDLDIVQWLVGEDVEVTELHAVGIPILTNKVDAANARLEFSSGAVANITASRVGTEKIRKMRFFQPHDYVAVDYTTKRASISGLAPPTADGAWPGVHVKNLDVIDVEPLRAEIASFFAAAQDGLPSPVSGIEGRNALSLALRVLERIHDHGTRTKLGALSAQPHLGRRTARTLPLFPPPQKNRSRPSDSSPEMAAPGGISRLSRTSPVW

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
179 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
180 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
181 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
187 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
188 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 1.22
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13776567 2162886012 Bacteria 1368
2 MBSR1b_contig_5161721 2162886012 Bacteria 1359
3 CNAas_1000160 3300000532 Bacteria 6053
4 JGI24748J21848_1000003 3300002074 Bacteria 323921
5 JGI24034J26672_10000005 3300002239 Bacteria 404185
6 JGI24751J29686_10000023 3300002459 Bacteria 97529
7 JGI25406J46586_10011858 3300003203 Bacteria 3805
8 JGI25406J46586_10016942 3300003203 Bacteria 3023
9 Ga0065714_10064432 3300005288 Bacteria 133542
10 Ga0065704_10071170 3300005289 Bacteria 12695
11 Ga0065704_10173405 3300005289 Unclassified 1278
12 Ga0065712_10072279 3300005290 Bacteria 4829
13 Ga0065712_10093804 3300005290 Bacteria 2273
14 Ga0065715_10009713 3300005293 Bacteria 4340
15 Ga0065715_10009734 3300005293 Unclassified 2501
16 Ga0065715_10089813 3300005293 Bacteria 8450
17 Ga0065715_10099362 3300005293 Bacteria 3421
18 Ga0065715_10103597 3300005293 Unclassified 2998
19 Ga0065715_10147335 3300005293 Bacteria 1772
20 Ga0065707_10000836 3300005295 Bacteria 19661
21 Ga0065707_10096715 3300005295 Archaea 3241
22 Ga0065707_10100476 3300005295 Bacteria 2927
23 Ga0065707_10186486 3300005295 Bacteria 1385
24 Ga0070690_100075947 3300005330 Bacteria 2191
25 Ga0070670_100000324 3300005331 Bacteria 40556
26 Ga0070670_100014027 3300005331 Bacteria 6872
27 Ga0068869_100005176 3300005334 Bacteria 8185
28 Ga0068869_100012114 3300005334 Bacteria 5686
29 Ga0068869_100099884 3300005334 Bacteria 2193
30 Ga0068869_100178660 3300005334 Unclassified 1663
31 Ga0068869_100372267 3300005334 Bacteria 1169
32 Ga0070680_100004971 3300005336 Bacteria 10014
33 Ga0070680_100118489 3300005336 Unclassified 2208
34 Ga0070682_100000053 3300005337 Bacteria 114824
35 Ga0070682_100003818 3300005337 Bacteria 8370
36 Ga0070682_100046100 3300005337 Bacteria 2704
37 Ga0068868_100022633 3300005338 Bacteria 4747
38 Ga0068868_100048020 3300005338 Bacteria 3348
39 Ga0070689_100000716 3300005340 Bacteria 20218
40 Ga0070687_100000965 3300005343 Bacteria 9768
41 Ga0070661_100077282 3300005344 Unclassified 2454
42 Ga0070692_10051097 3300005345 Bacteria 2148
43 Ga0070692_10076782 3300005345 Bacteria 1791
44 Ga0070669_100002201 3300005353 Bacteria 14118
45 Ga0070669_100016219 3300005353 Bacteria 5313
46 Ga0070669_100034506 3300005353 Bacteria 3662
47 Ga0070669_100074830 3300005353 Unclassified 2511
48 Ga0070675_100060933 3300005354 Bacteria 3115
49 Ga0070675_100170755 3300005354 Unclassified 1875
50 Ga0070671_100002430 3300005355 Bacteria 14400
51 Ga0070671_100010365 3300005355 Bacteria 7477
52 Ga0070674_100093794 3300005356 Bacteria 2172
53 Ga0070673_100028243 3300005364 Unclassified 4169
54 Ga0070673_100126753 3300005364 Bacteria 2137
55 Ga0070673_100127741 3300005364 Bacteria 2129
56 Ga0070673_100131750 3300005364 Bacteria 2099
57 Ga0070688_100165464 3300005365 Unclassified 1522
58 Ga0070659_100011980 3300005366 Bacteria 6419
59 Ga0070659_100017985 3300005366 Bacteria 5327
60 Ga0070667_100053872 3300005367 Unclassified 3396
61 Ga0070703_10001698 3300005406 Bacteria 6543
62 Ga0070703_10023897 3300005406 Bacteria 1802
63 Ga0070705_100014379 3300005440 Bacteria 4069
64 Ga0070705_100109294 3300005440 Bacteria 1763
65 Ga0070700_100000042 3300005441 Bacteria 99515
66 Ga0070700_100207871 3300005441 Bacteria 1379
67 Ga0070694_100006095 3300005444 Bacteria 7315
68 Ga0070694_100009905 3300005444 Bacteria 5856
69 Ga0070694_100011255 3300005444 Bacteria 5540
70 Ga0070694_100035151 3300005444 Bacteria 3310
71 Ga0070694_100062732 3300005444 Bacteria 2540
72 Ga0070694_100066356 3300005444 Bacteria 2475
73 Ga0070694_100298867 3300005444 Unclassified 1233
74 Ga0070708_100000158 3300005445 Bacteria 47837
75 Ga0070678_100039386 3300005456 Bacteria 3334
76 Ga0070681_10001716 3300005458 Bacteria 19600
77 Ga0070681_10002627 3300005458 Bacteria 16490
78 Ga0070681_10007839 3300005458 Bacteria 10442
79 Ga0070681_10060165 3300005458 Bacteria 3777
80 Ga0068867_100066782 3300005459 Bacteria 2679
81 Ga0068867_100104361 3300005459 Unclassified 2169
82 Ga0068867_100125189 3300005459 Bacteria 1991
83 Ga0068867_100133377 3300005459 Bacteria 1933
84 Ga0068867_100171776 3300005459 Unclassified 1717
85 Ga0068867_100268065 3300005459 Bacteria 1395
86 Ga0070706_100000480 3300005467 Bacteria 47075
87 Ga0070706_100008127 3300005467 Bacteria 9785
88 Ga0070707_100000478 3300005468 Bacteria 39602
89 Ga0070707_100070349 3300005468 Unclassified 3370
90 Ga0070707_100140251 3300005468 Bacteria 2352
91 Ga0070698_100000017 3300005471 Bacteria 107963
92 Ga0070698_100008359 3300005471 Bacteria 11186
93 Ga0070698_100013816 3300005471 Bacteria 8542
94 Ga0070698_100036140 3300005471 Bacteria 5106
95 Ga0070698_100077829 3300005471 Bacteria 3315
96 Ga0070698_100175819 3300005471 Unclassified 2080
97 Ga0070699_100002459 3300005518 Bacteria 16656
98 Ga0070699_100008119 3300005518 Bacteria 9115
99 Ga0070699_100020347 3300005518 Bacteria 5723
100 Ga0070699_100136613 3300005518 Bacteria 2163
101 Ga0070699_100195119 3300005518 Bacteria 1799
102 Ga0070699_100387274 3300005518 Bacteria 1263
103 Ga0070679_100001527 3300005530 Bacteria 20622
104 Ga0070697_100000163 3300005536 Bacteria 54349
105 Ga0070697_100000333 3300005536 Bacteria 37156
106 Ga0070697_100002016 3300005536 Bacteria 15539
107 Ga0070697_100056832 3300005536 Unclassified 3184
108 Ga0070697_100067266 3300005536 Bacteria 2930
109 Ga0070697_100109075 3300005536 Unclassified 2305
110 Ga0070697_100155827 3300005536 Bacteria 1928
111 Ga0070672_100063254 3300005543 Bacteria 2922
112 Ga0070672_100205513 3300005543 Bacteria 1648
113 Ga0070672_100283653 3300005543 Bacteria 1401
114 Ga0070686_100003147 3300005544 Bacteria 9037
115 Ga0070686_100032773 3300005544 Bacteria 3188
116 Ga0070686_100077160 3300005544 Bacteria 2196
117 Ga0070686_100096479 3300005544 Bacteria 1988
118 Ga0070695_100082247 3300005545 Unclassified 2132
119 Ga0070695_100103373 3300005545 Unclassified 1922
120 Ga0070695_100202609 3300005545 Bacteria 1419
121 Ga0070695_100317138 3300005545 Bacteria 1157
122 Ga0070695_100378390 3300005545 Bacteria 1068
123 Ga0070696_100006138 3300005546 Bacteria 8027
124 Ga0070696_100046562 3300005546 Bacteria 3008
125 Ga0070696_100074290 3300005546 Bacteria 2397
126 Ga0070696_100077384 3300005546 Bacteria 2351
127 Ga0070696_100081789 3300005546 Unclassified 2289
128 Ga0070696_100145287 3300005546 Bacteria 1737
129 Ga0070693_100016083 3300005547 Bacteria 3865
130 Ga0070693_100036660 3300005547 Unclassified 2728
131 Ga0070693_100042877 3300005547 Bacteria 2552
132 Ga0070693_100106692 3300005547 Bacteria 1716
133 Ga0070665_100314572 3300005548 Unclassified 1570
134 Ga0070704_100050055 3300005549 Bacteria 2934
135 Ga0070704_100054872 3300005549 Bacteria 2822
136 Ga0070704_100169646 3300005549 Bacteria 1734
137 Ga0070704_100248767 3300005549 Unclassified 1459
138 Ga0070704_100377712 3300005549 Bacteria 1203
139 Ga0070664_100005541 3300005564 Bacteria 10134
140 Ga0068857_100015150 3300005577 Bacteria 6729
141 Ga0068857_100257878 3300005577 Bacteria 1600
142 Ga0068854_100137772 3300005578 Bacteria 1870
143 Ga0068854_100183179 3300005578 Unclassified 1637
144 Ga0068856_100083483 3300005614 Bacteria 3172
145 Ga0070702_100034646 3300005615 Bacteria 2784
146 Ga0068859_100006869 3300005617 Bacteria 11556
147 Ga0068859_100015271 3300005617 Bacteria 7712
148 Ga0068859_100024597 3300005617 Bacteria 6042
149 Ga0068859_100028234 3300005617 Bacteria 5625
150 Ga0068859_100080132 3300005617 Unclassified 3306
151 Ga0068859_100135222 3300005617 Bacteria 2538
152 Ga0068859_100274113 3300005617 Unclassified 1780
153 Ga0068859_100308953 3300005617 Bacteria 1675
154 Ga0068859_100387865 3300005617 Bacteria 1492
155 Ga0068859_100488402 3300005617 Bacteria 1327
156 Ga0068864_100003237 3300005618 Bacteria 13451
157 Ga0068864_100032156 3300005618 Bacteria 4456
158 Ga0068864_100393568 3300005618 Unclassified 1316
159 Ga0068866_10024389 3300005718 Unclassified 2828
160 Ga0068866_10047034 3300005718 Bacteria 2173
161 Ga0068861_100011755 3300005719 Bacteria 6093
162 Ga0068861_100031944 3300005719 Bacteria 3873
163 Ga0068861_100260387 3300005719 Bacteria 1485
164 Ga0068861_100298481 3300005719 Unclassified 1394
165 Ga0068861_100414067 3300005719 Bacteria 1199
166 Ga0068851_10000390 3300005834 Bacteria 19872
167 Ga0068851_10060167 3300005834 Unclassified 1944
168 Ga0068870_10042031 3300005840 Unclassified 2378
169 Ga0068863_100048615 3300005841 Bacteria 4022
170 Ga0068863_100239723 3300005841 Bacteria 1750
171 Ga0068863_100338410 3300005841 Bacteria 1464
172 Ga0068858_100000026 3300005842 Bacteria 153013
173 Ga0068858_100040244 3300005842 Bacteria 4333
174 Ga0068858_100336475 3300005842 Bacteria 1444
175 Ga0068858_100487979 3300005842 Unclassified 1189
176 Ga0068860_100022389 3300005843 Bacteria 6113
177 Ga0068860_100051415 3300005843 Bacteria 3921
178 Ga0068860_100221061 3300005843 Unclassified 1839
179 Ga0068860_100289092 3300005843 Unclassified 1604
180 Ga0068862_100093938 3300005844 Bacteria 2615
181 Ga0068862_100105766 3300005844 Unclassified 2466
182 Ga0081539_10000395 3300005985 Bacteria 93818
183 Ga0081539_10001334 3300005985 Bacteria 42972
184 Ga0070716_100000021 3300006173 Bacteria 79460
185 Ga0097621_100004968 3300006237 Bacteria 9324
186 Ga0097621_100038472 3300006237 Unclassified 3839
187 Ga0068871_100003466 3300006358 Bacteria 10841
188 Ga0068871_100006002 3300006358 Bacteria 8552
189 Ga0075428_100179418 3300006844 Bacteria 2293
190 Ga0075428_100464073 3300006844 Bacteria 1356
191 Ga0075430_100047112 3300006846 Unclassified 3639
192 Ga0075430_100152311 3300006846 Bacteria 1925
193 Ga0075431_100139262 3300006847 Bacteria 2502
194 Ga0075433_10072781 3300006852 Bacteria 3022
195 Ga0075433_10093153 3300006852 Bacteria 2665
196 Ga0075433_10099465 3300006852 Unclassified 2575
197 Ga0075433_10129903 3300006852 Bacteria 2238
198 Ga0075433_10246329 3300006852 Unclassified 1586
199 Ga0075433_10277894 3300006852 Bacteria 1484
200 Ga0075433_10294752 3300006852 Bacteria 1437
201 Ga0075434_100028830 3300006871 Bacteria 5458
202 Ga0075434_100054950 3300006871 Bacteria 3956
203 Ga0075434_100073185 3300006871 Unclassified 3419
204 Ga0075434_100121504 3300006871 Unclassified 2627
205 Ga0075434_100388040 3300006871 Bacteria 1417
206 Ga0075429_100028449 3300006880 Bacteria 4853
207 Ga0068865_100005175 3300006881 Bacteria 7892
208 Ga0068865_100128831 3300006881 Unclassified 1893
209 Ga0097620_100006869 3300006931 Bacteria 11556
210 Ga0097620_100015272 3300006931 Bacteria 7712
211 Ga0097620_100024598 3300006931 Bacteria 6042
212 Ga0097620_100028235 3300006931 Bacteria 5625
213 Ga0097620_100052671 3300006931 Bacteria 4092
214 Ga0097620_100080132 3300006931 Unclassified 3306
215 Ga0097620_100135217 3300006931 Bacteria 2538
216 Ga0097620_100274111 3300006931 Unclassified 1780
217 Ga0097620_100308940 3300006931 Bacteria 1675
218 Ga0097620_100387895 3300006931 Bacteria 1492
219 Ga0097620_100488384 3300006931 Bacteria 1327
220 Ga0075435_100154802 3300007076 Bacteria 1928
221 Ga0075435_100334570 3300007076 Bacteria 1297
222 Ga0099794_10094879 3300007265 Bacteria 1484
223 Ga0105240_10043592 3300009093 Bacteria 5707
224 Ga0105240_10082422 3300009093 Bacteria 3950
225 Ga0111539_10000296 3300009094 Bacteria 60206
226 Ga0111539_10034349 3300009094 Bacteria 6150
227 Ga0111539_10274483 3300009094 Bacteria 1962
228 Ga0105245_10283385 3300009098 Bacteria 1620
229 Ga0105245_10413930 3300009098 Bacteria 1350
230 Ga0105247_10000033 3300009101 Bacteria 184433
231 Ga0105247_10006088 3300009101 Bacteria 7498
232 Ga0105247_10065731 3300009101 Bacteria 2256
233 Ga0114129_10039872 3300009147 Bacteria 6625
234 Ga0114129_10046526 3300009147 Bacteria 6097
235 Ga0114129_10048792 3300009147 Bacteria 5951
236 Ga0114129_10072609 3300009147 Bacteria 4797
237 Ga0114129_10119573 3300009147 Unclassified 3629
238 Ga0114129_10130563 3300009147 Bacteria 3451
239 Ga0114129_10289130 3300009147 Bacteria 2188
240 Ga0114129_10369446 3300009147 Bacteria 1896
241 Ga0105243_10001811 3300009148 Bacteria 18305
242 Ga0105243_10034946 3300009148 Bacteria 3896
243 Ga0105243_10047702 3300009148 Unclassified 3374
244 Ga0105243_10166350 3300009148 Bacteria 1906
245 Ga0105243_10527769 3300009148 Bacteria 1124
246 Ga0105241_10044478 3300009174 Unclassified 3365
247 Ga0105241_10108265 3300009174 Bacteria 2221
248 Ga0105241_10218773 3300009174 Bacteria 1599
249 Ga0105241_10295779 3300009174 Unclassified 1388
250 Ga0105241_10335921 3300009174 Unclassified 1307
251 Ga0105242_10001628 3300009176 Bacteria 17708
252 Ga0105242_10113479 3300009176 Bacteria 2314
253 Ga0105242_10162198 3300009176 Unclassified 1958
254 Ga0105248_10066426 3300009177 Bacteria 4050
255 Ga0105248_10121916 3300009177 Unclassified 2941
256 Ga0105248_10131941 3300009177 Bacteria 2819
257 Ga0105248_10174521 3300009177 Unclassified 2423
258 Ga0105237_10040849 3300009545 Bacteria 4678
259 Ga0105237_10239915 3300009545 Bacteria 1814
260 Ga0105249_10023748 3300009553 Bacteria 5506
261 Ga0105249_10045966 3300009553 Bacteria 3973
262 Ga0105249_10066169 3300009553 Bacteria 3327
263 Ga0105249_10092063 3300009553 Bacteria 2838
264 Ga0105239_10052903 3300010375 Bacteria 4454
265 Ga0105239_10104590 3300010375 Unclassified 3135
266 Ga0105239_10175904 3300010375 Bacteria 2394
267 Ga0105239_10431558 3300010375 Bacteria 1494
268 Ga0105246_10135378 3300011119 Bacteria 1846
269 Ga0157373_10002570 3300013100 Bacteria 13790
270 Ga0157373_10006157 3300013100 Bacteria 8971
271 Ga0157373_10044740 3300013100 Unclassified 3160
272 Ga0157374_10057950 3300013296 Unclassified 3619
273 Ga0157378_10000011 3300013297 Bacteria 158889
274 Ga0157378_10017512 3300013297 Bacteria 6289
275 Ga0157378_10059391 3300013297 Bacteria 3412
276 Ga0157378_10068472 3300013297 Bacteria 3183
277 Ga0157378_10184741 3300013297 Bacteria 1963
278 Ga0157378_10238889 3300013297 Bacteria 1735
279 Ga0157378_10430233 3300013297 Bacteria 1306
280 Ga0163162_10001324 3300013306 Bacteria 23137
281 Ga0163162_10004567 3300013306 Bacteria 13337
282 Ga0163162_10019056 3300013306 Bacteria 6730
283 Ga0163162_10043382 3300013306 Bacteria 4503
284 Ga0163162_10083809 3300013306 Bacteria 3262
285 Ga0163162_10508826 3300013306 Bacteria 1334
286 Ga0157372_10026386 3300013307 Bacteria 6322
287 Ga0157372_10054591 3300013307 Unclassified 4458
288 Ga0157375_10003953 3300013308 Bacteria 12852
289 Ga0157375_10024165 3300013308 Bacteria 5621
290 Ga0157375_10049864 3300013308 Bacteria 4104
291 Ga0157375_10083642 3300013308 Bacteria 3237
292 Ga0157375_10084940 3300013308 Bacteria 3215
293 Ga0157375_10104295 3300013308 Bacteria 2924
294 Ga0163163_10001138 3300014325 Bacteria 22621
295 Ga0163163_10003330 3300014325 Bacteria 13635
296 Ga0163163_10013085 3300014325 Bacteria 7580
297 Ga0163163_10093648 3300014325 Bacteria 3021
298 Ga0163163_10094456 3300014325 Unclassified 3009
299 Ga0163163_10542985 3300014325 Unclassified 1225
300 Ga0157380_10004050 3300014326 Bacteria 10105
301 Ga0157380_10004707 3300014326 Bacteria 9498
302 Ga0157377_10032347 3300014745 Bacteria 2848
303 Ga0157379_10041956 3300014968 Bacteria 4083
304 Ga0157379_10185933 3300014968 Bacteria 1878
305 Ga0157379_10364969 3300014968 Bacteria 1324
306 Ga0157376_10011709 3300014969 Bacteria 6477
307 Ga0163161_10004375 3300017792 Bacteria 9848
308 Ga0163161_10046151 3300017792 Unclassified 3143
309 Ga0213876_10122151 3300021384 Bacteria 1383
310 Ga0207672_1000215 3300025223 Bacteria 8151
311 Ga0207653_10000641 3300025885 Bacteria 12025
312 Ga0207642_10077387 3300025899 Unclassified 1604
313 Ga0207710_10000001 3300025900 Bacteria 1797433
314 Ga0207710_10003142 3300025900 Bacteria 7398
315 Ga0207643_10049217 3300025908 Bacteria 2388
316 Ga0207643_10088080 3300025908 Bacteria 1806
317 Ga0207684_10000533 3300025910 Bacteria 47088
318 Ga0207684_10015078 3300025910 Bacteria 6653
319 Ga0207707_10000044 3300025912 Bacteria 122847
320 Ga0207707_10264354 3300025912 Bacteria 1492
321 Ga0207695_10083930 3300025913 Bacteria 3217
322 Ga0207660_10003658 3300025917 Bacteria 10021
323 Ga0207662_10000656 3300025918 Bacteria 15659
324 Ga0207662_10005139 3300025918 Bacteria 6943
325 Ga0207662_10090789 3300025918 Bacteria 1878
326 Ga0207652_10000462 3300025921 Bacteria 41666
327 Ga0207646_10000849 3300025922 Bacteria 39555
328 Ga0207646_10175264 3300025922 Bacteria 1937
329 Ga0207646_10482633 3300025922 Bacteria 1117
330 Ga0207681_10003799 3300025923 Bacteria 9369
331 Ga0207681_10016868 3300025923 Bacteria 4579
332 Ga0207681_10021638 3300025923 Bacteria 4091
333 Ga0207681_10102450 3300025923 Bacteria 2067
334 Ga0207650_10000112 3300025925 Bacteria 106714
335 Ga0207650_10032171 3300025925 Unclassified 3794
336 Ga0207659_10215638 3300025926 Unclassified 1540
337 Ga0207687_10313850 3300025927 Unclassified 1267
338 Ga0207644_10030420 3300025931 Unclassified 3755
339 Ga0207690_10021784 3300025932 Bacteria 3979
340 Ga0207686_10012940 3300025934 Bacteria 4602
341 Ga0207709_10000871 3300025935 Bacteria 23031
342 Ga0207709_10042007 3300025935 Unclassified 2747
343 Ga0207709_10059781 3300025935 Bacteria 2373
344 Ga0207709_10144533 3300025935 Bacteria 1639
345 Ga0207670_10000655 3300025936 Bacteria 18353
346 Ga0207665_10000035 3300025939 Bacteria 87960
347 Ga0207665_10372967 3300025939 Bacteria 1081
348 Ga0207691_10005690 3300025940 Bacteria 12049
349 Ga0207691_10083863 3300025940 Bacteria 2861
350 Ga0207691_10177057 3300025940 Unclassified 1865
351 Ga0207711_10339346 3300025941 Unclassified 1390
352 Ga0207689_10006063 3300025942 Bacteria 10691
353 Ga0207689_10029657 3300025942 Unclassified 4566
354 Ga0207689_10037555 3300025942 Unclassified 4017
355 Ga0207689_10044023 3300025942 Bacteria 3690
356 Ga0207689_10066939 3300025942 Unclassified 2953
357 Ga0207689_10115417 3300025942 Unclassified 2207
358 Ga0207689_10215127 3300025942 Bacteria 1588
359 Ga0207679_10035305 3300025945 Unclassified 3536
360 Ga0207679_10224396 3300025945 Unclassified 1582
361 Ga0207651_10390747 3300025960 Bacteria 1181
362 Ga0207712_10018224 3300025961 Bacteria 4570
363 Ga0207712_10044792 3300025961 Bacteria 3060
364 Ga0207712_10119913 3300025961 Bacteria 1988
365 Ga0207640_10098736 3300025981 Unclassified 2042
366 Ga0207640_10137369 3300025981 Bacteria 1777
367 Ga0207640_10315066 3300025981 Unclassified 1243
368 Ga0207677_10022794 3300026023 Unclassified 3855
369 Ga0207677_10091963 3300026023 Unclassified 2208
370 Ga0207703_10000110 3300026035 Bacteria 96947
371 Ga0207703_10040243 3300026035 Unclassified 3740
372 Ga0207703_10154256 3300026035 Bacteria 2005
373 Ga0207703_10301951 3300026035 Bacteria 1460
374 Ga0207703_10322367 3300026035 Unclassified 1415
375 Ga0207708_10000074 3300026075 Bacteria 79215
376 Ga0207708_10031790 3300026075 Bacteria 4008
377 Ga0207708_10088044 3300026075 Bacteria 2392
378 Ga0207708_10243230 3300026075 Bacteria 1448
379 Ga0207702_10123398 3300026078 Bacteria 2321
380 Ga0207641_10037575 3300026088 Bacteria 4045
381 Ga0207641_10078774 3300026088 Bacteria 2855
382 Ga0207648_10007622 3300026089 Bacteria 10611
383 Ga0207648_10022214 3300026089 Bacteria 5700
384 Ga0207648_10099123 3300026089 Bacteria 2552
385 Ga0207648_10105995 3300026089 Bacteria 2466
386 Ga0207648_10133623 3300026089 Unclassified 2184
387 Ga0207648_10140413 3300026089 Bacteria 2129
388 Ga0207648_10148733 3300026089 Unclassified 2066
389 Ga0207648_10183175 3300026089 Unclassified 1854
390 Ga0207648_10298065 3300026089 Bacteria 1445
391 Ga0207676_10010546 3300026095 Bacteria 6584
392 Ga0207676_10011353 3300026095 Bacteria 6367
393 Ga0207676_10151956 3300026095 Unclassified 1995
394 Ga0207676_10284127 3300026095 Unclassified 1504
395 Ga0207676_10315326 3300026095 Bacteria 1433
396 Ga0207674_10003413 3300026116 Bacteria 19457
397 Ga0207674_10065579 3300026116 Bacteria 3659
398 Ga0207674_10085142 3300026116 Unclassified 3158
399 Ga0207674_10259595 3300026116 Bacteria 1684
400 Ga0207674_10327346 3300026116 Bacteria 1482
401 Ga0207675_100000348 3300026118 Bacteria 44204
402 Ga0207675_100015659 3300026118 Bacteria 7072
403 Ga0207675_100050618 3300026118 Bacteria 3876
404 Ga0207675_100105295 3300026118 Unclassified 2659
405 Ga0207675_100244255 3300026118 Unclassified 1735
406 Ga0207675_100359489 3300026118 Bacteria 1428
407 Ga0207698_10279032 3300026142 Unclassified 1545
408 Ga0207428_10002868 3300027907 Bacteria 17091
409 Ga0207428_10149561 3300027907 Bacteria 1778
410 Ga0207428_10227059 3300027907 Unclassified 1398
411 Ga0268265_10054616 3300028380 Bacteria 3032
412 Ga0268264_10033018 3300028381 Bacteria 4249
413 Ga0268264_10065965 3300028381 Unclassified 3051
414 Ga0268264_10067330 3300028381 Bacteria 3023
415 Ga0268264_10116978 3300028381 Unclassified 2344
416 Ga0268264_10131861 3300028381 Bacteria 2217
417 Ga0268264_10243176 3300028381 Unclassified 1668
418 Ga0307408_100211804 3300031548 Unclassified 1575
419 Ga0307405_10017057 3300031731 Bacteria 3977
420 Ga0307405_10050516 3300031731 Bacteria 2575
421 Ga0307413_10066248 3300031824 Unclassified 2253
422 Ga0307406_10036564 3300031901 Bacteria 3026
423 Ga0307412_10121151 3300031911 Unclassified 1883
424 Ga0307416_100071857 3300032002 Bacteria 2877
425 Ga0307416_100127518 3300032002 Unclassified 2282
426 Ga0307416_100307412 3300032002 Bacteria 1580
427 Ga0307414_10096984 3300032004 Unclassified 2207
428 Ga0307411_10351099 3300032005 Unclassified 1202
429 Ga0373951_0000579 3300035091 Bacteria 10121
430 Ga0373937_0111154 3300036401 Bacteria 2549
431 Ga0395900_0178367 3300037418 Unclassified 2160
432 Ga0395900_0532724 3300037418 Bacteria 1121
433 Ga0395898_0110131 3300037466 Bacteria 2640
434 Ga0395905_0006289 3300037471 Bacteria 11975
435 Ga0395901_0339147 3300038443 Unclassified 1553
436 Ga0395901_0346532 3300038443 Unclassified 1534
437 Ga0242420_009443 3300038996 Bacteria 1600
438 Ga0436365_0802763 3300039437 Bacteria 1973
439 Ga0436365_0916216 3300039437 Bacteria 2511
440 Ga0439448_0012895 3300042005 Bacteria 2507
441 Ga0439446_0042662 3300042156 Bacteria 1339
442 Ga0439458_0006437 3300042157 Bacteria 2620
443 Ga0451576_0031178 3300045051 Bacteria 5686
444 Ga0495663_0000718 3300046525 Bacteria 11394
445 Ga0495598_0009994 3300046537 Bacteria 2259
446 Ga0495672_0073343 3300047320 Bacteria 1931
447 Ga0496100_0126228 3300048903 Bacteria 1796
448 Ga0496106_0010050 3300048909 Bacteria 6990
449 Ga0496108_0116809 3300048911 Unclassified 2286
450 Ga0496108_0262926 3300048911 Bacteria 1502
451 Ga0496112_0319120 3300048915 Bacteria 1498
452 Ga0496113_0046989 3300048916 Bacteria 3207
453 Ga0501038_0001223 3300049574 Bacteria 23290
454 Ga0501075_0058481 3300049591 Unclassified 2904
455 Ga0501198_005624 3300049649 Unclassified 1769
456 Ga0501216_014575 3300049660 Bacteria 1316
457 Ga0501217_001887 3300049661 Bacteria 4020
458 Ga0501217_003917 3300049661 Unclassified 3035
459 Ga0501224_005333 3300049664 Unclassified 1839
460 Ga0501233_002049 3300049668 Bacteria 3517
461 Ga0501233_024806 3300049668 Bacteria 1314
462 Ga0501251_004061 3300049681 Bacteria 1493
463 Ga0501251_010907 3300049681 Bacteria 1074
464 Ga0501257_010839 3300049686 Bacteria 2074
465 Ga0501225_0005895 3300049705 Unclassified 3586
466 Ga0501234_005283 3300049707 Bacteria 2022
467 Ga0501271_005179 3300049768 Bacteria 1261
468 Ga0501283_010989 3300049779 Bacteria 1340
469 Ga0501045_0127277 3300049824 Unclassified 1893
470 nmdc:mga05p37_469981_c1 3300050507 Bacteria 1451
471 nmdc:mga05p37_5382_c2 3300050507 Bacteria 4725
472 nmdc:mga05p37_8844_c1 3300050507 Bacteria 11898
473 nmdc:mga09592_163473_c1 3300050508 Bacteria 1923
474 nmdc:mga09592_168928_c1 3300050508 Bacteria 1891
475 nmdc:mga0qj67_125654_c1 3300050509 Bacteria 2076
476 nmdc:mga0qj67_36166_c1 3300050509 Bacteria 3863
477 nmdc:mga06r32_338354_c1 3300050510 Bacteria 1490
478 nmdc:mga08y16_236507_c1 3300050511 Unclassified 1889
479 nmdc:mga08y16_63617_c1 3300050511 Bacteria 3853
480 nmdc:mga08y16_8432_c1 3300050511 Bacteria 10789
481 nmdc:mga0n895_375787_c1 3300050512 Bacteria 1438
482 nmdc:mga0n895_447270_c1 3300050512 Bacteria 1305
483 nmdc:mga0n895_58566_c1 3300050512 Bacteria 3798
484 nmdc:mga0rr50_19948_c1 3300050513 Bacteria 4539
485 nmdc:mga0rr50_344089_c1 3300050513 Unclassified 1253
486 nmdc:mga0a205_119788_c1 3300050515 Bacteria 2531
487 nmdc:mga0a205_156540_c2 3300050515 Bacteria 1755
488 nmdc:mga0a205_159631_c1 3300050515 Bacteria 2152
489 nmdc:mga0a205_172564_c1 3300050515 Bacteria 2058
490 nmdc:mga0a205_211828_c1 3300050515 Unclassified 1826
491 nmdc:mga0a205_293734_c1 3300050515 Unclassified 1499
492 nmdc:mga0a205_309918_c1 3300050515 Bacteria 1451
493 Ga0500616_0001280 3300053153 Bacteria 25121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10283385 Ga0105245_102833852 307
2 3300013306 Ga0163162_10508826 Ga0163162_105088262 307
3 3300050512 nmdc:mga0n895_447270_c1 nmdc:mga0n895_447270_c1_188_1147 307
4 3300025939 Ga0207665_10372967 Ga0207665_103729671 309
5 3300045051 Ga0451576_0031178 Ga0451576_0031178_917_1849 309
6 3300002459 JGI24751J29686_10000023 JGI24751J29686_1000002384 310
7 3300005293 Ga0065715_10009713 Ga0065715_100097134 310
8 3300005331 Ga0070670_100000324 Ga0070670_10000032411 310
9 3300014325 Ga0163163_10001138 Ga0163163_1000113813 310
10 3300025925 Ga0207650_10000112 Ga0207650_1000011213 310
11 3300026089 Ga0207648_10140413 Ga0207648_101404132 312
12 3300031731 Ga0307405_10050516 Ga0307405_100505162 312
13 3300031824 Ga0307413_10066248 Ga0307413_100662481 312
14 3300037471 Ga0395905_0006289 Ga0395905_0006289_6072_7049 312
15 3300049661 Ga0501217_003917 Ga0501217_003917_1689_2681 312
16 3300049705 Ga0501225_0005895 Ga0501225_0005895_663_1655 312
17 3300005440 Ga0070705_100109294 Ga0070705_1001092942 313
18 3300005471 Ga0070698_100036140 Ga0070698_1000361401 313
19 3300006173 Ga0070716_100000021 Ga0070716_10000002140 313
20 3300025939 Ga0207665_10000035 Ga0207665_1000003551 313
21 3300009147 Ga0114129_10039872 Ga0114129_100398724 315
22 3300050515 nmdc:mga0a205_293734_c1 nmdc:mga0a205_293734_c1_437_1387 315
23 3300005471 Ga0070698_100077829 Ga0070698_1000778292 316
24 3300005719 Ga0068861_100031944 Ga0068861_1000319442 316
25 3300026118 Ga0207675_100015659 Ga0207675_1000156594 316
26 3300049686 Ga0501257_010839 Ga0501257_010839_362_1336 316
27 3300050515 nmdc:mga0a205_172564_c1 nmdc:mga0a205_172564_c1_989_1939 316
28 3300005617 Ga0068859_100135222 Ga0068859_1001352222 319
29 3300005842 Ga0068858_100336475 Ga0068858_1003364752 319
30 3300006931 Ga0097620_100135217 Ga0097620_1001352172 319
31 3300009148 Ga0105243_10527769 Ga0105243_105277691 319
32 3300013297 Ga0157378_10430233 Ga0157378_104302331 319
33 3300026035 Ga0207703_10301951 Ga0207703_103019512 319
34 3300026089 Ga0207648_10298065 Ga0207648_102980651 319
35 3300005458 Ga0070681_10007839 Ga0070681_100078395 320
36 3300006852 Ga0075433_10246329 Ga0075433_102463292 320
37 3300026116 Ga0207674_10003413 Ga0207674_1000341314 320
38 3300025935 Ga0207709_10144533 Ga0207709_101445331 321
39 3300038443 Ga0395901_0339147 Ga0395901_0339147_42_1013 321
40 3300050513 nmdc:mga0rr50_19948_c1 nmdc:mga0rr50_19948_c1_330_1301 321
41 3300005288 Ga0065714_10064432 Ga0065714_10064432126 322
42 3300005290 Ga0065712_10093804 Ga0065712_100938041 322
43 3300005293 Ga0065715_10089813 Ga0065715_100898136 322
44 3300005295 Ga0065707_10096715 Ga0065707_100967152 322
45 3300005330 Ga0070690_100075947 Ga0070690_1000759472 322
46 3300005340 Ga0070689_100000716 Ga0070689_1000007165 322
47 3300005441 Ga0070700_100000042 Ga0070700_10000004285 322
48 3300005444 Ga0070694_100009905 Ga0070694_1000099055 322
49 3300005459 Ga0068867_100125189 Ga0068867_1001251892 322
50 3300005471 Ga0070698_100175819 Ga0070698_1001758191 322
51 3300005518 Ga0070699_100020347 Ga0070699_1000203475 322
52 3300005536 Ga0070697_100000163 Ga0070697_10000016327 322
53 3300005543 Ga0070672_100205513 Ga0070672_1002055132 322
54 3300005545 Ga0070695_100082247 Ga0070695_1000822472 322
55 3300005546 Ga0070696_100046562 Ga0070696_1000465621 322
56 3300005615 Ga0070702_100034646 Ga0070702_1000346462 322
57 3300005617 Ga0068859_100006869 Ga0068859_1000068692 322
58 3300005617 Ga0068859_100024597 Ga0068859_1000245974 322
59 3300005617 Ga0068859_100308953 Ga0068859_1003089532 322
60 3300005618 Ga0068864_100032156 Ga0068864_1000321562 322
61 3300005719 Ga0068861_100260387 Ga0068861_1002603872 322
62 3300005719 Ga0068861_100414067 Ga0068861_1004140672 322
63 3300005844 Ga0068862_100105766 Ga0068862_1001057662 322
64 3300006844 Ga0075428_100464073 Ga0075428_1004640732 322
65 3300006852 Ga0075433_10129903 Ga0075433_101299032 322
66 3300006931 Ga0097620_100006869 Ga0097620_1000068692 322
67 3300006931 Ga0097620_100024598 Ga0097620_1000245984 322
68 3300006931 Ga0097620_100308940 Ga0097620_1003089401 322
69 3300009101 Ga0105247_10006088 Ga0105247_100060885 322
70 3300009147 Ga0114129_10046526 Ga0114129_100465262 322
71 3300010375 Ga0105239_10104590 Ga0105239_101045901 322
72 3300010375 Ga0105239_10431558 Ga0105239_104315582 322
73 3300013308 Ga0157375_10003953 Ga0157375_1000395310 322
74 3300025900 Ga0207710_10003142 Ga0207710_100031425 322
75 3300025908 Ga0207643_10049217 Ga0207643_100492172 322
76 3300025936 Ga0207670_10000655 Ga0207670_100006553 322
77 3300026035 Ga0207703_10322367 Ga0207703_103223672 322
78 3300026075 Ga0207708_10000074 Ga0207708_1000007465 322
79 3300026089 Ga0207648_10105995 Ga0207648_101059952 322
80 3300026095 Ga0207676_10010546 Ga0207676_100105462 322
81 3300026116 Ga0207674_10065579 Ga0207674_100655793 322
82 3300028381 Ga0268264_10131861 Ga0268264_101318612 322
83 3300031548 Ga0307408_100211804 Ga0307408_1002118042 322
84 3300031731 Ga0307405_10017057 Ga0307405_100170572 322
85 3300031901 Ga0307406_10036564 Ga0307406_100365642 322
86 3300031911 Ga0307412_10121151 Ga0307412_101211511 322
87 3300032002 Ga0307416_100127518 Ga0307416_1001275182 322
88 3300032002 Ga0307416_100307412 Ga0307416_1003074122 322
89 3300032004 Ga0307414_10096984 Ga0307414_100969842 322
90 3300032005 Ga0307411_10351099 Ga0307411_103510992 322
91 3300047320 Ga0495672_0073343 Ga0495672_0073343_570_1541 322
92 3300049649 Ga0501198_005624 Ga0501198_005624_779_1759 322
93 3300049661 Ga0501217_001887 Ga0501217_001887_1624_2604 322
94 3300049664 Ga0501224_005333 Ga0501224_005333_783_1763 322
95 3300049668 Ga0501233_002049 Ga0501233_002049_43_1023 322
96 3300049668 Ga0501233_024806 Ga0501233_024806_208_1188 322
97 3300049681 Ga0501251_004061 Ga0501251_004061_351_1331 322
98 3300050515 nmdc:mga0a205_156540_c2 nmdc:mga0a205_156540_c2_51_1031 322
99 3300003203 JGI25406J46586_10016942 JGI25406J46586_100169422 323
100 3300005331 Ga0070670_100014027 Ga0070670_1000140272 323
101 3300005334 Ga0068869_100372267 Ga0068869_1003722671 323
102 3300005336 Ga0070680_100004971 Ga0070680_1000049712 323
103 3300005353 Ga0070669_100002201 Ga0070669_10000220110 323
104 3300005364 Ga0070673_100131750 Ga0070673_1001317502 323
105 3300005366 Ga0070659_100011980 Ga0070659_1000119804 323
106 3300005456 Ga0070678_100039386 Ga0070678_1000393862 323
107 3300005458 Ga0070681_10001716 Ga0070681_100017166 323
108 3300005459 Ga0068867_100133377 Ga0068867_1001333772 323
109 3300005530 Ga0070679_100001527 Ga0070679_1000015277 323
110 3300005543 Ga0070672_100283653 Ga0070672_1002836532 323
111 3300005546 Ga0070696_100074290 Ga0070696_1000742902 323
112 3300005617 Ga0068859_100387865 Ga0068859_1003878652 323
113 3300005844 Ga0068862_100093938 Ga0068862_1000939382 323
114 3300005985 Ga0081539_10001334 Ga0081539_100013344 323
115 3300006846 Ga0075430_100152311 Ga0075430_1001523112 323
116 3300006847 Ga0075431_100139262 Ga0075431_1001392622 323
117 3300006871 Ga0075434_100121504 Ga0075434_1001215042 323
118 3300006931 Ga0097620_100387895 Ga0097620_1003878952 323
119 3300009094 Ga0111539_10034349 Ga0111539_100343495 323
120 3300009147 Ga0114129_10369446 Ga0114129_103694462 323
121 3300009174 Ga0105241_10218773 Ga0105241_102187732 323
122 3300013297 Ga0157378_10238889 Ga0157378_102388892 323
123 3300013308 Ga0157375_10084940 Ga0157375_100849402 323
124 3300025912 Ga0207707_10000044 Ga0207707_1000004415 323
125 3300025917 Ga0207660_10003658 Ga0207660_100036582 323
126 3300025921 Ga0207652_10000462 Ga0207652_1000046215 323
127 3300025923 Ga0207681_10003799 Ga0207681_100037998 323
128 3300025925 Ga0207650_10032171 Ga0207650_100321714 323
129 3300025932 Ga0207690_10021784 Ga0207690_100217842 323
130 3300025960 Ga0207651_10390747 Ga0207651_103907472 323
131 3300026089 Ga0207648_10099123 Ga0207648_100991232 323
132 3300027907 Ga0207428_10149561 Ga0207428_101495613 323
133 3300042005 Ga0439448_0012895 Ga0439448_0012895_1174_2157 323
134 3300042157 Ga0439458_0006437 Ga0439458_0006437_308_1291 323
135 3300049591 Ga0501075_0058481 Ga0501075_0058481_507_1484 323
136 3300050507 nmdc:mga05p37_469981_c1 nmdc:mga05p37_469981_c1_122_1099 323
137 3300050509 nmdc:mga0qj67_125654_c1 nmdc:mga0qj67_125654_c1_454_1431 323
138 3300050510 nmdc:mga06r32_338354_c1 nmdc:mga06r32_338354_c1_497_1474 323
139 3300050511 nmdc:mga08y16_63617_c1 nmdc:mga08y16_63617_c1_639_1616 323
140 3300005334 Ga0068869_100005176 Ga0068869_1000051767 324
141 3300005355 Ga0070671_100002430 Ga0070671_10000243014 324
142 3300006852 Ga0075433_10072781 Ga0075433_100727812 324
143 3300021384 Ga0213876_10122151 Ga0213876_101221512 324
144 3300025942 Ga0207689_10044023 Ga0207689_100440232 324
145 3300025942 Ga0207689_10115417 Ga0207689_101154171 324
146 3300025942 Ga0207689_10215127 Ga0207689_102151271 324
147 3300039437 Ga0436365_0802763 Ga0436365_0802763_618_1601 324
148 3300050515 nmdc:mga0a205_119788_c1 nmdc:mga0a205_119788_c1_734_1714 324
149 3300003203 JGI25406J46586_10011858 JGI25406J46586_100118582 325
150 3300005289 Ga0065704_10071170 Ga0065704_100711705 325
151 3300005290 Ga0065712_10072279 Ga0065712_100722795 325
152 3300005293 Ga0065715_10009734 Ga0065715_100097342 325
153 3300005293 Ga0065715_10099362 Ga0065715_100993623 325
154 3300005293 Ga0065715_10103597 Ga0065715_101035972 325
155 3300005293 Ga0065715_10147335 Ga0065715_101473351 325
156 3300005295 Ga0065707_10000836 Ga0065707_1000083612 325
157 3300005295 Ga0065707_10186486 Ga0065707_101864861 325
158 3300005334 Ga0068869_100012114 Ga0068869_1000121143 325
159 3300005334 Ga0068869_100099884 Ga0068869_1000998842 325
160 3300005334 Ga0068869_100178660 Ga0068869_1001786601 325
161 3300005337 Ga0070682_100000053 Ga0070682_10000005381 325
162 3300005337 Ga0070682_100003818 Ga0070682_1000038183 325
163 3300005337 Ga0070682_100046100 Ga0070682_1000461002 325
164 3300005338 Ga0068868_100022633 Ga0068868_1000226332 325
165 3300005338 Ga0068868_100048020 Ga0068868_1000480202 325
166 3300005344 Ga0070661_100077282 Ga0070661_1000772822 325
167 3300005345 Ga0070692_10051097 Ga0070692_100510972 325
168 3300005345 Ga0070692_10076782 Ga0070692_100767822 325
169 3300005354 Ga0070675_100060933 Ga0070675_1000609332 325
170 3300005354 Ga0070675_100170755 Ga0070675_1001707552 325
171 3300005355 Ga0070671_100010365 Ga0070671_1000103652 325
172 3300005356 Ga0070674_100093794 Ga0070674_1000937942 325
173 3300005364 Ga0070673_100028243 Ga0070673_1000282431 325
174 3300005364 Ga0070673_100127741 Ga0070673_1001277411 325
175 3300005365 Ga0070688_100165464 Ga0070688_1001654642 325
176 3300005366 Ga0070659_100017985 Ga0070659_1000179854 325
177 3300005367 Ga0070667_100053872 Ga0070667_1000538722 325
178 3300005406 Ga0070703_10001698 Ga0070703_100016982 325
179 3300005440 Ga0070705_100014379 Ga0070705_1000143793 325
180 3300005444 Ga0070694_100006095 Ga0070694_1000060952 325
181 3300005444 Ga0070694_100062732 Ga0070694_1000627322 325
182 3300005444 Ga0070694_100066356 Ga0070694_1000663562 325
183 3300005458 Ga0070681_10002627 Ga0070681_100026276 325
184 3300005458 Ga0070681_10060165 Ga0070681_100601652 325
185 3300005459 Ga0068867_100066782 Ga0068867_1000667822 325
186 3300005459 Ga0068867_100104361 Ga0068867_1001043612 325
187 3300005467 Ga0070706_100000480 Ga0070706_10000048037 325
188 3300005468 Ga0070707_100140251 Ga0070707_1001402512 325
189 3300005471 Ga0070698_100008359 Ga0070698_10000835913 325
190 3300005518 Ga0070699_100002459 Ga0070699_10000245913 325
191 3300005518 Ga0070699_100195119 Ga0070699_1001951192 325
192 3300005536 Ga0070697_100155827 Ga0070697_1001558272 325
193 3300005543 Ga0070672_100063254 Ga0070672_1000632542 325
194 3300005544 Ga0070686_100032773 Ga0070686_1000327732 325
195 3300005545 Ga0070695_100202609 Ga0070695_1002026091 325
196 3300005545 Ga0070695_100317138 Ga0070695_1003171381 325
197 3300005545 Ga0070695_100378390 Ga0070695_1003783901 325
198 3300005546 Ga0070696_100077384 Ga0070696_1000773842 325
199 3300005546 Ga0070696_100145287 Ga0070696_1001452872 325
200 3300005547 Ga0070693_100016083 Ga0070693_1000160833 325
201 3300005547 Ga0070693_100036660 Ga0070693_1000366603 325
202 3300005547 Ga0070693_100042877 Ga0070693_1000428772 325
203 3300005547 Ga0070693_100106692 Ga0070693_1001066921 325
204 3300005548 Ga0070665_100314572 Ga0070665_1003145722 325
205 3300005549 Ga0070704_100050055 Ga0070704_1000500552 325
206 3300005549 Ga0070704_100054872 Ga0070704_1000548723 325
207 3300005549 Ga0070704_100169646 Ga0070704_1001696462 325
208 3300005549 Ga0070704_100248767 Ga0070704_1002487671 325
209 3300005564 Ga0070664_100005541 Ga0070664_1000055416 325
210 3300005577 Ga0068857_100015150 Ga0068857_1000151507 325
211 3300005577 Ga0068857_100257878 Ga0068857_1002578781 325
212 3300005578 Ga0068854_100137772 Ga0068854_1001377721 325
213 3300005578 Ga0068854_100183179 Ga0068854_1001831791 325
214 3300005617 Ga0068859_100015271 Ga0068859_1000152712 325
215 3300005617 Ga0068859_100028234 Ga0068859_1000282342 325
216 3300005617 Ga0068859_100080132 Ga0068859_1000801323 325
217 3300005617 Ga0068859_100488402 Ga0068859_1004884021 325
218 3300005618 Ga0068864_100003237 Ga0068864_1000032372 325
219 3300005618 Ga0068864_100393568 Ga0068864_1003935681 325
220 3300005718 Ga0068866_10024389 Ga0068866_100243892 325
221 3300005719 Ga0068861_100298481 Ga0068861_1002984812 325
222 3300005834 Ga0068851_10000390 Ga0068851_100003904 325
223 3300005834 Ga0068851_10060167 Ga0068851_100601672 325
224 3300005840 Ga0068870_10042031 Ga0068870_100420312 325
225 3300005841 Ga0068863_100239723 Ga0068863_1002397232 325
226 3300005841 Ga0068863_100338410 Ga0068863_1003384102 325
227 3300005842 Ga0068858_100040244 Ga0068858_1000402444 325
228 3300005842 Ga0068858_100487979 Ga0068858_1004879791 325
229 3300005843 Ga0068860_100022389 Ga0068860_1000223894 325
230 3300005843 Ga0068860_100051415 Ga0068860_1000514151 325
231 3300005843 Ga0068860_100221061 Ga0068860_1002210611 325
232 3300005843 Ga0068860_100289092 Ga0068860_1002890922 325
233 3300005985 Ga0081539_10000395 Ga0081539_1000039564 325
234 3300006237 Ga0097621_100004968 Ga0097621_1000049687 325
235 3300006237 Ga0097621_100038472 Ga0097621_1000384722 325
236 3300006358 Ga0068871_100003466 Ga0068871_1000034667 325
237 3300006358 Ga0068871_100006002 Ga0068871_1000060026 325
238 3300006846 Ga0075430_100047112 Ga0075430_1000471121 325
239 3300006852 Ga0075433_10093153 Ga0075433_100931532 325
240 3300006852 Ga0075433_10277894 Ga0075433_102778942 325
241 3300006871 Ga0075434_100028830 Ga0075434_1000288305 325
242 3300006871 Ga0075434_100388040 Ga0075434_1003880402 325
243 3300006880 Ga0075429_100028449 Ga0075429_1000284495 325
244 3300006881 Ga0068865_100005175 Ga0068865_1000051752 325
245 3300006931 Ga0097620_100015272 Ga0097620_1000152722 325
246 3300006931 Ga0097620_100028235 Ga0097620_1000282352 325
247 3300006931 Ga0097620_100052671 Ga0097620_1000526713 325
248 3300006931 Ga0097620_100080132 Ga0097620_1000801323 325
249 3300006931 Ga0097620_100488384 Ga0097620_1004883841 325
250 3300007076 Ga0075435_100154802 Ga0075435_1001548021 325
251 3300007076 Ga0075435_100334570 Ga0075435_1003345701 325
252 3300009093 Ga0105240_10043592 Ga0105240_100435922 325
253 3300009093 Ga0105240_10082422 Ga0105240_100824222 325
254 3300009094 Ga0111539_10000296 Ga0111539_1000029624 325
255 3300009094 Ga0111539_10274483 Ga0111539_102744832 325
256 3300009098 Ga0105245_10413930 Ga0105245_104139301 325
257 3300009101 Ga0105247_10065731 Ga0105247_100657312 325
258 3300009147 Ga0114129_10072609 Ga0114129_100726093 325
259 3300009147 Ga0114129_10119573 Ga0114129_101195734 325
260 3300009148 Ga0105243_10034946 Ga0105243_100349464 325
261 3300009148 Ga0105243_10047702 Ga0105243_100477022 325
262 3300009148 Ga0105243_10166350 Ga0105243_101663502 325
263 3300009174 Ga0105241_10044478 Ga0105241_100444782 325
264 3300009174 Ga0105241_10108265 Ga0105241_101082652 325
265 3300009174 Ga0105241_10295779 Ga0105241_102957791 325
266 3300009174 Ga0105241_10335921 Ga0105241_103359211 325
267 3300009176 Ga0105242_10113479 Ga0105242_101134791 325
268 3300009176 Ga0105242_10162198 Ga0105242_101621982 325
269 3300009177 Ga0105248_10066426 Ga0105248_100664262 325
270 3300009177 Ga0105248_10121916 Ga0105248_101219163 325
271 3300009177 Ga0105248_10131941 Ga0105248_101319411 325
272 3300009177 Ga0105248_10174521 Ga0105248_101745212 325
273 3300009545 Ga0105237_10040849 Ga0105237_100408494 325
274 3300009545 Ga0105237_10239915 Ga0105237_102399152 325
275 3300009553 Ga0105249_10023748 Ga0105249_100237484 325
276 3300009553 Ga0105249_10066169 Ga0105249_100661692 325
277 3300010375 Ga0105239_10175904 Ga0105239_101759042 325
278 3300011119 Ga0105246_10135378 Ga0105246_101353781 325
279 3300013100 Ga0157373_10002570 Ga0157373_1000257013 325
280 3300013100 Ga0157373_10006157 Ga0157373_100061574 325
281 3300013100 Ga0157373_10044740 Ga0157373_100447402 325
282 3300013296 Ga0157374_10057950 Ga0157374_100579502 325
283 3300013297 Ga0157378_10017512 Ga0157378_100175122 325
284 3300013297 Ga0157378_10068472 Ga0157378_100684723 325
285 3300013297 Ga0157378_10184741 Ga0157378_101847412 325
286 3300013306 Ga0163162_10001324 Ga0163162_100013248 325
287 3300013306 Ga0163162_10004567 Ga0163162_100045677 325
288 3300013306 Ga0163162_10083809 Ga0163162_100838093 325
289 3300013307 Ga0157372_10026386 Ga0157372_100263862 325
290 3300013307 Ga0157372_10054591 Ga0157372_100545913 325
291 3300013308 Ga0157375_10049864 Ga0157375_100498643 325
292 3300013308 Ga0157375_10104295 Ga0157375_101042952 325
293 3300014325 Ga0163163_10003330 Ga0163163_100033308 325
294 3300014325 Ga0163163_10013085 Ga0163163_100130856 325
295 3300014325 Ga0163163_10093648 Ga0163163_100936482 325
296 3300014325 Ga0163163_10094456 Ga0163163_100944562 325
297 3300014325 Ga0163163_10542985 Ga0163163_105429852 325
298 3300014745 Ga0157377_10032347 Ga0157377_100323472 325
299 3300014968 Ga0157379_10041956 Ga0157379_100419562 325
300 3300014968 Ga0157379_10185933 Ga0157379_101859331 325
301 3300014969 Ga0157376_10011709 Ga0157376_100117095 325
302 3300017792 Ga0163161_10004375 Ga0163161_100043757 325
303 3300025885 Ga0207653_10000641 Ga0207653_1000064112 325
304 3300025899 Ga0207642_10077387 Ga0207642_100773872 325
305 3300025908 Ga0207643_10088080 Ga0207643_100880802 325
306 3300025910 Ga0207684_10000533 Ga0207684_1000053313 325
307 3300025912 Ga0207707_10264354 Ga0207707_102643542 325
308 3300025913 Ga0207695_10083930 Ga0207695_100839302 325
309 3300025918 Ga0207662_10000656 Ga0207662_100006562 325
310 3300025918 Ga0207662_10090789 Ga0207662_100907892 325
311 3300025922 Ga0207646_10175264 Ga0207646_101752642 325
312 3300025922 Ga0207646_10482633 Ga0207646_104826331 325
313 3300025923 Ga0207681_10016868 Ga0207681_100168685 325
314 3300025926 Ga0207659_10215638 Ga0207659_102156382 325
315 3300025927 Ga0207687_10313850 Ga0207687_103138501 325
316 3300025931 Ga0207644_10030420 Ga0207644_100304203 325
317 3300025935 Ga0207709_10042007 Ga0207709_100420072 325
318 3300025935 Ga0207709_10059781 Ga0207709_100597812 325
319 3300025940 Ga0207691_10005690 Ga0207691_100056907 325
320 3300025940 Ga0207691_10083863 Ga0207691_100838632 325
321 3300025941 Ga0207711_10339346 Ga0207711_103393461 325
322 3300025942 Ga0207689_10029657 Ga0207689_100296573 325
323 3300025942 Ga0207689_10037555 Ga0207689_100375552 325
324 3300025942 Ga0207689_10066939 Ga0207689_100669393 325
325 3300025945 Ga0207679_10035305 Ga0207679_100353053 325
326 3300025945 Ga0207679_10224396 Ga0207679_102243962 325
327 3300025961 Ga0207712_10018224 Ga0207712_100182242 325
328 3300025961 Ga0207712_10044792 Ga0207712_100447923 325
329 3300025981 Ga0207640_10137369 Ga0207640_101373692 325
330 3300025981 Ga0207640_10315066 Ga0207640_103150661 325
331 3300026023 Ga0207677_10022794 Ga0207677_100227943 325
332 3300026035 Ga0207703_10040243 Ga0207703_100402433 325
333 3300026035 Ga0207703_10154256 Ga0207703_101542562 325
334 3300026075 Ga0207708_10088044 Ga0207708_100880442 325
335 3300026088 Ga0207641_10078774 Ga0207641_100787741 325
336 3300026089 Ga0207648_10007622 Ga0207648_100076224 325
337 3300026089 Ga0207648_10022214 Ga0207648_100222143 325
338 3300026089 Ga0207648_10133623 Ga0207648_101336232 325
339 3300026095 Ga0207676_10011353 Ga0207676_100113536 325
340 3300026095 Ga0207676_10151956 Ga0207676_101519562 325
341 3300026095 Ga0207676_10284127 Ga0207676_102841272 325
342 3300026095 Ga0207676_10315326 Ga0207676_103153262 325
343 3300026116 Ga0207674_10085142 Ga0207674_100851421 325
344 3300026116 Ga0207674_10259595 Ga0207674_102595952 325
345 3300026116 Ga0207674_10327346 Ga0207674_103273461 325
346 3300026118 Ga0207675_100050618 Ga0207675_1000506182 325
347 3300026118 Ga0207675_100244255 Ga0207675_1002442552 325
348 3300026142 Ga0207698_10279032 Ga0207698_102790322 325
349 3300027907 Ga0207428_10002868 Ga0207428_1000286814 325
350 3300028381 Ga0268264_10033018 Ga0268264_100330183 325
351 3300028381 Ga0268264_10065965 Ga0268264_100659653 325
352 3300028381 Ga0268264_10067330 Ga0268264_100673302 325
353 3300028381 Ga0268264_10243176 Ga0268264_102431762 325
354 3300035091 Ga0373951_0000579 Ga0373951_0000579_8106_9101 325
355 3300036401 Ga0373937_0111154 Ga0373937_0111154_452_1441 325
356 3300037466 Ga0395898_0110131 Ga0395898_0110131_1482_2471 325
357 3300038443 Ga0395901_0346532 Ga0395901_0346532_201_1190 325
358 3300038996 Ga0242420_009443 Ga0242420_009443_546_1529 325
359 3300046525 Ga0495663_0000718 Ga0495663_0000718_3600_4583 325
360 3300046537 Ga0495598_0009994 Ga0495598_0009994_604_1587 325
361 3300048911 Ga0496108_0116809 Ga0496108_0116809_507_1499 325
362 3300048911 Ga0496108_0262926 Ga0496108_0262926_63_1055 325
363 3300048915 Ga0496112_0319120 Ga0496112_0319120_484_1473 325
364 3300048916 Ga0496113_0046989 Ga0496113_0046989_1163_2152 325
365 3300049574 Ga0501038_0001223 Ga0501038_0001223_379_1371 325
366 3300049660 Ga0501216_014575 Ga0501216_014575_87_1076 325
367 3300049681 Ga0501251_010907 Ga0501251_010907_51_1040 325
368 3300049707 Ga0501234_005283 Ga0501234_005283_782_1783 325
369 3300049768 Ga0501271_005179 Ga0501271_005179_117_1106 325
370 3300049779 Ga0501283_010989 Ga0501283_010989_46_1047 325
371 3300049824 Ga0501045_0127277 Ga0501045_0127277_646_1641 325
372 3300050507 nmdc:mga05p37_5382_c2 nmdc:mga05p37_5382_c2_2386_3369 325
373 3300050507 nmdc:mga05p37_8844_c1 nmdc:mga05p37_8844_c1_9857_10861 325
374 3300050508 nmdc:mga09592_163473_c1 nmdc:mga09592_163473_c1_824_1813 325
375 3300050508 nmdc:mga09592_168928_c1 nmdc:mga09592_168928_c1_519_1508 325
376 3300050509 nmdc:mga0qj67_36166_c1 nmdc:mga0qj67_36166_c1_1843_2832 325
377 3300050511 nmdc:mga08y16_8432_c1 nmdc:mga08y16_8432_c1_4494_5483 325
378 3300050512 nmdc:mga0n895_375787_c1 nmdc:mga0n895_375787_c1_103_1092 325
379 3300050512 nmdc:mga0n895_58566_c1 nmdc:mga0n895_58566_c1_2637_3623 325
380 3300050513 nmdc:mga0rr50_344089_c1 nmdc:mga0rr50_344089_c1_203_1213 325
381 3300050515 nmdc:mga0a205_159631_c1 nmdc:mga0a205_159631_c1_597_1583 325
382 3300050515 nmdc:mga0a205_309918_c1 nmdc:mga0a205_309918_c1_50_1039 325
383 3300000532 CNAas_1000160 CNAas_10001605 326
384 3300005289 Ga0065704_10173405 Ga0065704_101734051 326
385 3300005295 Ga0065707_10100476 Ga0065707_101004762 326
386 3300005336 Ga0070680_100118489 Ga0070680_1001184892 326
387 3300005353 Ga0070669_100034506 Ga0070669_1000345062 326
388 3300005444 Ga0070694_100298867 Ga0070694_1002988671 326
389 3300005546 Ga0070696_100006138 Ga0070696_1000061382 326
390 3300006844 Ga0075428_100179418 Ga0075428_1001794182 326
391 3300006881 Ga0068865_100128831 Ga0068865_1001288312 326
392 3300009147 Ga0114129_10130563 Ga0114129_101305632 326
393 3300009147 Ga0114129_10289130 Ga0114129_102891302 326
394 3300013308 Ga0157375_10024165 Ga0157375_100241655 326
395 3300014326 Ga0157380_10004707 Ga0157380_1000470710 326
396 3300025923 Ga0207681_10021638 Ga0207681_100216382 326
397 3300026075 Ga0207708_10031790 Ga0207708_100317902 326
398 3300026089 Ga0207648_10183175 Ga0207648_101831752 326
399 3300026118 Ga0207675_100359489 Ga0207675_1003594892 326
400 3300027907 Ga0207428_10227059 Ga0207428_102270591 326
401 3300028380 Ga0268265_10054616 Ga0268265_100546161 326
402 3300037418 Ga0395900_0532724 Ga0395900_0532724_44_1030 326
403 3300039437 Ga0436365_0916216 Ga0436365_0916216_1211_2200 326
404 3300050511 nmdc:mga08y16_236507_c1 nmdc:mga08y16_236507_c1_761_1756 326
405 2162886012 MBSR1b_contig_13776567 MBSR1b_0086.00007250 327
406 2162886012 MBSR1b_contig_5161721 MBSR1b_0598.00004690 327
407 3300002074 JGI24748J21848_1000003 JGI24748J21848_1000003261 327
408 3300002239 JGI24034J26672_10000005 JGI24034J26672_10000005139 327
409 3300005343 Ga0070687_100000965 Ga0070687_1000009656 327
410 3300005353 Ga0070669_100016219 Ga0070669_1000162194 327
411 3300005353 Ga0070669_100074830 Ga0070669_1000748302 327
412 3300005364 Ga0070673_100126753 Ga0070673_1001267532 327
413 3300005406 Ga0070703_10023897 Ga0070703_100238973 327
414 3300005441 Ga0070700_100207871 Ga0070700_1002078712 327
415 3300005444 Ga0070694_100011255 Ga0070694_1000112552 327
416 3300005444 Ga0070694_100035151 Ga0070694_1000351512 327
417 3300005445 Ga0070708_100000158 Ga0070708_10000015833 327
418 3300005459 Ga0068867_100171776 Ga0068867_1001717761 327
419 3300005459 Ga0068867_100268065 Ga0068867_1002680651 327
420 3300005467 Ga0070706_100008127 Ga0070706_1000081277 327
421 3300005468 Ga0070707_100000478 Ga0070707_1000004784 327
422 3300005468 Ga0070707_100070349 Ga0070707_1000703493 327
423 3300005471 Ga0070698_100000017 Ga0070698_10000001792 327
424 3300005471 Ga0070698_100013816 Ga0070698_1000138164 327
425 3300005518 Ga0070699_100008119 Ga0070699_1000081197 327
426 3300005518 Ga0070699_100136613 Ga0070699_1001366132 327
427 3300005518 Ga0070699_100387274 Ga0070699_1003872742 327
428 3300005536 Ga0070697_100000333 Ga0070697_10000033314 327
429 3300005536 Ga0070697_100002016 Ga0070697_1000020167 327
430 3300005536 Ga0070697_100056832 Ga0070697_1000568321 327
431 3300005536 Ga0070697_100067266 Ga0070697_1000672662 327
432 3300005536 Ga0070697_100109075 Ga0070697_1001090752 327
433 3300005544 Ga0070686_100003147 Ga0070686_1000031476 327
434 3300005544 Ga0070686_100077160 Ga0070686_1000771602 327
435 3300005544 Ga0070686_100096479 Ga0070686_1000964792 327
436 3300005545 Ga0070695_100103373 Ga0070695_1001033732 327
437 3300005546 Ga0070696_100081789 Ga0070696_1000817894 327
438 3300005549 Ga0070704_100377712 Ga0070704_1003777121 327
439 3300005614 Ga0068856_100083483 Ga0068856_1000834831 327
440 3300005617 Ga0068859_100274113 Ga0068859_1002741132 327
441 3300005718 Ga0068866_10047034 Ga0068866_100470341 327
442 3300005719 Ga0068861_100011755 Ga0068861_1000117555 327
443 3300005841 Ga0068863_100048615 Ga0068863_1000486154 327
444 3300005842 Ga0068858_100000026 Ga0068858_100000026103 327
445 3300006852 Ga0075433_10099465 Ga0075433_100994652 327
446 3300006852 Ga0075433_10294752 Ga0075433_102947522 327
447 3300006871 Ga0075434_100054950 Ga0075434_1000549502 327
448 3300006871 Ga0075434_100073185 Ga0075434_1000731852 327
449 3300006931 Ga0097620_100274111 Ga0097620_1002741112 327
450 3300007265 Ga0099794_10094879 Ga0099794_100948792 327
451 3300009101 Ga0105247_10000033 Ga0105247_1000003343 327
452 3300009147 Ga0114129_10048792 Ga0114129_100487921 327
453 3300009148 Ga0105243_10001811 Ga0105243_100018116 327
454 3300009176 Ga0105242_10001628 Ga0105242_1000162815 327
455 3300009553 Ga0105249_10045966 Ga0105249_100459662 327
456 3300009553 Ga0105249_10092063 Ga0105249_100920632 327
457 3300010375 Ga0105239_10052903 Ga0105239_100529033 327
458 3300013297 Ga0157378_10000011 Ga0157378_1000001184 327
459 3300013297 Ga0157378_10059391 Ga0157378_100593912 327
460 3300013306 Ga0163162_10019056 Ga0163162_100190566 327
461 3300013306 Ga0163162_10043382 Ga0163162_100433822 327
462 3300013308 Ga0157375_10083642 Ga0157375_100836424 327
463 3300014326 Ga0157380_10004050 Ga0157380_100040505 327
464 3300014968 Ga0157379_10364969 Ga0157379_103649692 327
465 3300017792 Ga0163161_10046151 Ga0163161_100461512 327
466 3300025223 Ga0207672_1000215 Ga0207672_10002154 327
467 3300025900 Ga0207710_10000001 Ga0207710_10000001155 327
468 3300025910 Ga0207684_10015078 Ga0207684_100150783 327
469 3300025918 Ga0207662_10005139 Ga0207662_100051396 327
470 3300025922 Ga0207646_10000849 Ga0207646_1000084936 327
471 3300025923 Ga0207681_10102450 Ga0207681_101024501 327
472 3300025934 Ga0207686_10012940 Ga0207686_100129402 327
473 3300025935 Ga0207709_10000871 Ga0207709_1000087118 327
474 3300025940 Ga0207691_10177057 Ga0207691_101770572 327
475 3300025942 Ga0207689_10006063 Ga0207689_100060638 327
476 3300025961 Ga0207712_10119913 Ga0207712_101199132 327
477 3300025981 Ga0207640_10098736 Ga0207640_100987362 327
478 3300026023 Ga0207677_10091963 Ga0207677_100919632 327
479 3300026035 Ga0207703_10000110 Ga0207703_1000011049 327
480 3300026075 Ga0207708_10243230 Ga0207708_102432301 327
481 3300026078 Ga0207702_10123398 Ga0207702_101233982 327
482 3300026088 Ga0207641_10037575 Ga0207641_100375752 327
483 3300026089 Ga0207648_10148733 Ga0207648_101487331 327
484 3300026118 Ga0207675_100000348 Ga0207675_10000034812 327
485 3300026118 Ga0207675_100105295 Ga0207675_1001052952 327
486 3300028381 Ga0268264_10116978 Ga0268264_101169781 327
487 3300032002 Ga0307416_100071857 Ga0307416_1000718572 327
488 3300037418 Ga0395900_0178367 Ga0395900_0178367_360_1358 327
489 3300042156 Ga0439446_0042662 Ga0439446_0042662_94_1098 327
490 3300048903 Ga0496100_0126228 Ga0496100_0126228_207_1193 327
491 3300048909 Ga0496106_0010050 Ga0496106_0010050_1155_2141 327
492 3300050515 nmdc:mga0a205_211828_c1 nmdc:mga0a205_211828_c1_658_1647 327
493 3300053153 Ga0500616_0001280 Ga0500616_0001280_13305_14477 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

3

122

0.92

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

152

227

0.9

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

4

93

0.84

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

101

230

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9544 2 315
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9489 2 315
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.9476 2 315
7bvj-assembly1.cif.gz_A udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.941 2 315
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9392 2 315
ID Description Score Start End Superfamily
af_P75931_1_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9268 2 120 3.40.50.720
af_Q2G1E5_4_119_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9217 2 115 3.40.50.720
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.918 1 125 3.40.50.720
3uuwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9158 2 120 3.40.50.720
af_P77503_10_129_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9129 2 120 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A258DWM4-F1-model_v4 Oxidoreductase 0.9532 2 129 GO:0000166
GO:0003824
AF-A0A2V8F3G6-F1-model_v4 UDP-N-acetyl-D-glucosamine dehydrogenase 0.9506 2 224 GO:0000166
GO:0016491
AF-A0A7C7GZF9-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9493 2 251 GO:0000166
GO:0003824
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9471 1 136 GO:0000166
GO:0003824
AF-A0A2M7YGV4-F1-model_v4 UDP-N-acetyl-D-glucosamine dehydrogenase 0.9433 2 312 GO:0000166
GO:0003824

Feature Viewer

pLDDT pTM Quality
89.87 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map