F454215

General Info

Members Datasets Scaffolds Average Seq Length
492 295 489 366

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10050132|Ga0070677_100501322
Length 427
Sequence MAKAKVKKATTKPAARVTRGGSQAKAKPRSKGIRKVGYVDVQNHSHGLHAVNWHDCAGGGQVVVQNKVAYVGNMRNPHGTQIIDVKDPKKPKLLAELTMPPGTHSHKVRVHGDLMLVNREALAVHSLQGEVPPEGYNGGLGIYDISKPAQPKLITEWKATLGPGASYARGVHRFDFDGRYAYISPTVDGYIGNIVMILDLKDPAKPEEVGRWWMPGQWVAGGETPTWKNDAHKCHHPLRFGNRLYTSYWQGGLVILDIDDMTKPKFVSGLDWSPPFPWPTHTALRIPFKIKQRDFMLVSDEDVFRQPDFPQYPASFLWMVDVTDEKHPQPISTFQIEDMPDTPQPRMTGCHQPCEVVTGTEIPVAWFAYGLRVIDISNPHALKEVAYYMPDVPEGSERVQSNDVTVDNRGLIYLLDRVRGLSILERT

Samples

Sample ID Description Type Environment
1 2643221651 Afipia sp. Root123D2 Isolate Unclassified
2 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
3 2858950400 Achromobacter sp. K91 Isolate Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
279 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
280 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
281 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
282 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
283 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
284 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
290 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
293 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.41
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 0
Rhizoplane 3.86
Rhizosphere 85.98
Stem 0
Stem Tuber 0
Unclassified 2.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000282 3300003215 Bacteria 38810
2 JGI25153J46596_10000289 3300003215 Bacteria 38374
3 Ga0070658_10152706 3300005327 Bacteria 1934
4 Ga0070658_10277323 3300005327 Bacteria 1426
5 Ga0070676_10035582 3300005328 Bacteria 2865
6 Ga0070676_10144926 3300005328 Bacteria 1515
7 Ga0070683_100008274 3300005329 Bacteria 8838
8 Ga0070683_100055590 3300005329 Bacteria 3674
9 Ga0070670_100000996 3300005331 Bacteria 22277
10 Ga0070670_100246567 3300005331 Bacteria 1555
11 Ga0070677_10001885 3300005333 Bacteria 6634
12 Ga0070677_10050132 3300005333 Bacteria 1684
13 Ga0070677_10057527 3300005333 Bacteria 1593
14 Ga0070666_10034880 3300005335 Bacteria 3334
15 Ga0070680_100021897 3300005336 Bacteria 5084
16 Ga0068868_100001122 3300005338 Bacteria 18316
17 Ga0070660_100013945 3300005339 Bacteria 5783
18 Ga0070689_100237686 3300005340 Bacteria 1499
19 Ga0070691_10086818 3300005341 Bacteria 1538
20 Ga0070661_100073960 3300005344 Bacteria 2509
21 Ga0070661_100091986 3300005344 Bacteria 2247
22 Ga0070661_100102343 3300005344 Bacteria 2132
23 Ga0070661_100154020 3300005344 Bacteria 1739
24 Ga0070669_100005290 3300005353 Bacteria 9317
25 Ga0070675_100001356 3300005354 Bacteria 17910
26 Ga0070675_100064699 3300005354 Bacteria 3023
27 Ga0070671_100000250 3300005355 Bacteria 36154
28 Ga0070671_100060882 3300005355 Bacteria 3143
29 Ga0070674_100029324 3300005356 Bacteria 3622
30 Ga0070673_100000170 3300005364 Bacteria 31473
31 Ga0070673_100046675 3300005364 Bacteria 3366
32 Ga0070673_100072930 3300005364 Bacteria 2762
33 Ga0070673_100170668 3300005364 Bacteria 1856
34 Ga0070688_100034584 3300005365 Bacteria 3062
35 Ga0070667_100024941 3300005367 Bacteria 4968
36 Ga0070667_100061850 3300005367 Bacteria 3170
37 Ga0070667_100329228 3300005367 Bacteria 1380
38 Ga0070714_100072483 3300005435 Bacteria 2982
39 Ga0070711_100038364 3300005439 Unclassified 3221
40 Ga0070700_100004919 3300005441 Bacteria 7026
41 Ga0070663_100198321 3300005455 Bacteria 1565
42 Ga0070678_100005833 3300005456 Bacteria 7166
43 Ga0070678_100068657 3300005456 Bacteria 2643
44 Ga0070662_100064219 3300005457 Bacteria 2688
45 Ga0070681_10000239 3300005458 Bacteria 43301
46 Ga0070681_10055556 3300005458 Bacteria 3942
47 Ga0070681_10238338 3300005458 Bacteria 1733
48 Ga0070681_10299811 3300005458 Unclassified 1517
49 Ga0068867_100005377 3300005459 Bacteria 9056
50 Ga0070707_100111777 3300005468 Bacteria 2649
51 Ga0070699_100014314 3300005518 Bacteria 6821
52 Ga0070679_100068710 3300005530 Bacteria 3534
53 Ga0070679_100071786 3300005530 Bacteria 3454
54 Ga0070679_100089789 3300005530 Bacteria 3060
55 Ga0070679_100105657 3300005530 Bacteria 2802
56 Ga0070684_100011227 3300005535 Bacteria 7131
57 Ga0070684_100078901 3300005535 Bacteria 2910
58 Ga0070697_100055533 3300005536 Bacteria 3220
59 Ga0070697_100287612 3300005536 Unclassified 1411
60 Ga0070672_100000937 3300005543 Bacteria 17542
61 Ga0070672_100012904 3300005543 Bacteria 5887
62 Ga0070672_100085721 3300005543 Bacteria 2532
63 Ga0070672_100126541 3300005543 Unclassified 2096
64 Ga0070695_100006935 3300005545 Bacteria 6710
65 Ga0070696_100004716 3300005546 Bacteria 9115
66 Ga0068855_100052783 3300005563 Bacteria 4785
67 Ga0068855_100160619 3300005563 Bacteria 2551
68 Ga0068855_100196738 3300005563 Bacteria 2271
69 Ga0068855_100357005 3300005563 Bacteria 1609
70 Ga0070664_100002773 3300005564 Bacteria 14134
71 Ga0070664_100056332 3300005564 Bacteria 3340
72 Ga0068857_100049679 3300005577 Bacteria 3721
73 Ga0068857_100260909 3300005577 Bacteria 1590
74 Ga0068854_100025784 3300005578 Bacteria 4034
75 Ga0068854_100038849 3300005578 Bacteria 3350
76 Ga0068856_100000782 3300005614 Bacteria 34475
77 Ga0068852_100002934 3300005616 Bacteria 11848
78 Ga0068852_100070967 3300005616 Bacteria 3057
79 Ga0068864_100027206 3300005618 Bacteria 4828
80 Ga0068864_100037524 3300005618 Bacteria 4135
81 Ga0068861_100045918 3300005719 Bacteria 3292
82 Ga0068861_100290451 3300005719 Bacteria 1412
83 Ga0068851_10000353 3300005834 Bacteria 20733
84 Ga0068863_100033581 3300005841 Bacteria 4888
85 Ga0068863_100167299 3300005841 Bacteria 2108
86 Ga0068858_100192075 3300005842 Unclassified 1929
87 Ga0068860_100143854 3300005843 Bacteria 2293
88 Ga0068862_100042529 3300005844 Bacteria 3870
89 Ga0081455_10000712 3300005937 Bacteria 43206
90 Ga0081455_10003788 3300005937 Bacteria 17258
91 Ga0081455_10012401 3300005937 Bacteria 8505
92 Ga0081538_10022067 3300005981 Bacteria 4624
93 Ga0081540_1003490 3300005983 Bacteria 12410
94 Ga0081540_1020488 3300005983 Bacteria 3974
95 Ga0081539_10021231 3300005985 Bacteria 4347
96 Ga0075365_10067801 3300006038 Bacteria 2396
97 Ga0075368_10014645 3300006042 Bacteria 2900
98 Ga0075363_100076245 3300006048 Bacteria 1828
99 Ga0070716_100082008 3300006173 Bacteria 1928
100 Ga0075367_10055815 3300006178 Bacteria 2345
101 Ga0075366_10053400 3300006195 Bacteria 2401
102 Ga0097621_100038521 3300006237 Bacteria 3836
103 Ga0097621_100149543 3300006237 Bacteria 2002
104 Ga0068871_100000916 3300006358 Bacteria 19636
105 Ga0075428_100012487 3300006844 Bacteria 9446
106 Ga0075433_10000352 3300006852 Bacteria 28750
107 Ga0075434_100002220 3300006871 Bacteria 16946
108 Ga0075434_100072564 3300006871 Bacteria 3434
109 Ga0075429_100002797 3300006880 Bacteria 14763
110 Ga0075435_100010425 3300007076 Bacteria 6799
111 Ga0075435_100061303 3300007076 Unclassified 3051
112 Ga0075435_100195109 3300007076 Bacteria 1715
113 Ga0105240_10107754 3300009093 Bacteria 3377
114 Ga0105240_10130452 3300009093 Bacteria 3016
115 Ga0111539_10002681 3300009094 Bacteria 23562
116 Ga0111539_10012353 3300009094 Bacteria 10702
117 Ga0111539_10017007 3300009094 Bacteria 9000
118 Ga0111539_10031280 3300009094 Bacteria 6465
119 Ga0111539_10095929 3300009094 Bacteria 3483
120 Ga0111539_10105348 3300009094 Bacteria 3309
121 Ga0111539_10115736 3300009094 Bacteria 3144
122 Ga0114129_10092910 3300009147 Bacteria 4180
123 Ga0114129_10288571 3300009147 Unclassified 2190
124 Ga0105241_10009946 3300009174 Bacteria 6987
125 Ga0105248_10000688 3300009177 Bacteria 38162
126 Ga0105248_10080445 3300009177 Bacteria 3662
127 Ga0105248_10150600 3300009177 Bacteria 2625
128 Ga0105248_10411569 3300009177 Bacteria 1522
129 Ga0105237_10033362 3300009545 Bacteria 5215
130 Ga0105237_10192332 3300009545 Bacteria 2040
131 Ga0105237_10221797 3300009545 Bacteria 1891
132 Ga0105238_10007842 3300009551 Bacteria 10676
133 Ga0105238_10066762 3300009551 Bacteria 3598
134 Ga0105239_10101030 3300010375 Bacteria 3190
135 Ga0157373_10002490 3300013100 Bacteria 14031
136 Ga0157371_10009207 3300013102 Bacteria 7795
137 Ga0157370_10007108 3300013104 Bacteria 12220
138 Ga0157370_10017005 3300013104 Bacteria 7350
139 Ga0157370_10028244 3300013104 Bacteria 5522
140 Ga0157370_10034497 3300013104 Bacteria 4926
141 Ga0157369_10054380 3300013105 Bacteria 4324
142 Ga0157369_10062032 3300013105 Bacteria 4029
143 Ga0157374_10001160 3300013296 Bacteria 22449
144 Ga0157374_10155418 3300013296 Bacteria 2226
145 Ga0157378_10001960 3300013297 Bacteria 18450
146 Ga0157378_10159223 3300013297 Bacteria 2110
147 Ga0163162_10001182 3300013306 Bacteria 24341
148 Ga0163162_10145389 3300013306 Bacteria 2487
149 Ga0163162_10343938 3300013306 Bacteria 1624
150 Ga0157372_10017474 3300013307 Bacteria 7699
151 Ga0157372_10019958 3300013307 Bacteria 7225
152 Ga0157372_10025379 3300013307 Bacteria 6443
153 Ga0157372_10118664 3300013307 Bacteria 3035
154 Ga0157375_10052242 3300013308 Bacteria 4017
155 Ga0157375_10233154 3300013308 Bacteria 2000
156 Ga0157376_10077753 3300014969 Bacteria 2839
157 Ga0157376_10133676 3300014969 Bacteria 2217
158 Ga0209758_1000048 3300025297 Bacteria 358400
159 Ga0209050_1006121 3300025298 Bacteria 7259
160 Ga0207426_1021514 3300025302 Bacteria 2230
161 Ga0209051_1011972 3300025303 Bacteria 4233
162 Ga0209257_1002078 3300025304 Bacteria 21096
163 Ga0207682_10000669 3300025893 Bacteria 16036
164 Ga0207682_10003715 3300025893 Bacteria 6574
165 Ga0207682_10005127 3300025893 Bacteria 5366
166 Ga0207682_10030146 3300025893 Bacteria 2171
167 Ga0207680_10077894 3300025903 Bacteria 2075
168 Ga0207699_10037307 3300025906 Bacteria 2777
169 Ga0207645_10070539 3300025907 Bacteria 2235
170 Ga0207705_10115478 3300025909 Bacteria 1987
171 Ga0207707_10033535 3300025912 Bacteria 4492
172 Ga0207707_10109259 3300025912 Bacteria 2418
173 Ga0207707_10336067 3300025912 Bacteria 1303
174 Ga0207695_10272244 3300025913 Bacteria 1589
175 Ga0207671_10154852 3300025914 Bacteria 1772
176 Ga0207663_10092281 3300025916 Unclassified 2013
177 Ga0207660_10018407 3300025917 Bacteria 4656
178 Ga0207662_10031838 3300025918 Bacteria 3066
179 Ga0207657_10045087 3300025919 Bacteria 3872
180 Ga0207649_10003991 3300025920 Bacteria 8039
181 Ga0207649_10036315 3300025920 Bacteria 2967
182 Ga0207649_10071670 3300025920 Bacteria 2214
183 Ga0207652_10016288 3300025921 Bacteria 6068
184 Ga0207652_10055595 3300025921 Bacteria 3405
185 Ga0207652_10146542 3300025921 Bacteria 2113
186 Ga0207652_10221838 3300025921 Bacteria 1703
187 Ga0207681_10051907 3300025923 Bacteria 2779
188 Ga0207650_10003442 3300025925 Bacteria 10879
189 Ga0207650_10217831 3300025925 Bacteria 1535
190 Ga0207659_10018058 3300025926 Unclassified 4618
191 Ga0207700_10033167 3300025928 Bacteria 3693
192 Ga0207700_10051888 3300025928 Bacteria 3064
193 Ga0207664_10048909 3300025929 Bacteria 3327
194 Ga0207664_10123969 3300025929 Bacteria 2167
195 Ga0207644_10002302 3300025931 Bacteria 12387
196 Ga0207644_10006702 3300025931 Bacteria 7500
197 Ga0207644_10008793 3300025931 Bacteria 6610
198 Ga0207644_10042277 3300025931 Bacteria 3229
199 Ga0207690_10092858 3300025932 Bacteria 2137
200 Ga0207706_10076868 3300025933 Bacteria 2936
201 Ga0207706_10119179 3300025933 Bacteria 2320
202 Ga0207709_10015272 3300025935 Bacteria 4257
203 Ga0207665_10100480 3300025939 Bacteria 2018
204 Ga0207691_10000795 3300025940 Bacteria 31353
205 Ga0207691_10015171 3300025940 Bacteria 7332
206 Ga0207691_10066596 3300025940 Bacteria 3258
207 Ga0207711_10003034 3300025941 Bacteria 14671
208 Ga0207711_10083783 3300025941 Bacteria 2789
209 Ga0207711_10226478 3300025941 Unclassified 1712
210 Ga0207661_10053662 3300025944 Bacteria 3226
211 Ga0207679_10098787 3300025945 Bacteria 2277
212 Ga0207679_10128527 3300025945 Bacteria 2029
213 Ga0207679_10302818 3300025945 Bacteria 1378
214 Ga0207667_10070774 3300025949 Bacteria 3630
215 Ga0207667_10182602 3300025949 Bacteria 2154
216 Ga0207651_10003598 3300025960 Bacteria 7629
217 Ga0207668_10176248 3300025972 Bacteria 1682
218 Ga0207640_10029012 3300025981 Bacteria 3390
219 Ga0207658_10034494 3300025986 Bacteria 3617
220 Ga0207678_10114973 3300026067 Bacteria 2295
221 Ga0207678_10261376 3300026067 Bacteria 1483
222 Ga0207708_10049475 3300026075 Bacteria 3201
223 Ga0207708_10056717 3300026075 Bacteria 2988
224 Ga0207702_10060721 3300026078 Bacteria 3223
225 Ga0207702_10229804 3300026078 Bacteria 1733
226 Ga0207641_10006725 3300026088 Bacteria 9634
227 Ga0207641_10031938 3300026088 Bacteria 4370
228 Ga0207641_10125973 3300026088 Bacteria 2293
229 Ga0207641_10139252 3300026088 Bacteria 2187
230 Ga0207648_10025440 3300026089 Bacteria 5272
231 Ga0207648_10028748 3300026089 Bacteria 4928
232 Ga0207648_10045773 3300026089 Bacteria 3837
233 Ga0207648_10150680 3300026089 Bacteria 2052
234 Ga0207676_10006191 3300026095 Bacteria 8452
235 Ga0207676_10026972 3300026095 Bacteria 4274
236 Ga0207674_10139614 3300026116 Bacteria 2383
237 Ga0207674_10221093 3300026116 Bacteria 1842
238 Ga0207675_100036293 3300026118 Bacteria 4599
239 Ga0207675_100276503 3300026118 Bacteria 1631
240 Ga0207683_10009673 3300026121 Bacteria 8217
241 Ga0207683_10326786 3300026121 Bacteria 1405
242 Ga0207698_10000652 3300026142 Bacteria 20065
243 Ga0207698_10087021 3300026142 Bacteria 2543
244 Ga0207428_10020070 3300027907 Bacteria 5686
245 Ga0207428_10030808 3300027907 Bacteria 4432
246 Ga0207428_10223420 3300027907 Unclassified 1411
247 Ga0268265_10040777 3300028380 Bacteria 3430
248 Ga0268264_10158955 3300028381 Unclassified 2033
249 Ga0265338_10042706 3300028800 Bacteria 4218
250 Ga0307511_10000248 3300030521 Bacteria 55337
251 Ga0265762_1009616 3300030760 Bacteria 1724
252 Ga0265760_10014998 3300031090 Bacteria 2220
253 Ga0265330_10010716 3300031235 Unclassified 4312
254 Ga0265332_10002254 3300031238 Bacteria 9891
255 Ga0265328_10005908 3300031239 Bacteria 5220
256 Ga0265320_10010368 3300031240 Bacteria 5555
257 Ga0265329_10011751 3300031242 Unclassified 3173
258 Ga0265331_10001066 3300031250 Bacteria 21375
259 Ga0265331_10002763 3300031250 Bacteria 11656
260 Ga0265327_10059852 3300031251 Bacteria 1949
261 Ga0265316_10018194 3300031344 Bacteria 6046
262 Ga0307513_10157146 3300031456 Bacteria 2172
263 Ga0265313_10006984 3300031595 Bacteria 7830
264 Ga0307508_10157849 3300031616 Bacteria 1872
265 Ga0265314_10000550 3300031711 Bacteria 47939
266 Ga0265342_10006978 3300031712 Bacteria 8348
267 Ga0307410_10033531 3300031852 Bacteria 3316
268 Ga0307409_100064926 3300031995 Bacteria 2870
269 Ga0373939_0005703 3300035114 Bacteria 2968
270 Ga0373954_0006778 3300035118 Bacteria 4998
271 Ga0373957_0024882 3300035120 Bacteria 2153
272 Ga0373943_0003218 3300035170 Bacteria 7410
273 Ga0373946_0001105 3300035171 Bacteria 9319
274 Ga0373955_0000069 3300035172 Bacteria 41106
275 Ga0373931_0000223 3300035691 Bacteria 24125
276 Ga0373931_0000871 3300035691 Bacteria 12737
277 Ga0373935_0000207 3300035692 Bacteria 28322
278 Ga0373935_0112758 3300035692 Bacteria 1807
279 Ga0373927_0078860 3300035695 Bacteria 2133
280 Ga0373933_0056918 3300035724 Bacteria 2348
281 Ga0373947_0001477 3300035725 Bacteria 14458
282 Ga0373947_0053193 3300035725 Bacteria 2441
283 Ga0373947_0125309 3300035725 Bacteria 1635
284 Ga0373937_0131046 3300036401 Unclassified 2342
285 Ga0373925_0000462 3300037068 Bacteria 40936
286 Ga0373925_0145952 3300037068 Bacteria 1855
287 Ga0395899_0065900 3300037312 Bacteria 2661
288 Ga0395900_0436869 3300037418 Bacteria 1267
289 Ga0395898_0005901 3300037466 Bacteria 13168
290 Ga0395905_0130251 3300037471 Bacteria 2366
291 Ga0395901_0073529 3300038443 Bacteria 3565
292 Ga0395901_0294030 3300038443 Bacteria 1685
293 Ga0436365_0390031 3300039437 Bacteria 4262
294 Ga0436365_1129988 3300039437 Bacteria 1319
295 Ga0451807_0874119 3300041486 Bacteria 1553
296 Ga0439450_024429 3300042008 Bacteria 1318
297 Ga0466969_0021597 3300044656 Bacteria 3327
298 Ga0466977_0000543 3300044666 Bacteria 12657
299 Ga0451576_0258201 3300045051 Unclassified 1821
300 Ga0451576_0276940 3300045051 Bacteria 1754
301 Ga0466967_0032259 3300045976 Bacteria 4421
302 Ga0495592_0000090 3300046454 Bacteria 80171
303 Ga0495592_0000943 3300046454 Bacteria 20225
304 Ga0495592_0222805 3300046454 Bacteria 1260
305 Ga0495603_0228005 3300046455 Bacteria 1074
306 Ga0495590_0058792 3300046457 Bacteria 1345
307 Ga0495629_0193944 3300046459 Bacteria 1405
308 Ga0495638_0156009 3300046460 Bacteria 1320
309 Ga0495651_0000396 3300046462 Bacteria 33745
310 Ga0495651_0148298 3300046462 Bacteria 1694
311 Ga0495653_0000107 3300046463 Bacteria 69282
312 Ga0495662_0119205 3300046476 Bacteria 1295
313 Ga0495664_0000078 3300046477 Bacteria 47377
314 Ga0495594_0097409 3300046499 Bacteria 1653
315 Ga0495607_0001040 3300046501 Bacteria 25446
316 Ga0495608_0000022 3300046511 Bacteria 165111
317 Ga0495618_0000229 3300046514 Bacteria 40948
318 Ga0495628_0000035 3300046516 Bacteria 111560
319 Ga0495628_0006936 3300046516 Bacteria 9836
320 Ga0495630_0000377 3300046517 Bacteria 35153
321 Ga0495652_0000062 3300046529 Bacteria 111572
322 Ga0495652_0017912 3300046529 Bacteria 6322
323 Ga0495652_0150685 3300046529 Bacteria 1818
324 Ga0495640_0000021 3300046533 Bacteria 110511
325 Ga0495640_0086234 3300046533 Bacteria 2079
326 Ga0495587_0000006 3300046536 Bacteria 310070
327 Ga0495598_0010526 3300046537 Bacteria 2217
328 Ga0495645_0000174 3300046543 Bacteria 44827
329 Ga0495645_0005540 3300046543 Bacteria 8682
330 Ga0495667_0000161 3300046559 Bacteria 45781
331 Ga0495667_0063308 3300046559 Unclassified 2421
332 Ga0495668_0049321 3300046616 Bacteria 2335
333 Ga0495634_0000350 3300046642 Bacteria 44772
334 Ga0495634_0067970 3300046642 Bacteria 2355
335 Ga0495625_0014832 3300046660 Bacteria 6201
336 Ga0495635_0000018 3300046663 Bacteria 193591
337 Ga0495657_0000245 3300046675 Bacteria 49381
338 Ga0495599_0000032 3300046678 Bacteria 108178
339 Ga0495599_0001884 3300046678 Bacteria 12152
340 Ga0495623_0000099 3300046679 Bacteria 52531
341 Ga0495646_0000083 3300046680 Bacteria 45193
342 Ga0495646_0003480 3300046680 Bacteria 9799
343 Ga0495658_0014971 3300046683 Bacteria 3974
344 Ga0495613_0041213 3300046689 Bacteria 3420
345 Ga0495613_0124274 3300046689 Bacteria 1851
346 Ga0495624_0012820 3300046690 Bacteria 5722
347 Ga0495600_0000022 3300046809 Bacteria 94789
348 Ga0495604_0000011 3300047317 Bacteria 292024
349 Ga0495604_0026472 3300047317 Unclassified 4617
350 Ga0495674_0000034 3300047319 Bacteria 110674
351 Ga0495674_0030598 3300047319 Bacteria 4894
352 Ga0495672_0090114 3300047320 Unclassified 1686
353 Ga0495676_0133937 3300047321 Bacteria 1785
354 Ga0495676_0169206 3300047321 Bacteria 1539
355 Ga0495680_0000290 3300047322 Bacteria 56506
356 Ga0495675_0001346 3300047444 Bacteria 14899
357 Ga0495684_0000012 3300047471 Bacteria 187118
358 Ga0495593_0009543 3300047673 Bacteria 5631
359 Ga0495602_0000064 3300048088 Bacteria 104858
360 Ga0496100_0028308 3300048903 Bacteria 3456
361 Ga0496100_0062736 3300048903 Bacteria 2454
362 Ga0496100_0230093 3300048903 Bacteria 1364
363 Ga0496101_0163369 3300048904 Unclassified 1709
364 Ga0496102_0077261 3300048905 Bacteria 3064
365 Ga0496102_0124031 3300048905 Bacteria 2414
366 Ga0496104_0070372 3300048907 Bacteria 3326
367 Ga0496104_0096728 3300048907 Bacteria 2825
368 Ga0496105_0355322 3300048908 Bacteria 1170
369 Ga0496107_0071764 3300048910 Bacteria 2517
370 Ga0496108_0004199 3300048911 Bacteria 11603
371 Ga0496109_0004052 3300048912 Bacteria 12243
372 Ga0496109_0164432 3300048912 Bacteria 2080
373 Ga0496109_0305866 3300048912 Bacteria 1500
374 Ga0496110_0001255 3300048913 Bacteria 18140
375 Ga0496114_0064109 3300048917 Bacteria 3077
376 Ga0496115_0077852 3300048918 Unclassified 2697
377 Ga0496115_0209318 3300048918 Unclassified 1611
378 Ga0496121_0000178 3300048924 Bacteria 141429
379 Ga0496121_0058408 3300048924 Bacteria 3189
380 Ga0501031_0070679 3300049568 Bacteria 2274
381 Ga0501032_0000430 3300049569 Bacteria 34776
382 Ga0501033_0005727 3300049570 Bacteria 9799
383 Ga0501034_0013536 3300049571 Bacteria 8396
384 Ga0501034_0031580 3300049571 Bacteria 5380
385 Ga0501034_0036651 3300049571 Bacteria 4966
386 Ga0501034_0040424 3300049571 Bacteria 4721
387 Ga0501034_0308747 3300049571 Bacteria 1517
388 Ga0501034_0331840 3300049571 Bacteria 1452
389 Ga0501036_0092600 3300049572 Bacteria 2553
390 Ga0501038_0003181 3300049574 Bacteria 15308
391 Ga0501039_0001639 3300049575 Bacteria 16499
392 Ga0501043_0002280 3300049579 Bacteria 16309
393 Ga0501046_0002162 3300049580 Bacteria 18558
394 Ga0501046_0077214 3300049580 Bacteria 2579
395 Ga0501047_0006001 3300049581 Bacteria 11416
396 Ga0501047_0037269 3300049581 Bacteria 4701
397 Ga0501048_0011230 3300049582 Bacteria 6678
398 Ga0501067_0007368 3300049583 Bacteria 6111
399 Ga0501067_0022466 3300049583 Bacteria 3491
400 Ga0501068_0003340 3300049584 Bacteria 8612
401 Ga0501069_0000959 3300049585 Bacteria 13746
402 Ga0501070_0001304 3300049586 Bacteria 22381
403 Ga0501070_0029166 3300049586 Bacteria 4628
404 Ga0501070_0035858 3300049586 Bacteria 4142
405 Ga0501071_0045587 3300049587 Bacteria 3148
406 Ga0501071_0204479 3300049587 Bacteria 1484
407 Ga0501072_0019996 3300049588 Bacteria 5184
408 Ga0501072_0292656 3300049588 Bacteria 1295
409 Ga0501073_0003837 3300049589 Bacteria 11278
410 Ga0501073_0005180 3300049589 Bacteria 9777
411 Ga0501073_0017695 3300049589 Bacteria 5159
412 Ga0501073_0069722 3300049589 Bacteria 2449
413 Ga0501074_0045536 3300049590 Bacteria 3174
414 Ga0501074_0060895 3300049590 Bacteria 2719
415 Ga0501076_0146632 3300049592 Bacteria 1919
416 Ga0501077_0176404 3300049593 Bacteria 1358
417 Ga0501080_0000865 3300049742 Bacteria 24819
418 Ga0501080_0006728 3300049742 Bacteria 10353
419 Ga0501080_0055195 3300049742 Bacteria 3700
420 Ga0501083_0011242 3300049744 Bacteria 6281
421 Ga0501083_0034488 3300049744 Bacteria 3460
422 Ga0501035_0038714 3300049822 Bacteria 4316
423 Ga0501035_0145387 3300049822 Bacteria 2060
424 Ga0501044_0004358 3300049823 Bacteria 15851
425 Ga0501044_0038572 3300049823 Bacteria 4988
426 Ga0501044_0086261 3300049823 Bacteria 3171
427 Ga0501044_0102196 3300049823 Bacteria 2883
428 Ga0501045_0104295 3300049824 Bacteria 2101
429 nmdc:mga03n38_26112_c1 3300050490 Bacteria 2408
430 nmdc:mga0yw44_22273_c1 3300050492 Bacteria 3551
431 nmdc:mga0k408_79710_c1 3300050493 Bacteria 1916
432 nmdc:mga06z11_15464_c1 3300050494 Bacteria 3407
433 nmdc:mga09592_22020_c1 3300050508 Bacteria 5258
434 nmdc:mga09592_5537_c1 3300050508 Bacteria 10277
435 nmdc:mga0qj67_3350_c1 3300050509 Bacteria 11548
436 nmdc:mga0qj67_45817_c1 3300050509 Bacteria 3450
437 nmdc:mga06r32_93391_c1 3300050510 Bacteria 2943
438 nmdc:mga08y16_158_c1 3300050511 Bacteria 58796
439 nmdc:mga08y16_215988_c1 3300050511 Bacteria 1986
440 nmdc:mga08y16_45031_c1 3300050511 Bacteria 4623
441 nmdc:mga08y16_488416_c1 3300050511 Bacteria 1252
442 nmdc:mga08y16_90765_c1 3300050511 Bacteria 3185
443 nmdc:mga08y16_99968_c1 3300050511 Bacteria 3020
444 nmdc:mga0n895_153844_c1 3300050512 Bacteria 2330
445 nmdc:mga0n895_22661_c1 3300050512 Bacteria 5890
446 nmdc:mga0n895_367096_c1 3300050512 Bacteria 1457
447 nmdc:mga0n895_6459_c1 3300050512 Bacteria 9956
448 nmdc:mga0rr50_15967_c1 3300050513 Bacteria 4972
449 nmdc:mga0rr50_191200_c1 3300050513 Unclassified 1677
450 nmdc:mga0a205_615_c1 3300050515 Bacteria 28354
451 Ga0495601_0000015 3300053077 Bacteria 213851
452 Ga0495601_0000975 3300053077 Bacteria 15631
453 Ga0495601_0006087 3300053077 Bacteria 7038
454 Ga0495601_0006974 3300053077 Bacteria 6617
455 Ga0495601_0008373 3300053077 Bacteria 6110
456 Ga0495601_0136427 3300053077 Unclassified 1599
457 Ga0495612_0000016 3300053078 Bacteria 158947
458 Ga0495595_0000035 3300053084 Bacteria 79822
459 Ga0495619_0000044 3300053085 Bacteria 108581
460 Ga0495619_0014441 3300053085 Bacteria 4988
461 Ga0495619_0034652 3300053085 Bacteria 3283
462 Ga0500644_0093667 3300053088 Bacteria 1129
463 Ga0500646_0000701 3300053090 Bacteria 9561
464 Ga0500583_0008191 3300053092 Bacteria 3733
465 Ga0500651_0042725 3300053093 Bacteria 2856
466 Ga0500641_0001747 3300053096 Bacteria 7706
467 Ga0500641_0032759 3300053096 Bacteria 2058
468 Ga0500555_019986 3300053103 Bacteria 1930
469 Ga0500562_014613 3300053108 Unclassified 2011
470 Ga0500595_001053 3300053119 Bacteria 15351
471 Ga0500595_001690 3300053119 Bacteria 11582
472 Ga0500595_015130 3300053119 Bacteria 2900
473 Ga0500652_000124 3300053131 Bacteria 29312
474 Ga0500658_0011030 3300053134 Bacteria 3332
475 Ga0500568_0019716 3300053139 Bacteria 2925
476 Ga0500568_0036628 3300053139 Bacteria 1995
477 Ga0500577_0069908 3300053142 Bacteria 1374
478 Ga0500604_0000505 3300053151 Bacteria 10786
479 Ga0500604_0009634 3300053151 Bacteria 2574
480 Ga0500616_0000859 3300053153 Bacteria 33743
481 Ga0500616_0008194 3300053153 Bacteria 6524
482 Ga0500616_0033106 3300053153 Bacteria 2822
483 Ga0500611_001537 3300053727 Bacteria 2565
484 Ga0500609_000267 3300053731 Bacteria 7589
485 Ga0501084_0135616 3300054114 Bacteria 2072
486 Ga0501084_0218215 3300054114 Bacteria 1609
487 Ga0501082_0002268 3300060353 Bacteria 16847
488 Ga0501082_0006905 3300060353 Bacteria 9819
489 Ga0501082_0022036 3300060353 Bacteria 5493

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0071764 Ga0496107_0071764_540_1616 302
2 3300048908 Ga0496105_0355322 Ga0496105_0355322_101_1150 320
3 3300048903 Ga0496100_0028308 Ga0496100_0028308_628_1677 322
4 3300048905 Ga0496102_0124031 Ga0496102_0124031_204_1340 323
5 3300048907 Ga0496104_0070372 Ga0496104_0070372_1047_2183 323
6 3300009174 Ga0105241_10009946 Ga0105241_100099466 325
7 3300009545 Ga0105237_10033362 Ga0105237_100333623 325
8 3300009551 Ga0105238_10066762 Ga0105238_100667622 325
9 3300010375 Ga0105239_10101030 Ga0105239_101010303 325
10 3300013100 Ga0157373_10002490 Ga0157373_100024905 325
11 3300013102 Ga0157371_10009207 Ga0157371_100092076 325
12 3300037418 Ga0395900_0436869 Ga0395900_0436869_103_1137 325
13 3300037471 Ga0395905_0130251 Ga0395905_0130251_1149_2183 325
14 3300038443 Ga0395901_0294030 Ga0395901_0294030_394_1428 325
15 3300035695 Ga0373927_0078860 Ga0373927_0078860_994_2028 326
16 3300035725 Ga0373947_0053193 Ga0373947_0053193_1361_2395 326
17 3300035725 Ga0373947_0125309 Ga0373947_0125309_228_1262 326
18 3300046455 Ga0495603_0228005 Ga0495603_0228005_16_1050 326
19 3300046459 Ga0495629_0193944 Ga0495629_0193944_281_1315 326
20 3300046476 Ga0495662_0119205 Ga0495662_0119205_126_1160 326
21 3300046642 Ga0495634_0067970 Ga0495634_0067970_1016_2050 326
22 3300047321 Ga0495676_0169206 Ga0495676_0169206_464_1498 326
23 3300053077 Ga0495601_0006974 Ga0495601_0006974_4890_5924 326
24 3300053077 Ga0495601_0008373 Ga0495601_0008373_589_1623 326
25 3300053085 Ga0495619_0034652 Ga0495619_0034652_1725_2759 326
26 3300053088 Ga0500644_0093667 Ga0500644_0093667_61_1092 326
27 3300005457 Ga0070662_100064219 Ga0070662_1000642193 327
28 3300005367 Ga0070667_100329228 Ga0070667_1003292281 330
29 3300049593 Ga0501077_0176404 Ga0501077_0176404_231_1340 330
30 3300006038 Ga0075365_10067801 Ga0075365_100678012 331
31 3300006178 Ga0075367_10055815 Ga0075367_100558151 331
32 3300031090 Ga0265760_10014998 Ga0265760_100149982 331
33 3300048903 Ga0496100_0230093 Ga0496100_0230093_74_1192 331
34 3300050490 nmdc:mga03n38_26112_c1 nmdc:mga03n38_26112_c1_896_2035 331
35 3300046457 Ga0495590_0058792 Ga0495590_0058792_53_1162 332
36 3300046683 Ga0495658_0014971 Ga0495658_0014971_353_1462 332
37 3300050511 nmdc:mga08y16_488416_c1 nmdc:mga08y16_488416_c1_35_1132 332
38 3300046499 Ga0495594_0097409 Ga0495594_0097409_124_1233 333
39 3300031995 Ga0307409_100064926 Ga0307409_1000649261 334
40 3300050508 nmdc:mga09592_22020_c1 nmdc:mga09592_22020_c1_904_2148 334
41 3300050509 nmdc:mga0qj67_45817_c1 nmdc:mga0qj67_45817_c1_273_1517 334
42 3300050510 nmdc:mga06r32_93391_c1 nmdc:mga06r32_93391_c1_729_1973 334
43 3300009147 Ga0114129_10288571 Ga0114129_102885712 335
44 3300005841 Ga0068863_100033581 Ga0068863_1000335814 336
45 3300005983 Ga0081540_1020488 Ga0081540_10204884 336
46 3300006871 Ga0075434_100072564 Ga0075434_1000725643 336
47 3300007076 Ga0075435_100195109 Ga0075435_1001951091 336
48 3300009094 Ga0111539_10105348 Ga0111539_101053484 336
49 3300026088 Ga0207641_10031938 Ga0207641_100319381 336
50 3300027907 Ga0207428_10223420 Ga0207428_102234201 336
51 3300039437 Ga0436365_0390031 Ga0436365_0390031_2416_3480 336
52 3300048904 Ga0496101_0163369 Ga0496101_0163369_553_1662 336
53 3300050511 nmdc:mga08y16_215988_c1 nmdc:mga08y16_215988_c1_75_1184 336
54 3300050512 nmdc:mga0n895_22661_c1 nmdc:mga0n895_22661_c1_3098_4207 336
55 3300009094 Ga0111539_10095929 Ga0111539_100959293 338
56 3300050512 nmdc:mga0n895_367096_c1 nmdc:mga0n895_367096_c1_193_1317 340
57 3300009177 Ga0105248_10411569 Ga0105248_104115692 341
58 3300041486 Ga0451807_0874119 Ga0451807_0874119_200_1327 341
59 3300006173 Ga0070716_100082008 Ga0070716_1000820082 342
60 3300025928 Ga0207700_10051888 Ga0207700_100518883 342
61 3300025939 Ga0207665_10100480 Ga0207665_101004802 342
62 3300039437 Ga0436365_1129988 Ga0436365_1129988_19_1134 342
63 3300048905 Ga0496102_0077261 Ga0496102_0077261_699_1802 342
64 3300048917 Ga0496114_0064109 Ga0496114_0064109_695_1798 342
65 3300049571 Ga0501034_0331840 Ga0501034_0331840_181_1311 343
66 3300006042 Ga0075368_10014645 Ga0075368_100146452 344
67 3300045051 Ga0451576_0258201 Ga0451576_0258201_556_1671 344
68 3300050494 nmdc:mga06z11_15464_c1 nmdc:mga06z11_15464_c1_1884_3008 344
69 3300053119 Ga0500595_001053 Ga0500595_001053_5627_6799 344
70 3300005328 Ga0070676_10035582 Ga0070676_100355822 345
71 3300026067 Ga0207678_10261376 Ga0207678_102613761 345
72 3300048924 Ga0496121_0058408 Ga0496121_0058408_878_2002 345
73 3300047320 Ga0495672_0090114 Ga0495672_0090114_206_1342 346
74 3300048924 Ga0496121_0000178 Ga0496121_0000178_131649_132845 346
75 3300049587 Ga0501071_0204479 Ga0501071_0204479_135_1247 346
76 3300049822 Ga0501035_0145387 Ga0501035_0145387_721_1833 346
77 3300053119 Ga0500595_001690 Ga0500595_001690_1044_2180 346
78 3300053139 Ga0500568_0036628 Ga0500568_0036628_386_1522 346
79 iso_pu_bacteria 2643221651 2644289090 346
80 iso_pu_bacteria 2828305725 2828307089 346
81 3300005333 Ga0070677_10057527 Ga0070677_100575272 347
82 3300005344 Ga0070661_100154020 Ga0070661_1001540201 347
83 3300005364 Ga0070673_100170668 Ga0070673_1001706682 347
84 3300005937 Ga0081455_10000712 Ga0081455_1000071229 347
85 3300005937 Ga0081455_10012401 Ga0081455_100124018 347
86 3300009093 Ga0105240_10107754 Ga0105240_101077542 347
87 3300009545 Ga0105237_10221797 Ga0105237_102217972 347
88 3300013104 Ga0157370_10017005 Ga0157370_100170052 347
89 3300013307 Ga0157372_10025379 Ga0157372_100253793 347
90 3300025893 Ga0207682_10030146 Ga0207682_100301462 347
91 3300025907 Ga0207645_10070539 Ga0207645_100705391 347
92 3300025913 Ga0207695_10272244 Ga0207695_102722442 347
93 3300025914 Ga0207671_10154852 Ga0207671_101548522 347
94 3300025925 Ga0207650_10217831 Ga0207650_102178312 347
95 3300025933 Ga0207706_10076868 Ga0207706_100768681 347
96 3300026089 Ga0207648_10150680 Ga0207648_101506802 347
97 3300026121 Ga0207683_10326786 Ga0207683_103267862 347
98 3300028800 Ga0265338_10042706 Ga0265338_100427065 347
99 3300031616 Ga0307508_10157849 Ga0307508_101578493 347
100 3300042008 Ga0439450_024429 Ga0439450_024429_124_1239 347
101 3300050509 nmdc:mga0qj67_3350_c1 nmdc:mga0qj67_3350_c1_2147_3256 347
102 3300053092 Ga0500583_0008191 Ga0500583_0008191_1690_2814 347
103 3300005341 Ga0070691_10086818 Ga0070691_100868182 348
104 3300005441 Ga0070700_100004919 Ga0070700_1000049196 348
105 3300005545 Ga0070695_100006935 Ga0070695_1000069352 348
106 3300005719 Ga0068861_100045918 Ga0068861_1000459182 348
107 3300009147 Ga0114129_10092910 Ga0114129_100929104 348
108 3300026075 Ga0207708_10056717 Ga0207708_100567172 348
109 3300026118 Ga0207675_100276503 Ga0207675_1002765032 348
110 3300035118 Ga0373954_0006778 Ga0373954_0006778_3657_4781 348
111 3300035120 Ga0373957_0024882 Ga0373957_0024882_347_1471 348
112 3300035170 Ga0373943_0003218 Ga0373943_0003218_3608_4732 348
113 3300035171 Ga0373946_0001105 Ga0373946_0001105_7752_8876 348
114 3300035172 Ga0373955_0000069 Ga0373955_0000069_16668_17792 348
115 3300035692 Ga0373935_0000207 Ga0373935_0000207_6318_7442 348
116 3300035724 Ga0373933_0056918 Ga0373933_0056918_906_2030 348
117 3300035725 Ga0373947_0001477 Ga0373947_0001477_4487_5611 348
118 3300037068 Ga0373925_0000462 Ga0373925_0000462_402_1526 348
119 3300044656 Ga0466969_0021597 Ga0466969_0021597_2156_3286 348
120 3300044666 Ga0466977_0000543 Ga0466977_0000543_8127_9257 348
121 3300046454 Ga0495592_0000090 Ga0495592_0000090_39392_40516 348
122 3300046462 Ga0495651_0000396 Ga0495651_0000396_19612_20736 348
123 3300046463 Ga0495653_0000107 Ga0495653_0000107_67729_68853 348
124 3300046477 Ga0495664_0000078 Ga0495664_0000078_4570_5694 348
125 3300046511 Ga0495608_0000022 Ga0495608_0000022_122304_123428 348
126 3300046514 Ga0495618_0000229 Ga0495618_0000229_422_1546 348
127 3300046516 Ga0495628_0000035 Ga0495628_0000035_70128_71252 348
128 3300046517 Ga0495630_0000377 Ga0495630_0000377_30974_32098 348
129 3300046529 Ga0495652_0000062 Ga0495652_0000062_70140_71264 348
130 3300046533 Ga0495640_0000021 Ga0495640_0000021_41684_42808 348
131 3300046536 Ga0495587_0000006 Ga0495587_0000006_70140_71264 348
132 3300046543 Ga0495645_0000174 Ga0495645_0000174_4293_5417 348
133 3300046559 Ga0495667_0000161 Ga0495667_0000161_4349_5473 348
134 3300046642 Ga0495634_0000350 Ga0495634_0000350_39383_40507 348
135 3300046663 Ga0495635_0000018 Ga0495635_0000018_153057_154181 348
136 3300046675 Ga0495657_0000245 Ga0495657_0000245_8857_9981 348
137 3300046678 Ga0495599_0000032 Ga0495599_0000032_67740_68864 348
138 3300046679 Ga0495623_0000099 Ga0495623_0000099_267_1391 348
139 3300046680 Ga0495646_0000083 Ga0495646_0000083_39711_40835 348
140 3300046690 Ga0495624_0012820 Ga0495624_0012820_537_1661 348
141 3300046809 Ga0495600_0000022 Ga0495600_0000022_51982_53106 348
142 3300047317 Ga0495604_0000011 Ga0495604_0000011_39411_40535 348
143 3300047319 Ga0495674_0000034 Ga0495674_0000034_70140_71264 348
144 3300047322 Ga0495680_0000290 Ga0495680_0000290_39404_40528 348
145 3300047444 Ga0495675_0001346 Ga0495675_0001346_4350_5474 348
146 3300047471 Ga0495684_0000012 Ga0495684_0000012_144426_145550 348
147 3300047673 Ga0495593_0009543 Ga0495593_0009543_498_1622 348
148 3300048088 Ga0495602_0000064 Ga0495602_0000064_39411_40535 348
149 3300048918 Ga0496115_0209318 Ga0496115_0209318_175_1284 348
150 3300053077 Ga0495601_0000015 Ga0495601_0000015_39411_40535 348
151 3300053078 Ga0495612_0000016 Ga0495612_0000016_1645_2769 348
152 3300053084 Ga0495595_0000035 Ga0495595_0000035_39345_40469 348
153 3300053085 Ga0495619_0000044 Ga0495619_0000044_39711_40835 348
154 3300005458 Ga0070681_10238338 Ga0070681_102383382 349
155 3300005530 Ga0070679_100068710 Ga0070679_1000687104 349
156 3300006195 Ga0075366_10053400 Ga0075366_100534003 349
157 3300006852 Ga0075433_10000352 Ga0075433_100003526 349
158 3300006871 Ga0075434_100002220 Ga0075434_10000222010 349
159 3300007076 Ga0075435_100061303 Ga0075435_1000613032 349
160 3300009094 Ga0111539_10017007 Ga0111539_100170072 349
161 3300013306 Ga0163162_10343938 Ga0163162_103439381 349
162 3300025912 Ga0207707_10336067 Ga0207707_103360671 349
163 3300026067 Ga0207678_10114973 Ga0207678_101149733 349
164 3300035114 Ga0373939_0005703 Ga0373939_0005703_51_1172 349
165 3300035691 Ga0373931_0000223 Ga0373931_0000223_6982_8103 349
166 3300035691 Ga0373931_0000871 Ga0373931_0000871_423_1544 349
167 3300046689 Ga0495613_0124274 Ga0495613_0124274_413_1543 349
168 3300050493 nmdc:mga0k408_79710_c1 nmdc:mga0k408_79710_c1_654_1778 349
169 3300050512 nmdc:mga0n895_6459_c1 nmdc:mga0n895_6459_c1_2347_3468 349
170 3300050513 nmdc:mga0rr50_191200_c1 nmdc:mga0rr50_191200_c1_391_1530 349
171 3300050515 nmdc:mga0a205_615_c1 nmdc:mga0a205_615_c1_14834_15955 349
172 3300053077 Ga0495601_0006087 Ga0495601_0006087_4429_5559 349
173 3300053085 Ga0495619_0014441 Ga0495619_0014441_279_1382 349
174 3300053090 Ga0500646_0000701 Ga0500646_0000701_7870_8994 349
175 3300053103 Ga0500555_019986 Ga0500555_019986_25_1149 349
176 3300053151 Ga0500604_0000505 Ga0500604_0000505_3216_4340 349
177 3300053153 Ga0500616_0033106 Ga0500616_0033106_185_1309 349
178 3300005344 Ga0070661_100091986 Ga0070661_1000919862 350
179 3300005518 Ga0070699_100014314 Ga0070699_1000143142 350
180 3300005535 Ga0070684_100011227 Ga0070684_1000112277 350
181 3300005536 Ga0070697_100287612 Ga0070697_1002876121 350
182 3300005543 Ga0070672_100085721 Ga0070672_1000857212 350
183 3300005546 Ga0070696_100004716 Ga0070696_1000047168 350
184 3300005577 Ga0068857_100049679 Ga0068857_1000496794 350
185 3300005578 Ga0068854_100025784 Ga0068854_1000257843 350
186 3300005616 Ga0068852_100002934 Ga0068852_10000293413 350
187 3300005618 Ga0068864_100027206 Ga0068864_1000272064 350
188 3300006237 Ga0097621_100149543 Ga0097621_1001495432 350
189 3300009093 Ga0105240_10130452 Ga0105240_101304522 350
190 3300009177 Ga0105248_10150600 Ga0105248_101506003 350
191 3300009551 Ga0105238_10007842 Ga0105238_100078425 350
192 3300013105 Ga0157369_10062032 Ga0157369_100620323 350
193 3300014969 Ga0157376_10077753 Ga0157376_100777532 350
194 3300025906 Ga0207699_10037307 Ga0207699_100373072 350
195 3300025920 Ga0207649_10036315 Ga0207649_100363151 350
196 3300025920 Ga0207649_10071670 Ga0207649_100716702 350
197 3300025928 Ga0207700_10033167 Ga0207700_100331672 350
198 3300025929 Ga0207664_10048909 Ga0207664_100489093 350
199 3300025940 Ga0207691_10015171 Ga0207691_100151712 350
200 3300025941 Ga0207711_10083783 Ga0207711_100837833 350
201 3300026088 Ga0207641_10006725 Ga0207641_100067253 350
202 3300026095 Ga0207676_10026972 Ga0207676_100269724 350
203 3300030521 Ga0307511_10000248 Ga0307511_1000024817 350
204 3300031852 Ga0307410_10033531 Ga0307410_100335312 350
205 3300045051 Ga0451576_0276940 Ga0451576_0276940_243_1370 350
206 3300048912 Ga0496109_0164432 Ga0496109_0164432_684_1799 350
207 3300048912 Ga0496109_0305866 Ga0496109_0305866_296_1411 350
208 3300049590 Ga0501074_0045536 Ga0501074_0045536_252_1379 350
209 3300049744 Ga0501083_0034488 Ga0501083_0034488_1468_2598 350
210 3300060353 Ga0501082_0022036 Ga0501082_0022036_987_2117 350
211 3300005336 Ga0070680_100021897 Ga0070680_1000218976 351
212 3300005344 Ga0070661_100102343 Ga0070661_1001023433 351
213 3300005439 Ga0070711_100038364 Ga0070711_1000383642 351
214 3300005458 Ga0070681_10000239 Ga0070681_1000023919 351
215 3300005563 Ga0068855_100196738 Ga0068855_1001967383 351
216 3300005564 Ga0070664_100056332 Ga0070664_1000563323 351
217 3300005577 Ga0068857_100260909 Ga0068857_1002609092 351
218 3300005614 Ga0068856_100000782 Ga0068856_10000078234 351
219 3300005983 Ga0081540_1003490 Ga0081540_10034903 351
220 3300007076 Ga0075435_100010425 Ga0075435_1000104252 351
221 3300013104 Ga0157370_10034497 Ga0157370_100344974 351
222 3300013307 Ga0157372_10017474 Ga0157372_100174748 351
223 3300025912 Ga0207707_10109259 Ga0207707_101092592 351
224 3300025916 Ga0207663_10092281 Ga0207663_100922812 351
225 3300025917 Ga0207660_10018407 Ga0207660_100184076 351
226 3300025921 Ga0207652_10146542 Ga0207652_101465422 351
227 3300025921 Ga0207652_10221838 Ga0207652_102218382 351
228 3300025945 Ga0207679_10098787 Ga0207679_100987872 351
229 3300025949 Ga0207667_10182602 Ga0207667_101826023 351
230 3300026078 Ga0207702_10060721 Ga0207702_100607213 351
231 3300026116 Ga0207674_10221093 Ga0207674_102210932 351
232 3300027907 Ga0207428_10030808 Ga0207428_100308082 351
233 3300031251 Ga0265327_10059852 Ga0265327_100598522 351
234 3300036401 Ga0373937_0131046 Ga0373937_0131046_11_1153 351
235 3300045976 Ga0466967_0032259 Ga0466967_0032259_1286_2416 351
236 3300046454 Ga0495592_0000943 Ga0495592_0000943_6380_7522 351
237 3300046516 Ga0495628_0006936 Ga0495628_0006936_4174_5316 351
238 3300046529 Ga0495652_0017912 Ga0495652_0017912_4882_6024 351
239 3300046543 Ga0495645_0005540 Ga0495645_0005540_4876_6018 351
240 3300046559 Ga0495667_0063308 Ga0495667_0063308_119_1261 351
241 3300046678 Ga0495599_0001884 Ga0495599_0001884_6004_7146 351
242 3300046680 Ga0495646_0003480 Ga0495646_0003480_6122_7264 351
243 3300047317 Ga0495604_0026472 Ga0495604_0026472_2948_4090 351
244 3300048918 Ga0496115_0077852 Ga0496115_0077852_222_1364 351
245 3300049571 Ga0501034_0040424 Ga0501034_0040424_1641_2771 351
246 3300049583 Ga0501067_0007368 Ga0501067_0007368_2024_3154 351
247 3300049586 Ga0501070_0035858 Ga0501070_0035858_2626_3756 351
248 3300049588 Ga0501072_0019996 Ga0501072_0019996_2907_4037 351
249 3300049589 Ga0501073_0005180 Ga0501073_0005180_2490_3620 351
250 3300049742 Ga0501080_0006728 Ga0501080_0006728_4290_5420 351
251 3300050511 nmdc:mga08y16_90765_c1 nmdc:mga08y16_90765_c1_373_1494 351
252 3300050513 nmdc:mga0rr50_15967_c1 nmdc:mga0rr50_15967_c1_2794_3915 351
253 3300053077 Ga0495601_0136427 Ga0495601_0136427_172_1314 351
254 3300005335 Ga0070666_10034880 Ga0070666_100348804 352
255 3300005364 Ga0070673_100046675 Ga0070673_1000466753 352
256 3300005543 Ga0070672_100012904 Ga0070672_1000129044 352
257 3300009177 Ga0105248_10000688 Ga0105248_100006882 352
258 3300013308 Ga0157375_10052242 Ga0157375_100522423 352
259 3300025903 Ga0207680_10077894 Ga0207680_100778942 352
260 3300025920 Ga0207649_10003991 Ga0207649_100039914 352
261 3300025923 Ga0207681_10051907 Ga0207681_100519073 352
262 3300025931 Ga0207644_10006702 Ga0207644_100067022 352
263 3300025932 Ga0207690_10092858 Ga0207690_100928582 352
264 3300025940 Ga0207691_10066596 Ga0207691_100665962 352
265 3300025941 Ga0207711_10003034 Ga0207711_1000303411 352
266 3300025945 Ga0207679_10128527 Ga0207679_101285272 352
267 3300025972 Ga0207668_10176248 Ga0207668_101762482 352
268 3300005327 Ga0070658_10152706 Ga0070658_101527061 353
269 3300005327 Ga0070658_10277323 Ga0070658_102773232 353
270 3300005328 Ga0070676_10144926 Ga0070676_101449262 353
271 3300005329 Ga0070683_100055590 Ga0070683_1000555902 353
272 3300005331 Ga0070670_100000996 Ga0070670_10000099621 353
273 3300005333 Ga0070677_10001885 Ga0070677_100018859 353
274 3300005333 Ga0070677_10050132 Ga0070677_100501322 353
275 3300005338 Ga0068868_100001122 Ga0068868_1000011227 353
276 3300005344 Ga0070661_100073960 Ga0070661_1000739602 353
277 3300005354 Ga0070675_100001356 Ga0070675_1000013569 353
278 3300005354 Ga0070675_100064699 Ga0070675_1000646992 353
279 3300005355 Ga0070671_100000250 Ga0070671_10000025034 353
280 3300005355 Ga0070671_100060882 Ga0070671_1000608822 353
281 3300005364 Ga0070673_100000170 Ga0070673_10000017017 353
282 3300005364 Ga0070673_100072930 Ga0070673_1000729301 353
283 3300005367 Ga0070667_100024941 Ga0070667_1000249414 353
284 3300005367 Ga0070667_100061850 Ga0070667_1000618504 353
285 3300005455 Ga0070663_100198321 Ga0070663_1001983211 353
286 3300005456 Ga0070678_100005833 Ga0070678_1000058333 353
287 3300005456 Ga0070678_100068657 Ga0070678_1000686572 353
288 3300005458 Ga0070681_10055556 Ga0070681_100555563 353
289 3300005459 Ga0068867_100005377 Ga0068867_1000053777 353
290 3300005468 Ga0070707_100111777 Ga0070707_1001117773 353
291 3300005530 Ga0070679_100105657 Ga0070679_1001056572 353
292 3300005535 Ga0070684_100078901 Ga0070684_1000789013 353
293 3300005543 Ga0070672_100000937 Ga0070672_1000009377 353
294 3300005543 Ga0070672_100126541 Ga0070672_1001265412 353
295 3300005563 Ga0068855_100160619 Ga0068855_1001606192 353
296 3300005564 Ga0070664_100002773 Ga0070664_1000027733 353
297 3300005578 Ga0068854_100038849 Ga0068854_1000388492 353
298 3300005616 Ga0068852_100070967 Ga0068852_1000709672 353
299 3300005618 Ga0068864_100037524 Ga0068864_1000375243 353
300 3300005834 Ga0068851_10000353 Ga0068851_100003536 353
301 3300005841 Ga0068863_100167299 Ga0068863_1001672992 353
302 3300005842 Ga0068858_100192075 Ga0068858_1001920752 353
303 3300006237 Ga0097621_100038521 Ga0097621_1000385213 353
304 3300006358 Ga0068871_100000916 Ga0068871_1000009163 353
305 3300009177 Ga0105248_10080445 Ga0105248_100804453 353
306 3300013104 Ga0157370_10028244 Ga0157370_100282446 353
307 3300013105 Ga0157369_10054380 Ga0157369_100543805 353
308 3300013296 Ga0157374_10001160 Ga0157374_1000116021 353
309 3300013296 Ga0157374_10155418 Ga0157374_101554182 353
310 3300013297 Ga0157378_10001960 Ga0157378_1000196015 353
311 3300013306 Ga0163162_10001182 Ga0163162_1000118219 353
312 3300013306 Ga0163162_10145389 Ga0163162_101453892 353
313 3300013308 Ga0157375_10233154 Ga0157375_102331542 353
314 3300014969 Ga0157376_10133676 Ga0157376_101336762 353
315 3300025893 Ga0207682_10003715 Ga0207682_100037153 353
316 3300025893 Ga0207682_10005127 Ga0207682_100051272 353
317 3300025909 Ga0207705_10115478 Ga0207705_101154782 353
318 3300025912 Ga0207707_10033535 Ga0207707_100335354 353
319 3300025921 Ga0207652_10016288 Ga0207652_100162885 353
320 3300025925 Ga0207650_10003442 Ga0207650_1000344210 353
321 3300025926 Ga0207659_10018058 Ga0207659_100180583 353
322 3300025931 Ga0207644_10002302 Ga0207644_1000230212 353
323 3300025931 Ga0207644_10008793 Ga0207644_100087932 353
324 3300025931 Ga0207644_10042277 Ga0207644_100422772 353
325 3300025933 Ga0207706_10119179 Ga0207706_101191792 353
326 3300025935 Ga0207709_10015272 Ga0207709_100152722 353
327 3300025940 Ga0207691_10000795 Ga0207691_1000079522 353
328 3300025941 Ga0207711_10226478 Ga0207711_102264782 353
329 3300025944 Ga0207661_10053662 Ga0207661_100536622 353
330 3300025945 Ga0207679_10302818 Ga0207679_103028181 353
331 3300025960 Ga0207651_10003598 Ga0207651_100035985 353
332 3300025981 Ga0207640_10029012 Ga0207640_100290122 353
333 3300025986 Ga0207658_10034494 Ga0207658_100344942 353
334 3300026075 Ga0207708_10049475 Ga0207708_100494752 353
335 3300026088 Ga0207641_10139252 Ga0207641_101392522 353
336 3300026089 Ga0207648_10025440 Ga0207648_100254404 353
337 3300026089 Ga0207648_10045773 Ga0207648_100457733 353
338 3300026095 Ga0207676_10006191 Ga0207676_100061912 353
339 3300026116 Ga0207674_10139614 Ga0207674_101396142 353
340 3300026118 Ga0207675_100036293 Ga0207675_1000362932 353
341 3300026121 Ga0207683_10009673 Ga0207683_100096736 353
342 3300026142 Ga0207698_10000652 Ga0207698_100006522 353
343 3300026142 Ga0207698_10087021 Ga0207698_100870212 353
344 3300028381 Ga0268264_10158955 Ga0268264_101589552 353
345 3300031235 Ga0265330_10010716 Ga0265330_100107163 353
346 3300031238 Ga0265332_10002254 Ga0265332_1000225410 353
347 3300031239 Ga0265328_10005908 Ga0265328_100059086 353
348 3300031240 Ga0265320_10010368 Ga0265320_100103685 353
349 3300031242 Ga0265329_10011751 Ga0265329_100117512 353
350 3300031250 Ga0265331_10001066 Ga0265331_100010666 353
351 3300031344 Ga0265316_10018194 Ga0265316_100181942 353
352 3300031711 Ga0265314_10000550 Ga0265314_1000055035 353
353 3300031712 Ga0265342_10006978 Ga0265342_100069785 353
354 3300046460 Ga0495638_0156009 Ga0495638_0156009_26_1156 353
355 3300046660 Ga0495625_0014832 Ga0495625_0014832_3673_4791 353
356 3300048907 Ga0496104_0096728 Ga0496104_0096728_93_1247 353
357 3300048911 Ga0496108_0004199 Ga0496108_0004199_6819_7973 353
358 3300048912 Ga0496109_0004052 Ga0496109_0004052_7407_8561 353
359 3300048913 Ga0496110_0001255 Ga0496110_0001255_16378_17532 353
360 3300049571 Ga0501034_0036651 Ga0501034_0036651_206_1438 353
361 3300049571 Ga0501034_0308747 Ga0501034_0308747_178_1293 353
362 3300049580 Ga0501046_0077214 Ga0501046_0077214_648_1775 353
363 3300049581 Ga0501047_0006001 Ga0501047_0006001_10255_11382 353
364 3300049584 Ga0501068_0003340 Ga0501068_0003340_1600_2727 353
365 3300049588 Ga0501072_0292656 Ga0501072_0292656_81_1208 353
366 3300049589 Ga0501073_0017695 Ga0501073_0017695_2734_3861 353
367 3300049823 Ga0501044_0038572 Ga0501044_0038572_2632_3759 353
368 3300050512 nmdc:mga0n895_153844_c1 nmdc:mga0n895_153844_c1_162_1442 353
369 3300053151 Ga0500604_0009634 Ga0500604_0009634_138_1256 353
370 3300053153 Ga0500616_0008194 Ga0500616_0008194_2999_4123 353
371 3300053727 Ga0500611_001537 Ga0500611_001537_837_1955 353
372 3300060353 Ga0501082_0002268 Ga0501082_0002268_8717_9844 353
373 iso_pu_bacteria 2858950400 2858952346 353
374 3300005339 Ga0070660_100013945 Ga0070660_1000139454 354
375 3300005356 Ga0070674_100029324 Ga0070674_1000293241 354
376 3300005435 Ga0070714_100072483 Ga0070714_1000724833 354
377 3300005530 Ga0070679_100071786 Ga0070679_1000717864 354
378 3300005530 Ga0070679_100089789 Ga0070679_1000897893 354
379 3300005563 Ga0068855_100052783 Ga0068855_1000527834 354
380 3300005843 Ga0068860_100143854 Ga0068860_1001438543 354
381 3300005844 Ga0068862_100042529 Ga0068862_1000425295 354
382 3300006048 Ga0075363_100076245 Ga0075363_1000762451 354
383 3300006844 Ga0075428_100012487 Ga0075428_1000124872 354
384 3300006880 Ga0075429_100002797 Ga0075429_1000027973 354
385 3300009094 Ga0111539_10012353 Ga0111539_100123537 354
386 3300009094 Ga0111539_10031280 Ga0111539_100312806 354
387 3300009094 Ga0111539_10115736 Ga0111539_101157362 354
388 3300013104 Ga0157370_10007108 Ga0157370_100071082 354
389 3300013307 Ga0157372_10019958 Ga0157372_100199586 354
390 3300013307 Ga0157372_10118664 Ga0157372_101186642 354
391 3300025919 Ga0207657_10045087 Ga0207657_100450874 354
392 3300025921 Ga0207652_10055595 Ga0207652_100555954 354
393 3300025929 Ga0207664_10123969 Ga0207664_101239692 354
394 3300025949 Ga0207667_10070774 Ga0207667_100707745 354
395 3300026078 Ga0207702_10229804 Ga0207702_102298042 354
396 3300026088 Ga0207641_10125973 Ga0207641_101259732 354
397 3300027907 Ga0207428_10020070 Ga0207428_100200704 354
398 3300046616 Ga0495668_0049321 Ga0495668_0049321_810_1940 354
399 3300048903 Ga0496100_0062736 Ga0496100_0062736_558_1784 354
400 3300050508 nmdc:mga09592_5537_c1 nmdc:mga09592_5537_c1_1269_2504 354
401 3300050511 nmdc:mga08y16_45031_c1 nmdc:mga08y16_45031_c1_3234_4469 354
402 3300050511 nmdc:mga08y16_99968_c1 nmdc:mga08y16_99968_c1_767_1993 354
403 3300053108 Ga0500562_014613 Ga0500562_014613_861_2000 354
404 3300005331 Ga0070670_100246567 Ga0070670_1002465672 355
405 3300005340 Ga0070689_100237686 Ga0070689_1002376862 355
406 3300005365 Ga0070688_100034584 Ga0070688_1000345843 355
407 3300005563 Ga0068855_100357005 Ga0068855_1003570052 355
408 3300005719 Ga0068861_100290451 Ga0068861_1002904512 355
409 3300013297 Ga0157378_10159223 Ga0157378_101592233 355
410 3300025893 Ga0207682_10000669 Ga0207682_1000066911 355
411 3300025918 Ga0207662_10031838 Ga0207662_100318383 355
412 3300026089 Ga0207648_10028748 Ga0207648_100287483 355
413 3300046537 Ga0495598_0010526 Ga0495598_0010526_640_1770 355
414 3300053134 Ga0500658_0011030 Ga0500658_0011030_600_1730 355
415 3300005937 Ga0081455_10003788 Ga0081455_100037883 356
416 3300009545 Ga0105237_10192332 Ga0105237_101923322 356
417 3300030760 Ga0265762_1009616 Ga0265762_10096162 356
418 3300053096 Ga0500641_0032759 Ga0500641_0032759_168_1382 356
419 3300053119 Ga0500595_015130 Ga0500595_015130_227_1408 356
420 3300053131 Ga0500652_000124 Ga0500652_000124_23230_24411 356
421 3300005329 Ga0070683_100008274 Ga0070683_1000082747 357
422 3300037312 Ga0395899_0065900 Ga0395899_0065900_281_1411 357
423 3300037466 Ga0395898_0005901 Ga0395898_0005901_8064_9194 357
424 3300038443 Ga0395901_0073529 Ga0395901_0073529_1079_2209 357
425 3300046501 Ga0495607_0001040 Ga0495607_0001040_9404_10588 357
426 3300053096 Ga0500641_0001747 Ga0500641_0001747_5008_6135 357
427 3300003215 JGI25153J46596_10000282 JGI25153J46596_1000028211 358
428 3300003215 JGI25153J46596_10000289 JGI25153J46596_1000028931 358
429 3300005353 Ga0070669_100005290 Ga0070669_1000052909 358
430 3300005458 Ga0070681_10299811 Ga0070681_102998112 358
431 3300005536 Ga0070697_100055533 Ga0070697_1000555332 358
432 3300005981 Ga0081538_10022067 Ga0081538_100220674 358
433 3300005985 Ga0081539_10021231 Ga0081539_100212313 358
434 3300009094 Ga0111539_10002681 Ga0111539_1000268120 358
435 3300025297 Ga0209758_1000048 Ga0209758_1000048161 358
436 3300025298 Ga0209050_1006121 Ga0209050_10061214 358
437 3300025302 Ga0207426_1021514 Ga0207426_10215143 358
438 3300025303 Ga0209051_1011972 Ga0209051_10119722 358
439 3300025304 Ga0209257_1002078 Ga0209257_10020788 358
440 3300028380 Ga0268265_10040777 Ga0268265_100407772 358
441 3300031250 Ga0265331_10002763 Ga0265331_100027636 358
442 3300031456 Ga0307513_10157146 Ga0307513_101571462 358
443 3300031595 Ga0265313_10006984 Ga0265313_100069843 358
444 3300035692 Ga0373935_0112758 Ga0373935_0112758_614_1741 358
445 3300037068 Ga0373925_0145952 Ga0373925_0145952_508_1638 358
446 3300046454 Ga0495592_0222805 Ga0495592_0222805_35_1165 358
447 3300046462 Ga0495651_0148298 Ga0495651_0148298_481_1608 358
448 3300046529 Ga0495652_0150685 Ga0495652_0150685_356_1483 358
449 3300046533 Ga0495640_0086234 Ga0495640_0086234_877_2007 358
450 3300046689 Ga0495613_0041213 Ga0495613_0041213_1642_2772 358
451 3300047319 Ga0495674_0030598 Ga0495674_0030598_3400_4530 358
452 3300047321 Ga0495676_0133937 Ga0495676_0133937_225_1355 358
453 3300049568 Ga0501031_0070679 Ga0501031_0070679_675_1802 358
454 3300049569 Ga0501032_0000430 Ga0501032_0000430_9790_10917 358
455 3300049570 Ga0501033_0005727 Ga0501033_0005727_5476_6603 358
456 3300049571 Ga0501034_0013536 Ga0501034_0013536_4483_5610 358
457 3300049571 Ga0501034_0031580 Ga0501034_0031580_1006_2136 358
458 3300049572 Ga0501036_0092600 Ga0501036_0092600_714_1841 358
459 3300049574 Ga0501038_0003181 Ga0501038_0003181_11716_12843 358
460 3300049575 Ga0501039_0001639 Ga0501039_0001639_3458_4585 358
461 3300049579 Ga0501043_0002280 Ga0501043_0002280_5393_6520 358
462 3300049580 Ga0501046_0002162 Ga0501046_0002162_7596_8723 358
463 3300049581 Ga0501047_0037269 Ga0501047_0037269_537_1664 358
464 3300049582 Ga0501048_0011230 Ga0501048_0011230_834_1961 358
465 3300049583 Ga0501067_0022466 Ga0501067_0022466_606_1733 358
466 3300049585 Ga0501069_0000959 Ga0501069_0000959_1354_2481 358
467 3300049586 Ga0501070_0001304 Ga0501070_0001304_5120_6247 358
468 3300049586 Ga0501070_0029166 Ga0501070_0029166_259_1386 358
469 3300049587 Ga0501071_0045587 Ga0501071_0045587_542_1669 358
470 3300049589 Ga0501073_0003837 Ga0501073_0003837_5204_6331 358
471 3300049589 Ga0501073_0069722 Ga0501073_0069722_1012_2139 358
472 3300049590 Ga0501074_0060895 Ga0501074_0060895_1216_2343 358
473 3300049592 Ga0501076_0146632 Ga0501076_0146632_258_1415 358
474 3300049742 Ga0501080_0000865 Ga0501080_0000865_22412_23539 358
475 3300049742 Ga0501080_0055195 Ga0501080_0055195_128_1255 358
476 3300049744 Ga0501083_0011242 Ga0501083_0011242_1576_2703 358
477 3300049822 Ga0501035_0038714 Ga0501035_0038714_403_1530 358
478 3300049823 Ga0501044_0004358 Ga0501044_0004358_10477_11604 358
479 3300049823 Ga0501044_0086261 Ga0501044_0086261_852_1982 358
480 3300049823 Ga0501044_0102196 Ga0501044_0102196_1686_2813 358
481 3300049824 Ga0501045_0104295 Ga0501045_0104295_488_1618 358
482 3300050492 nmdc:mga0yw44_22273_c1 nmdc:mga0yw44_22273_c1_995_2125 358
483 3300050511 nmdc:mga08y16_158_c1 nmdc:mga08y16_158_c1_3779_4906 358
484 3300053077 Ga0495601_0000975 Ga0495601_0000975_8589_9719 358
485 3300053093 Ga0500651_0042725 Ga0500651_0042725_459_1586 358
486 3300053139 Ga0500568_0019716 Ga0500568_0019716_789_1916 358
487 3300053142 Ga0500577_0069908 Ga0500577_0069908_222_1349 358
488 3300053153 Ga0500616_0000859 Ga0500616_0000859_13924_15051 358
489 3300053731 Ga0500609_000267 Ga0500609_000267_5571_6698 358
490 3300054114 Ga0501084_0135616 Ga0501084_0135616_351_1478 358
491 3300054114 Ga0501084_0218215 Ga0501084_0218215_147_1274 358
492 3300060353 Ga0501082_0006905 Ga0501082_0006905_4300_5427 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08309

LVIVD

LVIVD repeat

240

271

0.89

PF08309

LVIVD

LVIVD repeat

135

158

0.89

PF08309

LVIVD

LVIVD repeat

363

390

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3odt-assembly2.cif.gz_B crystal structure of wd40 beta propeller domain of doa1 0.742 7 357
5hrm-assembly2.cif.gz_C crystal structure of phosphotriesterase from sphingobium sp. tcm1 0.7364 1 357
5hrm-assembly2.cif.gz_C crystal structure of phosphotriesterase from sphingobium sp. tcm1 0.7327 1 357
6zxh-assembly1.cif.gz_g cryo-em structure of a late human pre-40s ribosomal subunit - state h2 0.7256 7 355
3odt-assembly2.cif.gz_B crystal structure of wd40 beta propeller domain of doa1 0.7242 7 357
ID Description Score Start End Superfamily
af_F1M8Z5_136_280_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7997 170 261 2.40.128.630
af_F1MAM1_301_457_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7991 164 352 2.130.10.10
af_Q54GJ0_210_362_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7624 164 304 2.130.10.10
af_O22212_162_377_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7539 164 314 2.130.10.10
af_I1K5W4_1090_1204_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7512 8 129 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A537U5R9-F1-model_v4 Uncharacterized protein 0.9872 178 358
AF-A0A554UCP1-F1-model_v4 deleted 0.986 4 358
AF-A0A3S1HD27-F1-model_v4 Uncharacterized protein 0.9848 204 358
AF-A0A2E5P997-F1-model_v4 LVIVD repeat-containing protein 0.9807 1 358
AF-A0A3S1HD27-F1-model_v4 Uncharacterized protein 0.9785 204 358

Feature Viewer

pLDDT pTM Quality
91.47 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map