F454343

General Info

Members Datasets Scaffolds Average Seq Length
492 369 984 142

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_310767_c1|nmdc:mga0n895_310767_c1_132_641
Length 169
Sequence MRAFGARNTYLSVSCYHHGGGESVVSEVTIYHNPNCGTSRNVLGLIRNAGIEPTIIEYLKAPPDRQTLLGLLKRMEIRVRELLRRKGSPYDELGLDDPKWTDDQLIDTMLANPILINRPIVVTPLGVKLCRPSEIVLEILPAPQRGAFTKEDGERVVDDQGRPTRRPNR

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
99 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
138 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
200 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
224 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
225 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
234 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
250 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
262 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
263 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
264 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
265 2547132181 Kosakonia sacchari SP1 Isolate Stem
266 2561511199 Enterobacter sp. R4-368 Isolate Nodule
267 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
268 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
269 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
270 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
271 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
272 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
273 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
274 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
275 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
276 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
277 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
278 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
279 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
280 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
281 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
282 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
283 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
284 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
285 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
286 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
287 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
288 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
289 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
290 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
291 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
292 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
293 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
294 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
295 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
296 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
297 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
298 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
299 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
300 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
301 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
302 2636415599 Klebsiella variicola DX120E Isolate Unclassified
303 2643221568 Rhizobium sp. Root564 Isolate Unclassified
304 2643221594 Achromobacter sp. Root170 Isolate Unclassified
305 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
306 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
307 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
308 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
309 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
310 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
311 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
312 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
313 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
314 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
315 2773857925 Microvirga vignae BR3299 Isolate Unclassified
316 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
317 2775507074 Klebsiella sp. D5A Isolate Unclassified
318 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
319 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
320 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
321 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
322 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
323 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
324 2818991457 Xanthomonas translucens 569 Isolate Unclassified
325 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
326 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
327 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
328 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
329 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
330 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
331 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
332 2857564685 Duganella sp. R-74599 Isolate Unclassified
333 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
334 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
335 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
336 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
337 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
338 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
339 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
340 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
341 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
342 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
343 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
344 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
345 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
346 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
347 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
348 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
349 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
350 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
351 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
352 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
353 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
354 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
355 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
356 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
357 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
358 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
359 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
360 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
361 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
362 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
363 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
364 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
365 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
366 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
367 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
368 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
369 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.24
Metatranscriptomes 0.2
Isolates 22.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 6.1
Nodule 3.66
Rhizoplane 10.37
Rhizosphere 62.6
Stem 0.2
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_310767_c1 3300050512 Bacteria 1597
2 JGI24739J22299_10006238 3300001989 Bacteria 4500
3 JGI24735J21928_10152687 3300002067 Bacteria 667
4 Ga0055526_1007938 3300003771 Bacteria 5395
5 Ga0055530_10004849 3300003791 Bacteria 6723
6 Ga0055531_10004227 3300003794 Bacteria 8835
7 Ga0058692_1020707 3300003856 Bacteria 1376
8 Ga0065165_1000001 3300005262 Bacteria 494087
9 Ga0070658_10631541 3300005327 Bacteria 929
10 Ga0070670_100196876 3300005331 Bacteria 1750
11 Ga0070670_100858783 3300005331 Bacteria 821
12 Ga0068868_100956368 3300005338 Bacteria 781
13 Ga0070691_10008433 3300005341 Bacteria 4716
14 Ga0070668_101075362 3300005347 Bacteria 725
15 Ga0070675_100300876 3300005354 Bacteria 1413
16 Ga0070675_100380977 3300005354 Bacteria 1255
17 Ga0070659_100536689 3300005366 Bacteria 1000
18 Ga0070694_100015215 3300005444 Bacteria 4826
19 Ga0070679_100950007 3300005530 Bacteria 803
20 Ga0068853_100246899 3300005539 Bacteria 1637
21 Ga0070695_100008311 3300005545 Bacteria 6157
22 Ga0070665_100027788 3300005548 Bacteria 5696
23 Ga0068855_100096236 3300005563 Bacteria 3412
24 Ga0068855_100148623 3300005563 Bacteria 2665
25 Ga0068855_100192401 3300005563 Bacteria 2300
26 Ga0070664_100060661 3300005564 Bacteria 3221
27 Ga0068854_101746994 3300005578 Bacteria 569
28 Ga0068856_100113044 3300005614 Bacteria 2713
29 Ga0068856_100156718 3300005614 Bacteria 2287
30 Ga0068852_100054784 3300005616 Bacteria 3439
31 Ga0068852_100744236 3300005616 Bacteria 992
32 Ga0068861_100010738 3300005719 Bacteria 6364
33 Ga0068861_100038376 3300005719 Bacteria 3566
34 Ga0068861_100353887 3300005719 Bacteria 1289
35 Ga0068870_10204821 3300005840 Bacteria 1198
36 Ga0068858_101434263 3300005842 Bacteria 680
37 Ga0068862_100456200 3300005844 Bacteria 1206
38 Ga0081455_10161503 3300005937 Bacteria 1716
39 Ga0075365_10087535 3300006038 Bacteria 2118
40 Ga0070716_100472298 3300006173 Bacteria 919
41 Ga0075362_10004212 3300006177 Bacteria 5136
42 Ga0075369_10001184 3300006186 Bacteria 8825
43 Ga0075430_100060017 3300006846 Bacteria 3196
44 Ga0075430_100335975 3300006846 Bacteria 1248
45 Ga0075431_100704532 3300006847 Bacteria 987
46 Ga0075433_10143244 3300006852 Bacteria 2124
47 Ga0075429_100066636 3300006880 Bacteria 3135
48 Ga0075429_100264788 3300006880 Bacteria 1505
49 Ga0068865_101235186 3300006881 Bacteria 662
50 Ga0079104_1021371 3300006946 Bacteria 1763
51 Ga0105251_10025000 3300009011 Bacteria 3060
52 Ga0105251_10116053 3300009011 Bacteria 1217
53 Ga0105250_10000053 3300009092 Bacteria 114563
54 Ga0105240_11042639 3300009093 Bacteria 873
55 Ga0111539_10233337 3300009094 Bacteria 2142
56 Ga0111539_11549294 3300009094 Bacteria 769
57 Ga0114129_12883021 3300009147 Bacteria 569
58 Ga0105243_12604042 3300009148 Bacteria 545
59 Ga0105241_10109208 3300009174 Bacteria 2212
60 Ga0105242_10850312 3300009176 Bacteria 908
61 Ga0105237_10031546 3300009545 Bacteria 5370
62 Ga0105238_10281415 3300009551 Bacteria 1645
63 Ga0105239_11047722 3300010375 Bacteria 938
64 Ga0157373_10377195 3300013100 Bacteria 1014
65 Ga0157373_11068802 3300013100 Bacteria 604
66 Ga0157371_10001514 3300013102 Bacteria 24008
67 Ga0157371_10851930 3300013102 Bacteria 689
68 Ga0157369_10013662 3300013105 Bacteria 9182
69 Ga0157369_10310574 3300013105 Bacteria 1640
70 Ga0157378_12279078 3300013297 Bacteria 593
71 Ga0157372_10510861 3300013307 Bacteria 1401
72 Ga0157375_10185963 3300013308 Bacteria 2231
73 Ga0163163_10079952 3300014325 Bacteria 3268
74 Ga0157380_10377058 3300014326 Bacteria 1337
75 Ga0182008_10558470 3300014497 Bacteria 637
76 Ga0182006_1000051 3300015261 Bacteria 183089
77 Ga0163161_10004975 3300017792 Bacteria 9252
78 Ga0209147_100607 3300025229 Bacteria 19587
79 Ga0209646_1011971 3300025246 Bacteria 1337
80 Ga0209233_1015049 3300025261 Bacteria 2166
81 Ga0209676_1001039 3300025292 Bacteria 32114
82 Ga0209564_1001065 3300025295 Bacteria 33211
83 Ga0209050_1000622 3300025298 Bacteria 55613
84 Ga0209257_1002690 3300025304 Bacteria 16999
85 Ga0207696_1000116 3300025711 Bacteria 148125
86 Ga0207713_1030876 3300025735 Bacteria 2379
87 Ga0207713_1100645 3300025735 Bacteria 998
88 Ga0207688_10163548 3300025901 Bacteria 1320
89 Ga0207643_10072512 3300025908 Bacteria 1983
90 Ga0207705_10000621 3300025909 Bacteria 29636
91 Ga0207695_11226925 3300025913 Bacteria 630
92 Ga0207657_10511019 3300025919 Bacteria 941
93 Ga0207694_10215379 3300025924 Bacteria 1565
94 Ga0207650_10073460 3300025925 Bacteria 2576
95 Ga0207659_10061181 3300025926 Bacteria 2713
96 Ga0207659_10585619 3300025926 Bacteria 950
97 Ga0207644_10189678 3300025931 Bacteria 1616
98 Ga0207706_10069138 3300025933 Bacteria 3106
99 Ga0207689_10029701 3300025942 Bacteria 4562
100 Ga0207679_10232395 3300025945 Bacteria 1558
101 Ga0207679_10339739 3300025945 Bacteria 1305
102 Ga0207667_10011452 3300025949 Bacteria 10307
103 Ga0207667_10170231 3300025949 Bacteria 2239
104 Ga0207667_10274938 3300025949 Bacteria 1722
105 Ga0207712_11411357 3300025961 Bacteria 623
106 Ga0207668_10050974 3300025972 Bacteria 2856
107 Ga0207668_10869104 3300025972 Bacteria 801
108 Ga0207658_11530050 3300025986 Bacteria 610
109 Ga0207677_11189508 3300026023 Bacteria 697
110 Ga0207703_10943186 3300026035 Bacteria 827
111 Ga0207639_10196612 3300026041 Bacteria 1726
112 Ga0207708_10177307 3300026075 Bacteria 1691
113 Ga0207708_10547944 3300026075 Bacteria 975
114 Ga0207702_10136396 3300026078 Bacteria 2214
115 Ga0207641_12025066 3300026088 Bacteria 577
116 Ga0207676_10009756 3300026095 Bacteria 6828
117 Ga0207674_10663843 3300026116 Bacteria 1007
118 Ga0207675_100057875 3300026118 Bacteria 3617
119 Ga0207675_100202300 3300026118 Bacteria 1908
120 Ga0207675_100401311 3300026118 Bacteria 1351
121 Ga0207675_100462786 3300026118 Bacteria 1258
122 Ga0207698_10280737 3300026142 Bacteria 1540
123 Ga0209281_1032809 3300027111 Bacteria 916
124 Ga0209371_1000502 3300027312 Bacteria 37826
125 Ga0268266_10021060 3300028379 Bacteria 5556
126 Ga0268265_10505870 3300028380 Bacteria 1139
127 Ga0307515_10039529 3300028794 Bacteria 7496
128 Ga0268256_1000265 3300030500 Bacteria 55321
129 Ga0307513_10247008 3300031456 Bacteria 1584
130 Ga0307509_10000048 3300031507 Bacteria 167101
131 Ga0307410_11343113 3300031852 Bacteria 626
132 Ga0307412_10525665 3300031911 Bacteria 989
133 Ga0307409_101264036 3300031995 Bacteria 763
134 Ga0307416_101423188 3300032002 Bacteria 799
135 Ga0307416_102385203 3300032002 Bacteria 629
136 Ga0307414_10016060 3300032004 Bacteria 4539
137 Ga0307414_10109018 3300032004 Bacteria 2102
138 Ga0307414_11051873 3300032004 Bacteria 750
139 Ga0307414_11285222 3300032004 Bacteria 679
140 Ga0307411_11147198 3300032005 Bacteria 702
141 Ga0373929_0010522 3300035085 Bacteria 1730
142 Ga0373934_0051336 3300035086 Bacteria 1635
143 Ga0373960_0103652 3300035121 Bacteria 925
144 Ga0373955_0458250 3300035172 Bacteria 777
145 Ga0373961_0039037 3300035241 Bacteria 1363
146 Ga0373962_0014440 3300035242 Bacteria 2013
147 Ga0373931_0002951 3300035691 Bacteria 7593
148 Ga0373931_0933232 3300035691 Bacteria 585
149 Ga0373935_0068360 3300035692 Bacteria 2286
150 Ga0373927_0066897 3300035695 Bacteria 2325
151 Ga0373933_0002640 3300035724 Bacteria 10041
152 Ga0373937_0019040 3300036401 Bacteria 6142
153 Ga0373937_0544886 3300036401 Bacteria 1102
154 Ga0373937_1112986 3300036401 Bacteria 738
155 Ga0373925_0106466 3300037068 Bacteria 2162
156 Ga0395900_0084615 3300037418 Bacteria 3259
157 Ga0395898_0056828 3300037466 Bacteria 3813
158 Ga0395905_0017889 3300037471 Bacteria 6734
159 Ga0395905_0158328 3300037471 Bacteria 2129
160 Ga0395905_0168276 3300037471 Bacteria 2059
161 Ga0395905_0400216 3300037471 Bacteria 1268
162 Ga0395901_0040376 3300038443 Bacteria 4832
163 Ga0436365_1569938 3300039437 Bacteria 1482
164 Ga0436360_0647274 3300039438 Bacteria 2718
165 Ga0439436_0145191 3300041404 Bacteria 668
166 Ga0439438_007108 3300041405 Bacteria 3864
167 Ga0439465_0005143 3300041413 Bacteria 4197
168 Ga0439465_0012071 3300041413 Bacteria 2706
169 Ga0451800_0146814 3300041459 Bacteria 648
170 Ga0451837_0171425 3300041494 Bacteria 2551
171 Ga0439449_0171022 3300042007 Bacteria 812
172 Ga0439452_000002 3300042010 Bacteria 1377577
173 Ga0439458_0066987 3300042157 Bacteria 903
174 Ga0466973_0237118 3300044659 Bacteria 1302
175 Ga0495592_0004538 3300046454 Bacteria 10168
176 Ga0495592_0120566 3300046454 Bacteria 1845
177 Ga0495629_0000212 3300046459 Bacteria 52191
178 Ga0495629_0029980 3300046459 Bacteria 3856
179 Ga0495638_0063837 3300046460 Bacteria 2269
180 Ga0495638_0303522 3300046460 Bacteria 859
181 Ga0495651_0002375 3300046462 Bacteria 14542
182 Ga0495653_0009961 3300046463 Bacteria 7777
183 Ga0495653_0042085 3300046463 Bacteria 3560
184 Ga0495650_0039841 3300046471 Bacteria 2023
185 Ga0495580_0003522 3300046472 Bacteria 13305
186 Ga0495580_0016823 3300046472 Bacteria 5486
187 Ga0495580_0499912 3300046472 Bacteria 812
188 Ga0495582_0108785 3300046473 Bacteria 1556
189 Ga0495582_0426119 3300046473 Bacteria 766
190 Ga0495605_0045888 3300046474 Bacteria 2151
191 Ga0495664_0016526 3300046477 Bacteria 4206
192 Ga0495664_0119194 3300046477 Bacteria 1596
193 Ga0495594_0502931 3300046499 Bacteria 688
194 Ga0495583_0006431 3300046506 Bacteria 7687
195 Ga0495583_0022007 3300046506 Bacteria 3265
196 Ga0495583_0130176 3300046506 Bacteria 1053
197 Ga0495606_0060213 3300046507 Bacteria 2432
198 Ga0495608_0002101 3300046511 Bacteria 14347
199 Ga0495610_0002639 3300046512 Bacteria 14830
200 Ga0495610_0222712 3300046512 Bacteria 761
201 Ga0495618_0050338 3300046514 Bacteria 2631
202 Ga0495628_0004687 3300046516 Bacteria 12063
203 Ga0495630_0026191 3300046517 Bacteria 4317
204 Ga0495630_0337132 3300046517 Bacteria 1153
205 Ga0495643_0027804 3300046522 Bacteria 3174
206 Ga0495643_0038036 3300046522 Bacteria 2637
207 Ga0495648_0022950 3300046524 Bacteria 4283
208 Ga0495663_0000530 3300046525 Bacteria 13684
209 Ga0495666_0070796 3300046526 Bacteria 1658
210 Ga0495652_0002923 3300046529 Bacteria 17195
211 Ga0495652_0040714 3300046529 Bacteria 4016
212 Ga0495652_0056552 3300046529 Bacteria 3331
213 Ga0495652_0256934 3300046529 Bacteria 1292
214 Ga0495665_0067375 3300046531 Bacteria 1889
215 Ga0495665_0332882 3300046531 Bacteria 774
216 Ga0495665_0406854 3300046531 Bacteria 690
217 Ga0495640_0103754 3300046533 Bacteria 1864
218 Ga0495640_0361822 3300046533 Bacteria 894
219 Ga0495587_0044468 3300046536 Bacteria 2641
220 Ga0495609_0000827 3300046538 Bacteria 23013
221 Ga0495609_0167912 3300046538 Bacteria 927
222 Ga0495645_0023765 3300046543 Bacteria 4442
223 Ga0495667_0009464 3300046559 Bacteria 6602
224 Ga0495668_0071338 3300046616 Bacteria 1909
225 Ga0495668_0313736 3300046616 Bacteria 860
226 Ga0495668_0642950 3300046616 Bacteria 586
227 Ga0495634_0028467 3300046642 Bacteria 3878
228 Ga0495634_0148319 3300046642 Bacteria 1485
229 Ga0495611_0143839 3300046648 Bacteria 1113
230 Ga0495625_0002609 3300046660 Bacteria 19289
231 Ga0495625_0018596 3300046660 Bacteria 5417
232 Ga0495625_0043927 3300046660 Bacteria 3238
233 Ga0495625_0157718 3300046660 Bacteria 1522
234 Ga0495625_0466701 3300046660 Bacteria 777
235 Ga0495635_0032643 3300046663 Bacteria 3611
236 Ga0495661_0001361 3300046665 Bacteria 20654
237 Ga0495661_0049520 3300046665 Bacteria 2547
238 Ga0495599_0022609 3300046678 Bacteria 3926
239 Ga0495599_0384750 3300046678 Bacteria 837
240 Ga0495623_0003190 3300046679 Bacteria 10828
241 Ga0495646_0019584 3300046680 Bacteria 4281
242 Ga0495646_0021665 3300046680 Bacteria 4059
243 Ga0495646_0051682 3300046680 Bacteria 2486
244 Ga0495647_0212687 3300046681 Bacteria 851
245 Ga0495658_0655195 3300046683 Bacteria 673
246 Ga0495613_0057755 3300046689 Bacteria 2849
247 Ga0495613_0107726 3300046689 Bacteria 2010
248 Ga0495624_0002431 3300046690 Bacteria 14126
249 Ga0495624_0070944 3300046690 Bacteria 2168
250 Ga0495670_0315140 3300046691 Bacteria 839
251 Ga0495671_0185003 3300046692 Bacteria 1011
252 Ga0495671_0202901 3300046692 Bacteria 961
253 Ga0495649_0009417 3300046694 Bacteria 5808
254 Ga0495649_0026157 3300046694 Bacteria 3248
255 Ga0495600_0026169 3300046809 Bacteria 3763
256 Ga0495660_0188501 3300046810 Bacteria 993
257 Ga0495604_0004930 3300047317 Bacteria 10583
258 Ga0495604_0167925 3300047317 Bacteria 1546
259 Ga0495604_0492960 3300047317 Bacteria 796
260 Ga0495674_0005963 3300047319 Bacteria 11688
261 Ga0495674_0014359 3300047319 Bacteria 7416
262 Ga0495674_0023574 3300047319 Bacteria 5670
263 Ga0495674_0534891 3300047319 Bacteria 934
264 Ga0495672_0041700 3300047320 Bacteria 2773
265 Ga0495672_0104756 3300047320 Bacteria 1528
266 Ga0495676_0018073 3300047321 Bacteria 6220
267 Ga0495676_0249919 3300047321 Bacteria 1210
268 Ga0495683_0017609 3300047323 Bacteria 3701
269 Ga0495683_0058326 3300047323 Bacteria 1917
270 Ga0495675_0011418 3300047444 Bacteria 5576
271 Ga0495679_000108 3300047446 Bacteria 74572
272 Ga0495685_125486 3300047447 Bacteria 841
273 Ga0495681_0000036 3300047470 Bacteria 124207
274 Ga0495681_0006465 3300047470 Bacteria 7698
275 Ga0495684_0004293 3300047471 Bacteria 11126
276 Ga0495686_0001081 3300047472 Bacteria 32449
277 Ga0495686_0240001 3300047472 Bacteria 1022
278 Ga0495593_0007128 3300047673 Bacteria 6555
279 Ga0495593_0223144 3300047673 Bacteria 945
280 Ga0495602_0006759 3300048088 Bacteria 12039
281 Ga0495602_0027432 3300048088 Bacteria 5471
282 Ga0495602_0301460 3300048088 Bacteria 1172
283 Ga0495602_0348216 3300048088 Bacteria 1070
284 Ga0495615_0000006 3300048090 Bacteria 96050
285 Ga0495615_0035369 3300048090 Bacteria 1221
286 Ga0495626_0106407 3300048091 Bacteria 1218
287 Ga0496100_1203554 3300048903 Bacteria 598
288 Ga0496100_1331059 3300048903 Bacteria 567
289 Ga0496101_0521167 3300048904 Bacteria 939
290 Ga0496102_0000067 3300048905 Bacteria 156790
291 Ga0496102_0000078 3300048905 Bacteria 141629
292 Ga0496103_0002600 3300048906 Bacteria 11306
293 Ga0496103_0389308 3300048906 Bacteria 895
294 Ga0496104_0016161 3300048907 Bacteria 6773
295 Ga0496104_0963251 3300048907 Bacteria 758
296 Ga0496105_0000662 3300048908 Bacteria 23132
297 Ga0496107_0234537 3300048910 Bacteria 1365
298 Ga0496111_0002307 3300048914 Bacteria 11473
299 Ga0496113_0066255 3300048916 Bacteria 2735
300 Ga0496114_0040025 3300048917 Bacteria 3879
301 Ga0496115_0000056 3300048918 Bacteria 104434
302 Ga0496116_0006376 3300048919 Bacteria 10721
303 Ga0496117_0000114 3300048920 Bacteria 180658
304 Ga0496117_0285323 3300048920 Bacteria 882
305 Ga0496118_0000082 3300048921 Bacteria 185820
306 Ga0496118_0014789 3300048921 Bacteria 7279
307 Ga0496118_0035472 3300048921 Bacteria 4048
308 Ga0496119_0019495 3300048922 Bacteria 4993
309 Ga0496119_0242697 3300048922 Bacteria 912
310 Ga0496120_0106044 3300048923 Bacteria 1476
311 Ga0496121_0000344 3300048924 Bacteria 96865
312 Ga0496121_0002676 3300048924 Bacteria 26674
313 Ga0496121_0009736 3300048924 Bacteria 10996
314 Ga0496121_0070047 3300048924 Bacteria 2827
315 Ga0496121_0412526 3300048924 Bacteria 881
316 Ga0496122_0010005 3300048925 Bacteria 9870
317 Ga0496122_0021500 3300048925 Bacteria 5774
318 Ga0496122_0269846 3300048925 Bacteria 938
319 Ga0496123_0013351 3300048926 Bacteria 6905
320 Ga0496123_0025200 3300048926 Bacteria 4491
321 Ga0496123_0050108 3300048926 Bacteria 2793
322 Ga0496123_0103077 3300048926 Bacteria 1654
323 Ga0496123_0194213 3300048926 Bacteria 1047
324 Ga0496124_0000068 3300048927 Bacteria 221819
325 Ga0496124_0004593 3300048927 Bacteria 16009
326 Ga0496124_0017385 3300048927 Bacteria 6778
327 Ga0496124_0832192 3300048927 Bacteria 568
328 Ga0496125_0002303 3300048928 Bacteria 25208
329 Ga0496125_0004268 3300048928 Bacteria 16627
330 Ga0496125_0063036 3300048928 Bacteria 2959
331 Ga0496125_0097535 3300048928 Bacteria 2178
332 Ga0496125_0379043 3300048928 Bacteria 834
333 Ga0496126_0000157 3300048929 Bacteria 156203
334 Ga0496126_0000503 3300048929 Bacteria 76786
335 Ga0496126_0002383 3300048929 Bacteria 25559
336 Ga0496126_0128023 3300048929 Bacteria 2196
337 Ga0496126_0151890 3300048929 Bacteria 1984
338 Ga0496126_0177471 3300048929 Bacteria 1811
339 Ga0496126_0694486 3300048929 Bacteria 791
340 Ga0495678_035808 3300049459 Bacteria 2031
341 Ga0495682_0031568 3300049460 Bacteria 1957
342 Ga0501292_000003 3300049515 Bacteria 161908
343 Ga0501032_0310994 3300049569 Bacteria 1018
344 Ga0501034_0000215 3300049571 Bacteria 110067
345 Ga0501034_0000815 3300049571 Bacteria 46393
346 Ga0501038_0969672 3300049574 Bacteria 625
347 Ga0501047_0348720 3300049581 Bacteria 1317
348 Ga0501068_0580043 3300049584 Bacteria 730
349 Ga0501076_1014459 3300049592 Bacteria 684
350 Ga0501077_0342833 3300049593 Bacteria 953
351 Ga0501238_002524 3300049671 Bacteria 2193
352 Ga0501279_000009 3300049775 Bacteria 117146
353 Ga0501045_1375894 3300049824 Unclassified 513
354 nmdc:mga03683_15767_c1 3300050489 Bacteria 2826
355 nmdc:mga03n38_56253_c1 3300050490 Bacteria 1775
356 nmdc:mga03n38_60504_c1 3300050490 Bacteria 1722
357 nmdc:mga00v17_425102_c1 3300050491 Bacteria 863
358 nmdc:mga07m45_358110_c1 3300050496 Bacteria 848
359 nmdc:mga09592_42071_c1 3300050508 Bacteria 3843
360 nmdc:mga0qj67_355483_c1 3300050509 Bacteria 1184
361 nmdc:mga08y16_878145_c1 3300050511 Bacteria 884
362 nmdc:mga0sz30_271_c1 3300050516 Bacteria 19815
363 Ga0495601_0019342 3300053077 Bacteria 4153
364 Ga0495601_0043955 3300053077 Bacteria 2807
365 Ga0495612_0002989 3300053078 Bacteria 7016
366 Ga0495595_0000287 3300053084 Bacteria 19822
367 Ga0495619_0007250 3300053085 Bacteria 7023
368 Ga0500643_000203 3300053087 Bacteria 56433
369 Ga0500643_156419 3300053087 Bacteria 611
370 Ga0500644_0300211 3300053088 Bacteria 687
371 Ga0500642_0000471 3300053130 Bacteria 12520
372 Ga0500559_0000879 3300053136 Bacteria 19217
373 Ga0500564_025111 3300053138 Bacteria 2737
374 Ga0500568_0022422 3300053139 Bacteria 2700
375 Ga0500616_0053239 3300053153 Bacteria 2124
376 Ga0500627_0071383 3300053158 Bacteria 1538
377 Ga0500636_0007044 3300053177 Bacteria 6485
378 Ga0500645_000585 3300053730 Bacteria 23518
379 Ga0501084_0028819 3300054114 Bacteria 4642
380 Ga0587124_035437 3300059660 Bacteria 566
381 Ga0501082_0438319 3300060353 Bacteria 1141
382 2510281031 2510065053 Bacteria 5005518
383 2510294838 2510065055 Bacteria 5037935
384 2510309179 2510065058 Bacteria 5005894
385 2515610213 2515154107 Bacteria 6795637
386 2547695915 2547132181 Bacteria 4945084
387 2562462600 2561511199 Bacteria 5155034
388 2599100414 2597490356 Bacteria 7030811
389 2599410027 2599185169 Bacteria 5441380
390 2601523221 2600255254 Bacteria 5281859
391 2601528380 2600255255 Bacteria 5282785
392 2601615213 2600255280 Bacteria 5292309
393 2601619861 2600255281 Bacteria 5288753
394 2601643678 2600255287 Bacteria 5210468
395 2601648266 2600255288 Bacteria 5282738
396 2601653265 2600255289 Bacteria 5281907
397 2601658614 2600255290 Bacteria 5282218
398 2601663501 2600255291 Bacteria 5217298
399 2601696616 2600255298 Bacteria 5215185
400 2601701134 2600255299 Bacteria 5218662
401 2601705920 2600255300 Bacteria 5287774
402 2601711505 2600255301 Bacteria 5280532
403 2601716523 2600255302 Bacteria 5288235
404 2601721642 2600255303 Bacteria 5219315
405 2601726929 2600255304 Bacteria 5283973
406 2601731469 2600255305 Bacteria 5282329
407 2601736481 2600255306 Bacteria 5281613
408 2601740535 2600255307 Bacteria 5439064
409 2601751472 2600255309 Bacteria 5431045
410 2602018668 2600255392 Bacteria 5437392
411 2603660885 2602042052 Bacteria 5215873
412 2603666159 2602042053 Bacteria 5214361
413 2603838864 2602042103 Bacteria 5284714
414 2603843876 2602042104 Bacteria 5281639
415 2603849020 2602042105 Bacteria 5282303
416 2603854091 2602042106 Bacteria 5282744
417 2603872145 2602042110 Bacteria 5283285
418 2603876972 2602042111 Bacteria 5212080
419 2606049327 2603880178 Bacteria 5283018
420 2606070592 2603880184 Bacteria 5217896
421 2606147010 2603880202 Bacteria 5284684
422 2606176736 2603880211 Bacteria 5284226
423 2637223424 2636415599 Bacteria 5718434
424 2643856485 2643221568 Bacteria 5187270
425 2643979121 2643221594 Bacteria 5811388
426 2644040954 2643221605 Bacteria 4772303
427 2676408397 2675903046 Bacteria 5451247
428 2738708919 2738541275 Bacteria 4830863
429 2738847344 2738541301 Bacteria 4834102
430 2738863073 2738541304 Bacteria 4833665
431 2739295591 2738543022 Bacteria 4835059
432 2739357269 2738543033 Bacteria 4833336
433 2739652362 2739367664 Bacteria 4114334
434 2740030836 2739367865 Bacteria 4114482
435 2774131971 2773857672 Bacteria 4993178
436 2774868710 2773857925 Bacteria 6472445
437 2776258317 2775506901 Bacteria 9631051
438 2777019740 2775507074 Bacteria 5532402
439 2778126865 2775507255 Bacteria 3945731
440 2793405462 2791355275 Bacteria 4429597
441 2809036118 2808606395 Bacteria 6020352
442 2809064535 2808606401 Bacteria 4586670
443 2809080554 2808606404 Bacteria 4652788
444 2809084918 2808606405 Bacteria 4586632
445 2819661016 2818991457 Bacteria 5323295
446 2835315265 2835312727 Bacteria 7413381
447 2842338767 2842333319 Bacteria 8899485
448 2852686876 2852684882 Bacteria 5463342
449 2854901834 2854896431 Bacteria 5869725
450 2854919945 2854916844 Bacteria 5725939
451 2856288205 2856287931 Bacteria 7223934
452 2857360290 2857357740 Bacteria 9937880
453 2857566484 2857564685 Bacteria 6290584
454 2857580921 2857576091 Bacteria 5465855
455 2858695560 2858688981 Bacteria 8184122
456 2879165786 2879163058 Bacteria 4223965
457 2881928536 2881927736 Bacteria 3993927
458 2882457544 2882456835 Bacteria 6863978
459 2884301363 2884298095 Bacteria 3823049
460 2887379547 2887375801 Bacteria 5334027
461 2904516703 2904513164 Bacteria 5476410
462 2909400993 2909399089 Bacteria 3922598
463 2917834979 2917832318 Bacteria 5346010
464 2919131323 2919130084 Bacteria 5301837
465 2919141523 2919138771 Bacteria 5281312
466 2919498794 2919497567 Bacteria 4408621
467 2928102323 2928100450 Bacteria 4837635
468 2928961175 2928959182 Bacteria 4725774
469 2937000763 2936996657 Bacteria 6298727
470 2941486497 2941485952 Bacteria 3591484
471 2957419367 2957415311 Bacteria 6991633
472 2957421812 2957415311 Bacteria 6991633
473 2957450506 2957443900 Bacteria 6869977
474 2957463578 2957457609 Bacteria 6967680
475 2960622639 2960617483 Bacteria 6727748
476 2960666749 2960660292 Bacteria 7041660
477 2964646039 2964643177 Bacteria 6820887
478 2967740161 2967735183 Bacteria 6827012
479 2967742198 2967742019 Bacteria 6794534
480 2969080454 2969079654 Bacteria 5439582
481 2974301068 2974298342 Bacteria 4840922
482 2977528878 2977523885 Bacteria 6960446
483 2978977991 2978975091 Bacteria 4704313
484 2978978002 2978975091 Bacteria 4704313
485 2984503542 2984499530 Bacteria 5020881
486 2984562894 2984559226 Bacteria 5683096
487 2984600952 2984595703 Bacteria 5682994
488 3002145968 3002141150 Bacteria 5254435
489 642618199 642555113 Bacteria 8214658
490 8021623316 8021622325 Bacteria 4844743
491 8048749231 8048746797 Bacteria 3557226
492 8054558717 8054558443 Bacteria 5204801
493 nmdc:mga0n895_310767_c1
494 JGI24739J22299_10006238
495 JGI24735J21928_10152687
496 Ga0055526_1007938
497 Ga0055530_10004849
498 Ga0055531_10004227
499 Ga0058692_1020707
500 Ga0065165_1000001
501 Ga0070658_10631541
502 Ga0070670_100196876
503 Ga0070670_100858783
504 Ga0068868_100956368
505 Ga0070691_10008433
506 Ga0070668_101075362
507 Ga0070675_100300876
508 Ga0070675_100380977
509 Ga0070659_100536689
510 Ga0070694_100015215
511 Ga0070679_100950007
512 Ga0068853_100246899
513 Ga0070695_100008311
514 Ga0070665_100027788
515 Ga0068855_100096236
516 Ga0068855_100148623
517 Ga0068855_100192401
518 Ga0070664_100060661
519 Ga0068854_101746994
520 Ga0068856_100113044
521 Ga0068856_100156718
522 Ga0068852_100054784
523 Ga0068852_100744236
524 Ga0068861_100010738
525 Ga0068861_100038376
526 Ga0068861_100353887
527 Ga0068870_10204821
528 Ga0068858_101434263
529 Ga0068862_100456200
530 Ga0081455_10161503
531 Ga0075365_10087535
532 Ga0070716_100472298
533 Ga0075362_10004212
534 Ga0075369_10001184
535 Ga0075430_100060017
536 Ga0075430_100335975
537 Ga0075431_100704532
538 Ga0075433_10143244
539 Ga0075429_100066636
540 Ga0075429_100264788
541 Ga0068865_101235186
542 Ga0079104_1021371
543 Ga0105251_10025000
544 Ga0105251_10116053
545 Ga0105250_10000053
546 Ga0105240_11042639
547 Ga0111539_10233337
548 Ga0111539_11549294
549 Ga0114129_12883021
550 Ga0105243_12604042
551 Ga0105241_10109208
552 Ga0105242_10850312
553 Ga0105237_10031546
554 Ga0105238_10281415
555 Ga0105239_11047722
556 Ga0157373_10377195
557 Ga0157373_11068802
558 Ga0157371_10001514
559 Ga0157371_10851930
560 Ga0157369_10013662
561 Ga0157369_10310574
562 Ga0157378_12279078
563 Ga0157372_10510861
564 Ga0157375_10185963
565 Ga0163163_10079952
566 Ga0157380_10377058
567 Ga0182008_10558470
568 Ga0182006_1000051
569 Ga0163161_10004975
570 Ga0209147_100607
571 Ga0209646_1011971
572 Ga0209233_1015049
573 Ga0209676_1001039
574 Ga0209564_1001065
575 Ga0209050_1000622
576 Ga0209257_1002690
577 Ga0207696_1000116
578 Ga0207713_1030876
579 Ga0207713_1100645
580 Ga0207688_10163548
581 Ga0207643_10072512
582 Ga0207705_10000621
583 Ga0207695_11226925
584 Ga0207657_10511019
585 Ga0207694_10215379
586 Ga0207650_10073460
587 Ga0207659_10061181
588 Ga0207659_10585619
589 Ga0207644_10189678
590 Ga0207706_10069138
591 Ga0207689_10029701
592 Ga0207679_10232395
593 Ga0207679_10339739
594 Ga0207667_10011452
595 Ga0207667_10170231
596 Ga0207667_10274938
597 Ga0207712_11411357
598 Ga0207668_10050974
599 Ga0207668_10869104
600 Ga0207658_11530050
601 Ga0207677_11189508
602 Ga0207703_10943186
603 Ga0207639_10196612
604 Ga0207708_10177307
605 Ga0207708_10547944
606 Ga0207702_10136396
607 Ga0207641_12025066
608 Ga0207676_10009756
609 Ga0207674_10663843
610 Ga0207675_100057875
611 Ga0207675_100202300
612 Ga0207675_100401311
613 Ga0207675_100462786
614 Ga0207698_10280737
615 Ga0209281_1032809
616 Ga0209371_1000502
617 Ga0268266_10021060
618 Ga0268265_10505870
619 Ga0307515_10039529
620 Ga0268256_1000265
621 Ga0307513_10247008
622 Ga0307509_10000048
623 Ga0307410_11343113
624 Ga0307412_10525665
625 Ga0307409_101264036
626 Ga0307416_101423188
627 Ga0307416_102385203
628 Ga0307414_10016060
629 Ga0307414_10109018
630 Ga0307414_11051873
631 Ga0307414_11285222
632 Ga0307411_11147198
633 Ga0373929_0010522
634 Ga0373934_0051336
635 Ga0373960_0103652
636 Ga0373955_0458250
637 Ga0373961_0039037
638 Ga0373962_0014440
639 Ga0373931_0002951
640 Ga0373931_0933232
641 Ga0373935_0068360
642 Ga0373927_0066897
643 Ga0373933_0002640
644 Ga0373937_0019040
645 Ga0373937_0544886
646 Ga0373937_1112986
647 Ga0373925_0106466
648 Ga0395900_0084615
649 Ga0395898_0056828
650 Ga0395905_0017889
651 Ga0395905_0158328
652 Ga0395905_0168276
653 Ga0395905_0400216
654 Ga0395901_0040376
655 Ga0436365_1569938
656 Ga0436360_0647274
657 Ga0439436_0145191
658 Ga0439438_007108
659 Ga0439465_0005143
660 Ga0439465_0012071
661 Ga0451800_0146814
662 Ga0451837_0171425
663 Ga0439449_0171022
664 Ga0439452_000002
665 Ga0439458_0066987
666 Ga0466973_0237118
667 Ga0495592_0004538
668 Ga0495592_0120566
669 Ga0495629_0000212
670 Ga0495629_0029980
671 Ga0495638_0063837
672 Ga0495638_0303522
673 Ga0495651_0002375
674 Ga0495653_0009961
675 Ga0495653_0042085
676 Ga0495650_0039841
677 Ga0495580_0003522
678 Ga0495580_0016823
679 Ga0495580_0499912
680 Ga0495582_0108785
681 Ga0495582_0426119
682 Ga0495605_0045888
683 Ga0495664_0016526
684 Ga0495664_0119194
685 Ga0495594_0502931
686 Ga0495583_0006431
687 Ga0495583_0022007
688 Ga0495583_0130176
689 Ga0495606_0060213
690 Ga0495608_0002101
691 Ga0495610_0002639
692 Ga0495610_0222712
693 Ga0495618_0050338
694 Ga0495628_0004687
695 Ga0495630_0026191
696 Ga0495630_0337132
697 Ga0495643_0027804
698 Ga0495643_0038036
699 Ga0495648_0022950
700 Ga0495663_0000530
701 Ga0495666_0070796
702 Ga0495652_0002923
703 Ga0495652_0040714
704 Ga0495652_0056552
705 Ga0495652_0256934
706 Ga0495665_0067375
707 Ga0495665_0332882
708 Ga0495665_0406854
709 Ga0495640_0103754
710 Ga0495640_0361822
711 Ga0495587_0044468
712 Ga0495609_0000827
713 Ga0495609_0167912
714 Ga0495645_0023765
715 Ga0495667_0009464
716 Ga0495668_0071338
717 Ga0495668_0313736
718 Ga0495668_0642950
719 Ga0495634_0028467
720 Ga0495634_0148319
721 Ga0495611_0143839
722 Ga0495625_0002609
723 Ga0495625_0018596
724 Ga0495625_0043927
725 Ga0495625_0157718
726 Ga0495625_0466701
727 Ga0495635_0032643
728 Ga0495661_0001361
729 Ga0495661_0049520
730 Ga0495599_0022609
731 Ga0495599_0384750
732 Ga0495623_0003190
733 Ga0495646_0019584
734 Ga0495646_0021665
735 Ga0495646_0051682
736 Ga0495647_0212687
737 Ga0495658_0655195
738 Ga0495613_0057755
739 Ga0495613_0107726
740 Ga0495624_0002431
741 Ga0495624_0070944
742 Ga0495670_0315140
743 Ga0495671_0185003
744 Ga0495671_0202901
745 Ga0495649_0009417
746 Ga0495649_0026157
747 Ga0495600_0026169
748 Ga0495660_0188501
749 Ga0495604_0004930
750 Ga0495604_0167925
751 Ga0495604_0492960
752 Ga0495674_0005963
753 Ga0495674_0014359
754 Ga0495674_0023574
755 Ga0495674_0534891
756 Ga0495672_0041700
757 Ga0495672_0104756
758 Ga0495676_0018073
759 Ga0495676_0249919
760 Ga0495683_0017609
761 Ga0495683_0058326
762 Ga0495675_0011418
763 Ga0495679_000108
764 Ga0495685_125486
765 Ga0495681_0000036
766 Ga0495681_0006465
767 Ga0495684_0004293
768 Ga0495686_0001081
769 Ga0495686_0240001
770 Ga0495593_0007128
771 Ga0495593_0223144
772 Ga0495602_0006759
773 Ga0495602_0027432
774 Ga0495602_0301460
775 Ga0495602_0348216
776 Ga0495615_0000006
777 Ga0495615_0035369
778 Ga0495626_0106407
779 Ga0496100_1203554
780 Ga0496100_1331059
781 Ga0496101_0521167
782 Ga0496102_0000067
783 Ga0496102_0000078
784 Ga0496103_0002600
785 Ga0496103_0389308
786 Ga0496104_0016161
787 Ga0496104_0963251
788 Ga0496105_0000662
789 Ga0496107_0234537
790 Ga0496111_0002307
791 Ga0496113_0066255
792 Ga0496114_0040025
793 Ga0496115_0000056
794 Ga0496116_0006376
795 Ga0496117_0000114
796 Ga0496117_0285323
797 Ga0496118_0000082
798 Ga0496118_0014789
799 Ga0496118_0035472
800 Ga0496119_0019495
801 Ga0496119_0242697
802 Ga0496120_0106044
803 Ga0496121_0000344
804 Ga0496121_0002676
805 Ga0496121_0009736
806 Ga0496121_0070047
807 Ga0496121_0412526
808 Ga0496122_0010005
809 Ga0496122_0021500
810 Ga0496122_0269846
811 Ga0496123_0013351
812 Ga0496123_0025200
813 Ga0496123_0050108
814 Ga0496123_0103077
815 Ga0496123_0194213
816 Ga0496124_0000068
817 Ga0496124_0004593
818 Ga0496124_0017385
819 Ga0496124_0832192
820 Ga0496125_0002303
821 Ga0496125_0004268
822 Ga0496125_0063036
823 Ga0496125_0097535
824 Ga0496125_0379043
825 Ga0496126_0000157
826 Ga0496126_0000503
827 Ga0496126_0002383
828 Ga0496126_0128023
829 Ga0496126_0151890
830 Ga0496126_0177471
831 Ga0496126_0694486
832 Ga0495678_035808
833 Ga0495682_0031568
834 Ga0501292_000003
835 Ga0501032_0310994
836 Ga0501034_0000215
837 Ga0501034_0000815
838 Ga0501038_0969672
839 Ga0501047_0348720
840 Ga0501068_0580043
841 Ga0501076_1014459
842 Ga0501077_0342833
843 Ga0501238_002524
844 Ga0501279_000009
845 Ga0501045_1375894
846 nmdc:mga03683_15767_c1
847 nmdc:mga03n38_56253_c1
848 nmdc:mga03n38_60504_c1
849 nmdc:mga00v17_425102_c1
850 nmdc:mga07m45_358110_c1
851 nmdc:mga09592_42071_c1
852 nmdc:mga0qj67_355483_c1
853 nmdc:mga08y16_878145_c1
854 nmdc:mga0sz30_271_c1
855 Ga0495601_0019342
856 Ga0495601_0043955
857 Ga0495612_0002989
858 Ga0495595_0000287
859 Ga0495619_0007250
860 Ga0500643_000203
861 Ga0500643_156419
862 Ga0500644_0300211
863 Ga0500642_0000471
864 Ga0500559_0000879
865 Ga0500564_025111
866 Ga0500568_0022422
867 Ga0500616_0053239
868 Ga0500627_0071383
869 Ga0500636_0007044
870 Ga0500645_000585
871 Ga0501084_0028819
872 Ga0587124_035437
873 Ga0501082_0438319
874 2510281031
875 2510294838
876 2510309179
877 2515610213
878 2547695915
879 2562462600
880 2599100414
881 2599410027
882 2601523221
883 2601528380
884 2601615213
885 2601619861
886 2601643678
887 2601648266
888 2601653265
889 2601658614
890 2601663501
891 2601696616
892 2601701134
893 2601705920
894 2601711505
895 2601716523
896 2601721642
897 2601726929
898 2601731469
899 2601736481
900 2601740535
901 2601751472
902 2602018668
903 2603660885
904 2603666159
905 2603838864
906 2603843876
907 2603849020
908 2603854091
909 2603872145
910 2603876972
911 2606049327
912 2606070592
913 2606147010
914 2606176736
915 2637223424
916 2643856485
917 2643979121
918 2644040954
919 2676408397
920 2738708919
921 2738847344
922 2738863073
923 2739295591
924 2739357269
925 2739652362
926 2740030836
927 2774131971
928 2774868710
929 2776258317
930 2777019740
931 2778126865
932 2793405462
933 2809036118
934 2809064535
935 2809080554
936 2809084918
937 2819661016
938 2835315265
939 2842338767
940 2852686876
941 2854901834
942 2854919945
943 2856288205
944 2857360290
945 2857566484
946 2857580921
947 2858695560
948 2879165786
949 2881928536
950 2882457544
951 2884301363
952 2887379547
953 2904516703
954 2909400993
955 2917834979
956 2919131323
957 2919141523
958 2919498794
959 2928102323
960 2928961175
961 2937000763
962 2941486497
963 2957419367
964 2957421812
965 2957450506
966 2957463578
967 2960622639
968 2960666749
969 2964646039
970 2967740161
971 2967742198
972 2969080454
973 2974301068
974 2977528878
975 2978977991
976 2978978002
977 2984503542
978 2984562894
979 2984600952
980 3002145968
981 642618199
982 8021623316
983 8048749231
984 8054558717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

31

139

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j9b-assembly1.cif.gz_A arsenate reductase+0.4m arsenite from e. coli 0.9832 3 140
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9831 3 140
1sk0-assembly1.cif.gz_A arsenate reductase r60a mutant +0.4m arsenite from e. coli 0.9826 3 140
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9823 3 140
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9822 3 140
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9832 3 140 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9762 3 140 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9363 3 115 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9207 3 115 3.40.30.10
af_O45352_10_98_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9031 3 32 3.80.10.10
ID Description Score Start End GO Terms
AF-N0BHG6-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.003 3 118 GO:0008794
GO:0046685
AF-A0A2W4YC61-F1-model_v4 deleted 1.002 3 93
AF-A0A846M224-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.001 2 143 GO:0008794
GO:0046685
AF-A0A4V2NJT7-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.001 3 140 GO:0008794
GO:0046685
AF-A0A527ZCM3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.001 3 117 GO:0008794
GO:0046685

Map