F454183

General Info

Members Datasets Scaffolds Average Seq Length
491 271 397 460

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0000092|Ga0500641_0000092_23265_24884
Length 539
Sequence MDAIGHEIANFHQVIIARKVYVCKEIHRYKITKSFGVAKLAGAFAPYLRQLLKNSHINPVGKHGLSLIFASQKSSTKMTLIKSISGIRGTIGGKTGDNLTPVDAVKFASAYGTWLKGHAGKEKLTVVIGRDARISGPMIQNLVVNTLVGLGIDVIDLDLSTTPTVEVAVPLEKADGGIILTASHNPKQWNALKLLNEKGEFLSGADGAKILEIAESEAFDFADVDSLGEITRNDAYMDIHIDEVLELPLVDAEAVKKAGFKVVVDGVNSSGGIIIPKLLEQMGVEVVKLYCEPNGHFPHNPEPLKEHLGDICELVVKEKADFGIVVDPDVDRLAFISDDGEMFGEEYTLVACADYVLSKTPGNTVSNMSSSRALRDITQKHGGTYEASAVGEVNVVEMMKKNNAIIGGEGNGGIIYPELHYGRDSLVGVALFLTYLAEKKMSVAALRASYPQYYMSKNKIELTPQIDVDAILVAMADKYKAEDISTIDGVKIDFAEEWVHLRKSNTEPIIRIYTEAATQEKADVLAVRIIDEIKAVAGI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
8 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
9 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
10 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
11 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
12 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
13 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
14 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
15 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
16 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
17 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
18 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
19 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
20 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
21 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
22 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
23 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
24 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
25 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
26 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
27 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
28 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
29 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
30 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
31 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
32 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
33 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
34 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
35 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
36 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
37 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
38 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
39 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
40 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
41 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
42 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
43 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
44 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
45 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
46 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
47 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
48 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
49 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
50 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
51 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
52 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
53 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
54 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
55 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
56 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
57 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
58 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
59 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
60 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
61 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
62 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
63 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
64 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
65 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
66 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
67 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
68 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
69 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
70 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
71 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
72 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
73 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
74 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
75 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
76 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
77 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
78 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
79 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
80 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
81 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
82 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
83 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
84 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
85 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
86 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
87 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
88 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
91 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
92 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
95 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
96 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
97 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
100 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
103 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
104 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
116 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
117 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
118 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
119 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
120 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
167 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
193 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
194 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
195 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
196 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
199 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
244 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
245 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
246 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
247 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
248 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
249 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
250 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
251 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
252 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
259 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
267 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
268 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
269 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
270 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
271 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.65
Metatranscriptomes 0.2
Isolates 19.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 4.48
Nodule 1.22
Rhizoplane 0.61
Rhizosphere 75.76
Stem 0
Stem Tuber 0
Unclassified 17.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1465543 2162886007 Bacteria 2214
2 SwRhRL2b_contig_2462835 2162886007 Bacteria 1696
3 JGI24741J21665_1001112 3300001915 Bacteria 7981
4 rootH2_10018562 3300003320 Bacteria 22451
5 rootH2_10045513 3300003320 Bacteria 3231
6 rootH2_10061165 3300003320 Bacteria 4754
7 rootH2_10089432 3300003320 Bacteria 4110
8 rootL2_10062499 3300003322 Bacteria 3195
9 rootH1_10005005 3300003323 Bacteria 13841
10 rootH1_10023968 3300003323 Bacteria 14177
11 rootH1_10053707 3300003323 Unclassified 2538
12 rootH1_10069924 3300003323 Bacteria 6080
13 rootH1_10096944 3300003323 Bacteria 6760
14 Ga0006562J51391_1012845 3300003578 Bacteria 1880
15 Ga0055530_10024573 3300003791 Bacteria 1704
16 Ga0055531_10000048 3300003794 Bacteria 131142
17 Ga0065714_10002783 3300005288 Bacteria 12098
18 Ga0065714_10003592 3300005288 Bacteria 9509
19 Ga0065714_10078066 3300005288 Bacteria 2628
20 Ga0065704_10000703 3300005289 Bacteria 23928
21 Ga0065704_10070801 3300005289 Bacteria 15973
22 Ga0065704_10072930 3300005289 Bacteria 7781
23 Ga0065704_10075387 3300005289 Bacteria 5620
24 Ga0065704_10075852 3300005289 Bacteria 5387
25 Ga0065704_10077364 3300005289 Bacteria 4759
26 Ga0065704_10101974 3300005289 Bacteria 2220
27 Ga0065715_10002453 3300005293 Bacteria 4903
28 Ga0065715_10002923 3300005293 Bacteria 5755
29 Ga0070683_100011034 3300005329 Bacteria 7788
30 Ga0070683_100012560 3300005329 Bacteria 7362
31 Ga0070670_100010892 3300005331 Bacteria 7768
32 Ga0070666_10013025 3300005335 Bacteria 5265
33 Ga0070682_100001079 3300005337 Bacteria 15730
34 Ga0070660_100067110 3300005339 Bacteria 2794
35 Ga0070668_100009717 3300005347 Bacteria 7133
36 Ga0070675_100027132 3300005354 Bacteria 4600
37 Ga0070675_100040340 3300005354 Bacteria 3810
38 Ga0070671_100195755 3300005355 Bacteria 1714
39 Ga0070659_100003108 3300005366 Bacteria 11810
40 Ga0070659_100048590 3300005366 Bacteria 3334
41 Ga0070679_100049979 3300005530 Bacteria 4165
42 Ga0070684_100002982 3300005535 Bacteria 12598
43 Ga0070672_100146612 3300005543 Bacteria 1950
44 Ga0068855_100065703 3300005563 Bacteria 4229
45 Ga0070664_100005324 3300005564 Bacteria 10325
46 Ga0068857_100140460 3300005577 Bacteria 2183
47 Ga0068852_100004922 3300005616 Bacteria 9482
48 Ga0068851_10005478 3300005834 Bacteria 5757
49 Ga0068851_10025482 3300005834 Bacteria 2902
50 Ga0068860_100012932 3300005843 Bacteria 8200
51 Ga0068860_100043968 3300005843 Bacteria 4259
52 Ga0075366_10097596 3300006195 Bacteria 1762
53 Ga0068871_100165316 3300006358 Bacteria 1894
54 Ga0075428_100040492 3300006844 Bacteria 5125
55 Ga0068865_100055960 3300006881 Bacteria 2746
56 Ga0099824_1000378 3300006942 Bacteria 50161
57 Ga0079104_1000108 3300006946 Bacteria 122180
58 Ga0099826_10023160 3300006948 Bacteria 4633
59 Ga0105251_10064072 3300009011 Bacteria 1724
60 Ga0105244_10000029 3300009036 Bacteria 193769
61 Ga0105244_10000099 3300009036 Bacteria 90288
62 Ga0105250_10009113 3300009092 Bacteria 4190
63 Ga0111539_10014507 3300009094 Bacteria 9838
64 Ga0105245_10047331 3300009098 Bacteria 3844
65 Ga0105243_10000002 3300009148 Bacteria 856281
66 Ga0105243_10000149 3300009148 Bacteria 79865
67 Ga0105237_10049067 3300009545 Bacteria 4244
68 Ga0105237_10112120 3300009545 Bacteria 2720
69 Ga0105249_10106150 3300009553 Bacteria 2649
70 Ga0157373_10000020 3300013100 Bacteria 166079
71 Ga0157373_10090463 3300013100 Bacteria 2155
72 Ga0157371_10000019 3300013102 Bacteria 307914
73 Ga0157371_10015773 3300013102 Bacteria 5653
74 Ga0157371_10073676 3300013102 Bacteria 2418
75 Ga0157370_10000403 3300013104 Bacteria 54542
76 Ga0157370_10000420 3300013104 Bacteria 53532
77 Ga0157370_10000434 3300013104 Bacteria 52185
78 Ga0157370_10000871 3300013104 Bacteria 38342
79 Ga0157370_10006386 3300013104 Bacteria 13012
80 Ga0157370_10047081 3300013104 Bacteria 4135
81 Ga0157370_10120488 3300013104 Bacteria 2450
82 Ga0157369_10000436 3300013105 Bacteria 55545
83 Ga0157369_10017402 3300013105 Bacteria 8078
84 Ga0157374_10170697 3300013296 Unclassified 2121
85 Ga0163162_10045770 3300013306 Bacteria 4384
86 Ga0157372_10042324 3300013307 Bacteria 5038
87 Ga0157372_10065150 3300013307 Bacteria 4090
88 Ga0157372_10092591 3300013307 Unclassified 3439
89 Ga0157372_10232400 3300013307 Bacteria 2138
90 Ga0157375_10000357 3300013308 Bacteria 41524
91 Ga0157375_10061621 3300013308 Bacteria 3725
92 Ga0163163_10002667 3300014325 Bacteria 15096
93 Ga0157380_10000133 3300014326 Bacteria 41543
94 Ga0157380_10010323 3300014326 Bacteria 6714
95 Ga0157380_10065938 3300014326 Unclassified 2911
96 Ga0182008_10000005 3300014497 Bacteria 386556
97 Ga0182006_1000001 3300015261 Bacteria 1091090
98 Ga0182006_1012656 3300015261 Bacteria 3686
99 Ga0163161_10000023 3300017792 Bacteria 205048
100 Ga0163161_10007936 3300017792 Bacteria 7347
101 Ga0209675_1000022 3300025291 Bacteria 315280
102 Ga0209050_1001638 3300025298 Bacteria 22927
103 Ga0209257_1000007 3300025304 Bacteria 1564415
104 Ga0207656_10008904 3300025321 Bacteria 3717
105 Ga0207655_1000097 3300025728 Bacteria 193780
106 Ga0207655_1000239 3300025728 Bacteria 90288
107 Ga0207647_10000054 3300025904 Bacteria 86704
108 Ga0207705_10084796 3300025909 Bacteria 2314
109 Ga0207707_10115163 3300025912 Bacteria 2349
110 Ga0207671_10025923 3300025914 Bacteria 4398
111 Ga0207681_10080871 3300025923 Bacteria 2293
112 Ga0207650_10003750 3300025925 Bacteria 10393
113 Ga0207690_10002163 3300025932 Bacteria 12011
114 Ga0207690_10081785 3300025932 Bacteria 2258
115 Ga0207706_10013881 3300025933 Bacteria 7305
116 Ga0207709_10000003 3300025935 Bacteria 1050072
117 Ga0207709_10000044 3300025935 Bacteria 241642
118 Ga0207689_10070062 3300025942 Bacteria 2881
119 Ga0207661_10010788 3300025944 Bacteria 6588
120 Ga0207661_10014994 3300025944 Bacteria 5691
121 Ga0207679_10003059 3300025945 Bacteria 10358
122 Ga0207667_10004370 3300025949 Bacteria 17310
123 Ga0207667_10147702 3300025949 Bacteria 2420
124 Ga0207667_10233176 3300025949 Bacteria 1884
125 Ga0207712_10074622 3300025961 Bacteria 2449
126 Ga0207668_10044750 3300025972 Bacteria 3014
127 Ga0207658_10021390 3300025986 Bacteria 4490
128 Ga0207703_10191441 3300026035 Bacteria 1812
129 Ga0207639_10087672 3300026041 Bacteria 2481
130 Ga0207639_10177913 3300026041 Bacteria 1807
131 Ga0207639_10243842 3300026041 Bacteria 1564
132 Ga0207676_10140494 3300026095 Unclassified 2067
133 Ga0207674_10161198 3300026116 Bacteria 2197
134 Ga0207698_10029915 3300026142 Bacteria 3908
135 Ga0209281_1000208 3300027111 Bacteria 132254
136 Ga0209489_113012 3300027361 Bacteria 7074
137 Ga0265323_10000021 3300028653 Bacteria 87631
138 Ga0265336_10012381 3300028666 Bacteria 2872
139 Ga0307515_10000411 3300028794 Bacteria 103597
140 Ga0307515_10165477 3300028794 Bacteria 2232
141 Ga0265338_10003003 3300028800 Bacteria 24413
142 Ga0265338_10005037 3300028800 Bacteria 17453
143 Ga0265338_10015011 3300028800 Bacteria 8555
144 Ga0265327_10000030 3300031251 Bacteria 333531
145 Ga0265327_10000461 3300031251 Bacteria 72906
146 Ga0265327_10019775 3300031251 Bacteria 4126
147 Ga0265327_10029392 3300031251 Bacteria 3127
148 Ga0265316_10001515 3300031344 Bacteria 24893
149 Ga0265316_10008492 3300031344 Bacteria 9523
150 Ga0265316_10027728 3300031344 Bacteria 4683
151 Ga0307509_10012893 3300031507 Bacteria 9938
152 Ga0307509_10040937 3300031507 Bacteria 5035
153 Ga0307408_100000083 3300031548 Bacteria 105013
154 Ga0307408_100000143 3300031548 Bacteria 79423
155 Ga0307408_100001015 3300031548 Bacteria 21589
156 Ga0307408_100006871 3300031548 Bacteria 7543
157 Ga0307514_10005153 3300031649 Bacteria 11797
158 Ga0265342_10075867 3300031712 Bacteria 1949
159 Ga0316578_10008895 3300031728 Bacteria 5135
160 Ga0307405_10000002 3300031731 Bacteria 575196
161 Ga0316577_10040158 3300031733 Bacteria 2617
162 Ga0307413_10000047 3300031824 Bacteria 31403
163 Ga0307413_10066134 3300031824 Unclassified 2255
164 Ga0307410_10000027 3300031852 Bacteria 52776
165 Ga0307410_10000749 3300031852 Bacteria 13582
166 Ga0307406_10000271 3300031901 Bacteria 30940
167 Ga0307412_10000006 3300031911 Bacteria 506878
168 Ga0307412_10000098 3300031911 Bacteria 72053
169 Ga0307412_10003525 3300031911 Bacteria 8693
170 Ga0307409_100135775 3300031995 Bacteria 2110
171 Ga0307416_100000021 3300032002 Bacteria 189730
172 Ga0307416_100006662 3300032002 Bacteria 7247
173 Ga0307416_100029143 3300032002 Bacteria 4119
174 Ga0307414_10000008 3300032004 Bacteria 375832
175 Ga0307414_10000025 3300032004 Bacteria 199049
176 Ga0307414_10004625 3300032004 Bacteria 7489
177 Ga0307414_10022799 3300032004 Bacteria 3957
178 Ga0307414_10028078 3300032004 Bacteria 3645
179 Ga0307414_10068233 3300032004 Bacteria 2551
180 Ga0307414_10089536 3300032004 Bacteria 2281
181 Ga0307411_10000018 3300032005 Bacteria 87365
182 Ga0307411_10006080 3300032005 Bacteria 6002
183 Ga0307510_10113942 3300033180 Bacteria 2435
184 Ga0373927_0033568 3300035695 Bacteria 3341
185 Ga0316584_0000112 3300036712 Bacteria 34210
186 Ga0316584_0026831 3300036712 Bacteria 4236
187 Ga0316584_0132335 3300036712 Bacteria 1863
188 Ga0316584_0147760 3300036712 Bacteria 1751
189 Ga0395905_0001271 3300037471 Bacteria 31130
190 Ga0395905_0066024 3300037471 Bacteria 3388
191 Ga0400483_242687 3300039062 Bacteria 39926
192 Ga0400489_09530 3300039093 Bacteria 3884
193 Ga0439438_020686 3300041405 Bacteria 1845
194 Ga0439447_000624 3300041407 Bacteria 13184
195 Ga0439466_0002727 3300041411 Bacteria 6920
196 Ga0439465_0000007 3300041413 Bacteria 52288
197 Ga0451795_0040079 3300041456 Bacteria 2816
198 Ga0451795_0978483 3300041456 Bacteria 1720
199 Ga0451855_1305472 3300041511 Bacteria 5767
200 Ga0439445_0000049 3300042004 Bacteria 17022
201 Ga0439445_0010055 3300042004 Bacteria 2234
202 Ga0439449_0024914 3300042007 Bacteria 2237
203 Ga0451577_0000048 3300042876 Bacteria 309377
204 Ga0451577_0000515 3300042876 Bacteria 64793
205 Ga0451577_0000703 3300042876 Bacteria 52315
206 Ga0451577_0002562 3300042876 Bacteria 21462
207 Ga0451577_0009578 3300042876 Bacteria 9308
208 Ga0451577_0011211 3300042876 Bacteria 8499
209 Ga0451577_0015469 3300042876 Bacteria 7098
210 Ga0451577_0027011 3300042876 Bacteria 5197
211 Ga0451577_0031115 3300042876 Bacteria 4817
212 Ga0451577_0039274 3300042876 Bacteria 4253
213 Ga0451577_0042925 3300042876 Bacteria 4052
214 Ga0451577_0062894 3300042876 Bacteria 3309
215 Ga0451577_0130914 3300042876 Bacteria 2250
216 Ga0451577_0144933 3300042876 Bacteria 2135
217 Ga0451577_0158277 3300042876 Bacteria 2039
218 Ga0451577_0163006 3300042876 Bacteria 2008
219 Ga0451577_0178357 3300042876 Bacteria 1915
220 Ga0453683_0000078 3300044673 Bacteria 147056
221 Ga0453683_0000426 3300044673 Bacteria 48447
222 Ga0453683_0000759 3300044673 Bacteria 32471
223 Ga0453683_0002887 3300044673 Bacteria 12998
224 Ga0453683_0007613 3300044673 Bacteria 7334
225 Ga0453683_0008083 3300044673 Bacteria 7078
226 Ga0453683_0012126 3300044673 Bacteria 5659
227 Ga0453683_0023846 3300044673 Bacteria 3897
228 Ga0453683_0110394 3300044673 Bacteria 1729
229 Ga0453683_0120271 3300044673 Bacteria 1653
230 Ga0453683_0151306 3300044673 Bacteria 1466
231 Ga0453684_0000051 3300044712 Bacteria 551033
232 Ga0453684_0000143 3300044712 Bacteria 315998
233 Ga0453684_0000161 3300044712 Bacteria 298175
234 Ga0453684_0000226 3300044712 Bacteria 244912
235 Ga0453684_0000334 3300044712 Bacteria 196444
236 Ga0453684_0000841 3300044712 Bacteria 103501
237 Ga0453684_0000846 3300044712 Bacteria 103225
238 Ga0453684_0001838 3300044712 Bacteria 55467
239 Ga0453684_0001990 3300044712 Bacteria 52425
240 Ga0453684_0002274 3300044712 Bacteria 47417
241 Ga0453684_0004651 3300044712 Bacteria 28522
242 Ga0453684_0007503 3300044712 Bacteria 20003
243 Ga0453684_0007585 3300044712 Bacteria 19886
244 Ga0453684_0007828 3300044712 Bacteria 19471
245 Ga0453684_0008816 3300044712 Bacteria 17887
246 Ga0453684_0010329 3300044712 Bacteria 15985
247 Ga0453684_0015606 3300044712 Bacteria 11986
248 Ga0453684_0017784 3300044712 Bacteria 10973
249 Ga0453684_0023448 3300044712 Bacteria 9087
250 Ga0453684_0039581 3300044712 Bacteria 6421
251 Ga0453684_0040348 3300044712 Bacteria 6341
252 Ga0453684_0040572 3300044712 Bacteria 6317
253 Ga0453684_0041450 3300044712 Bacteria 6227
254 Ga0453684_0044557 3300044712 Bacteria 5933
255 Ga0453684_0048314 3300044712 Bacteria 5630
256 Ga0453684_0049294 3300044712 Bacteria 5556
257 Ga0453684_0050259 3300044712 Bacteria 5488
258 Ga0453684_0055152 3300044712 Bacteria 5169
259 Ga0453684_0068155 3300044712 Bacteria 4519
260 Ga0453684_0068204 3300044712 Bacteria 4517
261 Ga0453684_0082272 3300044712 Bacteria 4012
262 Ga0453684_0089907 3300044712 Bacteria 3795
263 Ga0453684_0090775 3300044712 Bacteria 3774
264 Ga0453684_0105349 3300044712 Bacteria 3440
265 Ga0453684_0121093 3300044712 Bacteria 3159
266 Ga0453684_0125479 3300044712 Bacteria 3090
267 Ga0453684_0207416 3300044712 Bacteria 2280
268 Ga0453684_0231756 3300044712 Bacteria 2131
269 Ga0453684_0233633 3300044712 Unclassified 2121
270 Ga0453684_0246636 3300044712 Unclassified 2053
271 Ga0453684_0247894 3300044712 Bacteria 2047
272 Ga0453684_0260341 3300044712 Unclassified 1987
273 Ga0453684_0271549 3300044712 Bacteria 1938
274 Ga0453684_0361764 3300044712 Bacteria 1633
275 Ga0466959_0019064 3300045049 Bacteria 5043
276 Ga0466959_0087776 3300045049 Bacteria 2237
277 Ga0451576_0000008 3300045051 Bacteria 746156
278 Ga0451576_0000059 3300045051 Bacteria 296795
279 Ga0451576_0000175 3300045051 Bacteria 161976
280 Ga0451576_0000352 3300045051 Bacteria 110468
281 Ga0451576_0000403 3300045051 Bacteria 100887
282 Ga0451576_0001289 3300045051 Bacteria 43512
283 Ga0451576_0002703 3300045051 Bacteria 25766
284 Ga0451576_0002985 3300045051 Bacteria 23960
285 Ga0451576_0004474 3300045051 Bacteria 18100
286 Ga0451576_0006200 3300045051 Bacteria 14723
287 Ga0451576_0025841 3300045051 Bacteria 6325
288 Ga0451576_0027025 3300045051 Bacteria 6167
289 Ga0451576_0056667 3300045051 Bacteria 4098
290 Ga0451576_0064179 3300045051 Bacteria 3826
291 Ga0451576_0073664 3300045051 Bacteria 3553
292 Ga0451576_0089246 3300045051 Bacteria 3206
293 Ga0451576_0098067 3300045051 Bacteria 3048
294 Ga0451576_0103563 3300045051 Bacteria 2960
295 Ga0451576_0142314 3300045051 Bacteria 2501
296 Ga0451576_0151103 3300045051 Bacteria 2422
297 Ga0451576_0218339 3300045051 Bacteria 1991
298 Ga0495627_000012 3300046453 Bacteria 345654
299 Ga0495627_002756 3300046453 Bacteria 8168
300 Ga0495627_005575 3300046453 Bacteria 5043
301 Ga0495638_0000001 3300046460 Bacteria 1114121
302 Ga0495606_0004755 3300046507 Bacteria 13375
303 Ga0495606_0013783 3300046507 Bacteria 6357
304 Ga0495610_0000005 3300046512 Bacteria 924111
305 Ga0495632_0007160 3300046519 Bacteria 7053
306 Ga0495643_0001055 3300046522 Bacteria 27762
307 Ga0495643_0093692 3300046522 Bacteria 1547
308 Ga0495663_0000047 3300046525 Bacteria 58338
309 Ga0495654_0000003 3300046530 Bacteria 863485
310 Ga0495609_0000003 3300046538 Bacteria 711547
311 Ga0495621_0020431 3300046539 Bacteria 2173
312 Ga0495633_0003662 3300046558 Bacteria 10148
313 Ga0495625_0000549 3300046660 Bacteria 54909
314 Ga0495625_0021610 3300046660 Bacteria 4950
315 Ga0495661_0000474 3300046665 Bacteria 42464
316 Ga0495660_0029914 3300046810 Bacteria 3070
317 Ga0495686_0000122 3300047472 Bacteria 162732
318 Ga0495686_0009106 3300047472 Bacteria 7194
319 Ga0496114_0005641 3300048917 Bacteria 9816
320 Ga0496116_0000004 3300048919 Bacteria 839841
321 Ga0496116_0000051 3300048919 Bacteria 305038
322 Ga0496116_0003323 3300048919 Bacteria 15985
323 Ga0496117_0000007 3300048920 Bacteria 720505
324 Ga0496118_0000118 3300048921 Bacteria 144482
325 Ga0496118_0058235 3300048921 Bacteria 2889
326 Ga0496118_0086095 3300048921 Bacteria 2185
327 Ga0496119_0000028 3300048922 Bacteria 244677
328 Ga0496120_0076473 3300048923 Bacteria 1824
329 Ga0496121_0011962 3300048924 Bacteria 9546
330 Ga0496121_0032586 3300048924 Bacteria 4734
331 Ga0496121_0158366 3300048924 Bacteria 1659
332 Ga0496122_0000368 3300048925 Bacteria 96829
333 Ga0496122_0000406 3300048925 Bacteria 91452
334 Ga0496122_0000875 3300048925 Bacteria 56698
335 Ga0496122_0003781 3300048925 Bacteria 19504
336 Ga0496122_0022883 3300048925 Bacteria 5533
337 Ga0496123_0001690 3300048926 Bacteria 29520
338 Ga0496123_0006116 3300048926 Bacteria 11804
339 Ga0496123_0007222 3300048926 Bacteria 10541
340 Ga0496123_0048159 3300048926 Bacteria 2870
341 Ga0496124_0001239 3300048927 Bacteria 39206
342 Ga0496124_0068644 3300048927 Bacteria 2945
343 Ga0496124_0070147 3300048927 Bacteria 2908
344 Ga0496125_0000082 3300048928 Bacteria 227300
345 Ga0496125_0000184 3300048928 Bacteria 137135
346 Ga0496125_0001005 3300048928 Bacteria 43909
347 Ga0496125_0001048 3300048928 Bacteria 42722
348 Ga0496125_0037568 3300048928 Bacteria 4208
349 Ga0496126_0012255 3300048929 Bacteria 8796
350 Ga0496126_0036877 3300048929 Bacteria 4568
351 Ga0501032_0025374 3300049569 Bacteria 4086
352 Ga0501032_0052071 3300049569 Unclassified 2759
353 Ga0501033_0000005 3300049570 Bacteria 379089
354 Ga0501033_0110781 3300049570 Bacteria 1998
355 Ga0501034_0000052 3300049571 Bacteria 207572
356 Ga0501034_0000115 3300049571 Bacteria 146825
357 Ga0501034_0102450 3300049571 Bacteria 2856
358 Ga0501036_0002416 3300049572 Bacteria 14614
359 Ga0501037_0188579 3300049573 Unclassified 1461
360 Ga0501039_0005537 3300049575 Bacteria 9557
361 Ga0501043_0001363 3300049579 Bacteria 21389
362 Ga0501046_0167006 3300049580 Bacteria 1653
363 Ga0501047_0006698 3300049581 Bacteria 10830
364 Ga0501202_020546 3300049652 Bacteria 1313
365 Ga0501238_000067 3300049671 Bacteria 16786
366 Ga0501242_000414 3300049674 Bacteria 3660
367 Ga0501249_000219 3300049679 Bacteria 17315
368 Ga0501259_000574 3300049688 Bacteria 5875
369 Ga0501241_000008 3300049758 Bacteria 137909
370 Ga0501241_000949 3300049758 Bacteria 6145
371 Ga0501264_000639 3300049761 Bacteria 4892
372 Ga0501266_000030 3300049763 Bacteria 42664
373 Ga0501269_000257 3300049766 Bacteria 15191
374 Ga0501280_000548 3300049776 Bacteria 8785
375 Ga0501280_005116 3300049776 Bacteria 1889
376 Ga0501035_0041480 3300049822 Bacteria 4155
377 Ga0501035_0044921 3300049822 Bacteria 3976
378 Ga0501035_0071201 3300049822 Bacteria 3079
379 Ga0501044_0002047 3300049823 Bacteria 23260
380 Ga0501045_0000192 3300049824 Bacteria 34433
381 nmdc:mga0k408_34147_c1 3300050493 Bacteria 2911
382 Ga0500641_0000009 3300053096 Bacteria 173260
383 Ga0500641_0000092 3300053096 Bacteria 34933
384 Ga0500562_000007 3300053108 Bacteria 241755
385 Ga0500562_000012 3300053108 Bacteria 168210
386 Ga0500562_016543 3300053108 Unclassified 1897
387 Ga0500655_003677 3300053133 Bacteria 2763
388 Ga0500658_0000061 3300053134 Bacteria 53519
389 Ga0500559_0003612 3300053136 Bacteria 7565
390 Ga0500559_0043404 3300053136 Bacteria 1964
391 Ga0500616_0000009 3300053153 Bacteria 779095
392 Ga0500616_0019078 3300053153 Bacteria 3872
393 Ga0500622_0000063 3300053156 Bacteria 127587
394 Ga0500622_0001862 3300053156 Bacteria 15961
395 Ga0500622_0004071 3300053156 Bacteria 9390
396 Ga0500645_004135 3300053730 Bacteria 5658
397 Ga0466962_0016607 3300061719 Unclassified 3550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025932 Ga0207690_10081785 Ga0207690_100817852 388
2 3300046522 Ga0495643_0093692 Ga0495643_0093692_327_1517 388
3 3300026095 Ga0207676_10140494 Ga0207676_101404941 393
4 3300049652 Ga0501202_020546 Ga0501202_020546_61_1290 400
5 3300025942 Ga0207689_10070062 Ga0207689_100700623 404
6 3300025986 Ga0207658_10021390 Ga0207658_100213901 404
7 3300053153 Ga0500616_0000009 Ga0500616_0000009_579365_580660 422
8 3300042876 Ga0451577_0027011 Ga0451577_0027011_2037_3458 425
9 3300044712 Ga0453684_0082272 Ga0453684_0082272_2213_3634 425
10 3300042876 Ga0451577_0002562 Ga0451577_0002562_8031_9413 428
11 3300044673 Ga0453683_0000426 Ga0453683_0000426_3665_5047 428
12 3300044712 Ga0453684_0000846 Ga0453684_0000846_57809_59191 428
13 3300044712 Ga0453684_0040348 Ga0453684_0040348_946_2328 428
14 3300045051 Ga0451576_0000175 Ga0451576_0000175_116560_117942 428
15 3300045051 Ga0451576_0000403 Ga0451576_0000403_43401_44783 428
16 3300044673 Ga0453683_0151306 Ga0453683_0151306_55_1446 432
17 3300044712 Ga0453684_0040572 Ga0453684_0040572_1353_2660 432
18 3300042876 Ga0451577_0130914 Ga0451577_0130914_271_1590 436
19 3300042876 Ga0451577_0000515 Ga0451577_0000515_6792_8156 437
20 3300045051 Ga0451576_0004474 Ga0451576_0004474_4555_5943 437
21 3300005289 Ga0065704_10101974 Ga0065704_101019743 438
22 3300042876 Ga0451577_0000048 Ga0451577_0000048_222979_224361 439
23 3300044673 Ga0453683_0000078 Ga0453683_0000078_85017_86399 439
24 3300044712 Ga0453684_0000161 Ga0453684_0000161_211777_213159 439
25 3300045051 Ga0451576_0000059 Ga0451576_0000059_85017_86399 439
26 3300048928 Ga0496125_0001048 Ga0496125_0001048_31774_33162 439
27 3300049822 Ga0501035_0044921 Ga0501035_0044921_217_1599 439
28 3300005530 Ga0070679_100049979 Ga0070679_1000499796 440
29 3300009545 Ga0105237_10049067 Ga0105237_100490675 440
30 3300025914 Ga0207671_10025923 Ga0207671_100259231 440
31 3300039093 Ga0400489_09530 Ga0400489_09530_108_1490 440
32 3300049571 Ga0501034_0000115 Ga0501034_0000115_56368_57753 441
33 3300042876 Ga0451577_0042925 Ga0451577_0042925_28_1413 443
34 3300045049 Ga0466959_0019064 Ga0466959_0019064_3057_4442 443
35 3300045051 Ga0451576_0089246 Ga0451576_0089246_525_1910 443
36 3300061719 Ga0466962_0016607 Ga0466962_0016607_772_2157 443
37 3300036712 Ga0316584_0132335 Ga0316584_0132335_72_1484 445
38 3300005366 Ga0070659_100048590 Ga0070659_1000485902 446
39 3300005563 Ga0068855_100065703 Ga0068855_1000657033 446
40 3300013100 Ga0157373_10090463 Ga0157373_100904632 446
41 3300013102 Ga0157371_10073676 Ga0157371_100736762 446
42 3300025949 Ga0207667_10233176 Ga0207667_102331762 446
43 3300013104 Ga0157370_10006386 Ga0157370_100063863 447
44 3300031824 Ga0307413_10066134 Ga0307413_100661342 448
45 iso_pu_bacteria 2929154850 2929155537 448
46 3300014326 Ga0157380_10010323 Ga0157380_100103232 449
47 3300014326 Ga0157380_10000133 Ga0157380_1000013321 450
48 3300026041 Ga0207639_10177913 Ga0207639_101779131 451
49 3300041456 Ga0451795_0978483 Ga0451795_0978483_244_1617 451
50 iso_pu_bacteria 2898713307 2898715910 451
51 3300025909 Ga0207705_10084796 Ga0207705_100847963 452
52 3300053108 Ga0500562_000012 Ga0500562_000012_118504_119871 452
53 3300053156 Ga0500622_0004071 Ga0500622_0004071_5108_6475 452
54 3300006358 Ga0068871_100165316 Ga0068871_1001653161 453
55 3300013306 Ga0163162_10045770 Ga0163162_100457703 453
56 3300026035 Ga0207703_10191441 Ga0207703_101914412 453
57 3300053730 Ga0500645_004135 Ga0500645_004135_307_1677 453
58 3300005834 Ga0068851_10005478 Ga0068851_100054785 454
59 3300006195 Ga0075366_10097596 Ga0075366_100975961 454
60 3300006881 Ga0068865_100055960 Ga0068865_1000559603 454
61 3300025321 Ga0207656_10008904 Ga0207656_100089044 454
62 3300025933 Ga0207706_10013881 Ga0207706_100138814 454
63 3300025949 Ga0207667_10004370 Ga0207667_100043708 454
64 3300042876 Ga0451577_0031115 Ga0451577_0031115_3403_4773 454
65 3300046539 Ga0495621_0020431 Ga0495621_0020431_607_1977 454
66 3300050493 nmdc:mga0k408_34147_c1 nmdc:mga0k408_34147_c1_118_1497 454
67 iso_pu_bacteria 2721755487 2722730110 454
68 iso_pu_bacteria 2739367866 2740032434 454
69 iso_pu_bacteria 2839989709 2839992874 454
70 iso_pu_bacteria 2896317667 2896321581 454
71 iso_pu_bacteria 2896344016 2896345598 454
72 iso_pu_bacteria 2904780799 2904782923 454
73 iso_pu_bacteria 2910245624 2910246050 454
74 iso_pu_bacteria 2919177583 2919179903 454
75 iso_pu_bacteria 3003233435 3003237407 454
76 iso_pu_bacteria 8055588893 8055589072 454
77 3300042876 Ga0451577_0009578 Ga0451577_0009578_3819_5207 455
78 3300044673 Ga0453683_0002887 Ga0453683_0002887_5876_7264 455
79 3300044673 Ga0453683_0007613 Ga0453683_0007613_5846_7234 455
80 3300044673 Ga0453683_0120271 Ga0453683_0120271_182_1594 455
81 3300044712 Ga0453684_0090775 Ga0453684_0090775_1407_2795 455
82 3300045051 Ga0451576_0000008 Ga0451576_0000008_491416_492804 455
83 3300045051 Ga0451576_0142314 Ga0451576_0142314_332_1744 455
84 3300044712 Ga0453684_0049294 Ga0453684_0049294_2252_3628 456
85 iso_pu_bacteria 2511231000 2511231577 456
86 iso_pu_bacteria 2513020052 2513235118 456
87 iso_pu_bacteria 2519899754 2520881700 456
88 iso_pu_bacteria 2523533629 2524006506 456
89 iso_pu_bacteria 2582581278 2585143098 456
90 iso_pu_bacteria 2582581281 2585157888 456
91 iso_pu_bacteria 2582581282 2585162188 456
92 iso_pu_bacteria 2582581873 2585426789 456
93 iso_pu_bacteria 2585428045 2587679244 456
94 iso_pu_bacteria 2585428060 2587749660 456
95 iso_pu_bacteria 2585428061 2587753104 456
96 iso_pu_bacteria 2585428095 2587866200 456
97 iso_pu_bacteria 2585428115 2587944352 456
98 iso_pu_bacteria 2585428182 2588210942 456
99 iso_pu_bacteria 2585428183 2588215356 456
100 iso_pu_bacteria 2585428184 2588218773 456
101 iso_pu_bacteria 2585428185 2588226155 456
102 iso_pu_bacteria 2585428187 2588232330 456
103 iso_pu_bacteria 2588253712 2588447000 456
104 iso_pu_bacteria 2588254255 2590603761 456
105 iso_pu_bacteria 2588254257 2590609645 456
106 iso_pu_bacteria 2643221600 2644008978 456
107 iso_pu_bacteria 2643221600 2644009890 456
108 iso_pu_bacteria 2643221667 2644372187 456
109 iso_pu_bacteria 2643221716 2644640183 456
110 iso_pu_bacteria 2643221716 2644644426 456
111 iso_pu_bacteria 2643221725 2644683290 456
112 iso_pu_bacteria 2728369107 2729201346 456
113 iso_pu_bacteria 2738541273 2738698736 456
114 iso_pu_bacteria 2738541279 2738734269 456
115 iso_pu_bacteria 2738541285 2738767027 456
116 iso_pu_bacteria 2738543007 2739215850 456
117 iso_pu_bacteria 2738543014 2739253062 456
118 iso_pu_bacteria 2739367857 2740001436 456
119 iso_pu_bacteria 2739367857 2740002079 456
120 iso_pu_bacteria 2739367858 2740006252 456
121 iso_pu_bacteria 2739367858 2740006895 456
122 iso_pu_bacteria 2739367874 2740059937 456
123 iso_pu_bacteria 2751185877 2753673725 456
124 iso_pu_bacteria 2765235839 2765575126 456
125 iso_pu_bacteria 2772190705 2772605128 456
126 iso_pu_bacteria 2775506739 2775674780 456
127 iso_pu_bacteria 2802428842 2802652825 456
128 iso_pu_bacteria 2816332188 2816874983 456
129 iso_pu_bacteria 2816332280 2817416981 456
130 iso_pu_bacteria 2833640130 2833643747 456
131 iso_pu_bacteria 2842083920 2842084504 456
132 iso_pu_bacteria 2857613821 2857618087 456
133 iso_pu_bacteria 2857618242 2857623009 456
134 iso_pu_bacteria 2871720351 2871723072 456
135 iso_pu_bacteria 2881247448 2881248564 456
136 iso_pu_bacteria 2881359912 2881362573 456
137 iso_pu_bacteria 2889290771 2889294339 456
138 iso_pu_bacteria 2903895155 2903899525 456
139 iso_pu_bacteria 2904419702 2904423847 456
140 iso_pu_bacteria 2904419702 2904424000 456
141 iso_pu_bacteria 2904555929 2904560508 456
142 iso_pu_bacteria 2905999023 2906003183 456
143 iso_pu_bacteria 2919097161 2919098398 456
144 iso_pu_bacteria 2919191525 2919191581 456
145 iso_pu_bacteria 2919191525 2919192029 456
146 iso_pu_bacteria 2919399522 2919401789 456
147 iso_pu_bacteria 2919509842 2919511436 456
148 iso_pu_bacteria 2919683626 2919687829 456
149 iso_pu_bacteria 2919683626 2919687937 456
150 iso_pu_bacteria 2929150217 2929154256 456
151 iso_pu_bacteria 2945924605 2945925182 456
152 iso_pu_bacteria 2946019816 2946023548 456
153 iso_pu_bacteria 2958458903 2958461653 456
154 iso_pu_bacteria 2958512119 2958512886 456
155 iso_pu_bacteria 2965320100 2965320885 456
156 iso_pu_bacteria 2977243572 2977243936 456
157 iso_pu_bacteria 2977268062 2977271076 456
158 iso_pu_bacteria 2984572630 2984574097 456
159 iso_pu_bacteria 2984606641 2984607544 456
160 iso_pu_bacteria 2993372514 2993375484 456
161 iso_pu_bacteria 2993480792 2993482354 456
162 iso_pu_bacteria 8036736890 8036737574 456
163 iso_pu_bacteria 8054307821 8054311130 456
164 iso_pu_bacteria 8055419101 8055422571 456
165 iso_pu_bacteria 8055592153 8055595581 456
166 iso_pu_bacteria 8056440228 8056443996 456
167 3300003320 rootH2_10045513 rootH2_100455133 457
168 3300003794 Ga0055531_10000048 Ga0055531_1000004885 457
169 3300005335 Ga0070666_10013025 Ga0070666_100130254 457
170 3300005354 Ga0070675_100040340 Ga0070675_1000403403 457
171 3300005543 Ga0070672_100146612 Ga0070672_1001466122 457
172 3300005843 Ga0068860_100012932 Ga0068860_1000129325 457
173 3300014326 Ga0157380_10065938 Ga0157380_100659382 457
174 3300025304 Ga0209257_1000007 Ga0209257_10000071388 457
175 3300025912 Ga0207707_10115163 Ga0207707_101151632 457
176 3300025949 Ga0207667_10147702 Ga0207667_101477023 457
177 3300026041 Ga0207639_10087672 Ga0207639_100876722 457
178 3300028794 Ga0307515_10000411 Ga0307515_1000041153 457
179 3300028794 Ga0307515_10165477 Ga0307515_101654773 457
180 3300031507 Ga0307509_10012893 Ga0307509_100128937 457
181 3300031507 Ga0307509_10040937 Ga0307509_100409372 457
182 3300031649 Ga0307514_10005153 Ga0307514_100051536 457
183 3300032004 Ga0307414_10068233 Ga0307414_100682331 457
184 3300035695 Ga0373927_0033568 Ga0373927_0033568_1003_2385 457
185 3300036712 Ga0316584_0147760 Ga0316584_0147760_35_1414 457
186 3300041405 Ga0439438_020686 Ga0439438_020686_289_1689 457
187 3300042004 Ga0439445_0010055 Ga0439445_0010055_487_1887 457
188 3300042007 Ga0439449_0024914 Ga0439449_0024914_13_1413 457
189 3300042876 Ga0451577_0015469 Ga0451577_0015469_1575_2960 457
190 3300042876 Ga0451577_0163006 Ga0451577_0163006_356_1741 457
191 3300044712 Ga0453684_0000841 Ga0453684_0000841_35741_37126 457
192 3300044712 Ga0453684_0007585 Ga0453684_0007585_8031_9410 457
193 3300044712 Ga0453684_0039581 Ga0453684_0039581_1602_2987 457
194 3300044712 Ga0453684_0105349 Ga0453684_0105349_877_2262 457
195 3300045051 Ga0451576_0006200 Ga0451576_0006200_7609_8994 457
196 3300045051 Ga0451576_0025841 Ga0451576_0025841_4169_5554 457
197 3300048917 Ga0496114_0005641 Ga0496114_0005641_2808_4202 457
198 3300049569 Ga0501032_0052071 Ga0501032_0052071_75_1460 457
199 3300049570 Ga0501033_0110781 Ga0501033_0110781_165_1559 457
200 3300049573 Ga0501037_0188579 Ga0501037_0188579_13_1398 457
201 3300049581 Ga0501047_0006698 Ga0501047_0006698_1679_3064 457
202 3300053108 Ga0500562_016543 Ga0500562_016543_88_1467 457
203 3300053153 Ga0500616_0019078 Ga0500616_0019078_789_2174 457
204 3300053156 Ga0500622_0000063 Ga0500622_0000063_48874_50253 457
205 3300003320 rootH2_10018562 rootH2_1001856217 458
206 3300003320 rootH2_10089432 rootH2_100894322 458
207 3300003323 rootH1_10005005 rootH1_100050057 458
208 3300003323 rootH1_10023968 rootH1_100239684 458
209 3300003323 rootH1_10053707 rootH1_100537072 458
210 3300003323 rootH1_10096944 rootH1_100969447 458
211 3300003791 Ga0055530_10024573 Ga0055530_100245731 458
212 3300005289 Ga0065704_10077364 Ga0065704_100773641 458
213 3300005293 Ga0065715_10002453 Ga0065715_100024533 458
214 3300005329 Ga0070683_100011034 Ga0070683_1000110343 458
215 3300006844 Ga0075428_100040492 Ga0075428_1000404924 458
216 3300009094 Ga0111539_10014507 Ga0111539_100145076 458
217 3300009148 Ga0105243_10000002 Ga0105243_1000000270 458
218 3300025298 Ga0209050_1001638 Ga0209050_100163817 458
219 3300025935 Ga0207709_10000003 Ga0207709_1000000370 458
220 3300025944 Ga0207661_10014994 Ga0207661_100149944 458
221 3300028800 Ga0265338_10015011 Ga0265338_100150115 458
222 3300031251 Ga0265327_10000030 Ga0265327_10000030251 458
223 3300031251 Ga0265327_10019775 Ga0265327_100197752 458
224 3300031548 Ga0307408_100000143 Ga0307408_1000001435 458
225 3300031548 Ga0307408_100006871 Ga0307408_1000068713 458
226 3300031995 Ga0307409_100135775 Ga0307409_1001357751 458
227 3300032002 Ga0307416_100006662 Ga0307416_1000066623 458
228 3300032004 Ga0307414_10028078 Ga0307414_100280783 458
229 3300041511 Ga0451855_1305472 Ga0451855_1305472_2104_3486 458
230 3300044673 Ga0453683_0012126 Ga0453683_0012126_3872_5296 458
231 3300045051 Ga0451576_0064179 Ga0451576_0064179_428_1831 458
232 3300045051 Ga0451576_0151103 Ga0451576_0151103_222_1646 458
233 3300046460 Ga0495638_0000001 Ga0495638_0000001_144753_146156 458
234 3300046665 Ga0495661_0000474 Ga0495661_0000474_29839_31230 458
235 3300048919 Ga0496116_0003323 Ga0496116_0003323_7984_9366 458
236 3300048921 Ga0496118_0058235 Ga0496118_0058235_114_1496 458
237 3300048926 Ga0496123_0048159 Ga0496123_0048159_539_1921 458
238 3300049761 Ga0501264_000639 Ga0501264_000639_2260_3663 458
239 3300053108 Ga0500562_000007 Ga0500562_000007_144318_145733 458
240 3300053133 Ga0500655_003677 Ga0500655_003677_318_1712 458
241 3300053156 Ga0500622_0001862 Ga0500622_0001862_1239_2663 458
242 3300003320 rootH2_10061165 rootH2_100611653 459
243 3300003322 rootL2_10062499 rootL2_100624992 459
244 3300005289 Ga0065704_10075852 Ga0065704_100758523 459
245 3300005843 Ga0068860_100043968 Ga0068860_1000439684 459
246 3300028666 Ga0265336_10012381 Ga0265336_100123813 459
247 3300031251 Ga0265327_10000461 Ga0265327_1000046123 459
248 3300031251 Ga0265327_10029392 Ga0265327_100293923 459
249 3300031344 Ga0265316_10027728 Ga0265316_100277282 459
250 3300031548 Ga0307408_100000083 Ga0307408_10000008387 459
251 3300037471 Ga0395905_0001271 Ga0395905_0001271_26003_27397 459
252 3300042876 Ga0451577_0000703 Ga0451577_0000703_14935_16323 459
253 3300042876 Ga0451577_0011211 Ga0451577_0011211_3860_5245 459
254 3300042876 Ga0451577_0039274 Ga0451577_0039274_1184_2566 459
255 3300042876 Ga0451577_0062894 Ga0451577_0062894_1148_2536 459
256 3300042876 Ga0451577_0144933 Ga0451577_0144933_32_1414 459
257 3300042876 Ga0451577_0158277 Ga0451577_0158277_99_1568 459
258 3300044673 Ga0453683_0000759 Ga0453683_0000759_15579_16967 459
259 3300044673 Ga0453683_0008083 Ga0453683_0008083_2016_3398 459
260 3300044673 Ga0453683_0023846 Ga0453683_0023846_947_2407 459
261 3300044673 Ga0453683_0110394 Ga0453683_0110394_127_1509 459
262 3300044712 Ga0453684_0000051 Ga0453684_0000051_273962_275347 459
263 3300044712 Ga0453684_0000143 Ga0453684_0000143_146130_147512 459
264 3300044712 Ga0453684_0000226 Ga0453684_0000226_220365_221750 459
265 3300044712 Ga0453684_0000334 Ga0453684_0000334_187308_188702 459
266 3300044712 Ga0453684_0001990 Ga0453684_0001990_15045_16433 459
267 3300044712 Ga0453684_0007503 Ga0453684_0007503_2215_3600 459
268 3300044712 Ga0453684_0007828 Ga0453684_0007828_12690_14072 459
269 3300044712 Ga0453684_0010329 Ga0453684_0010329_10017_11414 459
270 3300044712 Ga0453684_0017784 Ga0453684_0017784_9122_10513 459
271 3300044712 Ga0453684_0041450 Ga0453684_0041450_2297_3679 459
272 3300044712 Ga0453684_0044557 Ga0453684_0044557_3356_4738 459
273 3300044712 Ga0453684_0050259 Ga0453684_0050259_1778_3160 459
274 3300044712 Ga0453684_0055152 Ga0453684_0055152_2487_3869 459
275 3300044712 Ga0453684_0068204 Ga0453684_0068204_779_2182 459
276 3300044712 Ga0453684_0089907 Ga0453684_0089907_1432_2823 459
277 3300044712 Ga0453684_0121093 Ga0453684_0121093_1340_2722 459
278 3300044712 Ga0453684_0125479 Ga0453684_0125479_582_1967 459
279 3300044712 Ga0453684_0207416 Ga0453684_0207416_141_1610 459
280 3300044712 Ga0453684_0231756 Ga0453684_0231756_166_1551 459
281 3300044712 Ga0453684_0233633 Ga0453684_0233633_263_1648 459
282 3300044712 Ga0453684_0247894 Ga0453684_0247894_333_1721 459
283 3300044712 Ga0453684_0260341 Ga0453684_0260341_136_1527 459
284 3300044712 Ga0453684_0361764 Ga0453684_0361764_12_1394 459
285 3300045051 Ga0451576_0000352 Ga0451576_0000352_35987_37375 459
286 3300045051 Ga0451576_0001289 Ga0451576_0001289_1757_3220 459
287 3300045051 Ga0451576_0002703 Ga0451576_0002703_22352_23734 459
288 3300045051 Ga0451576_0002985 Ga0451576_0002985_1622_3007 459
289 3300045051 Ga0451576_0027025 Ga0451576_0027025_580_1965 459
290 3300045051 Ga0451576_0056667 Ga0451576_0056667_2365_3747 459
291 3300045051 Ga0451576_0073664 Ga0451576_0073664_1701_3083 459
292 3300045051 Ga0451576_0098067 Ga0451576_0098067_56_1441 459
293 3300045051 Ga0451576_0103563 Ga0451576_0103563_1467_2855 459
294 3300045051 Ga0451576_0218339 Ga0451576_0218339_34_1431 459
295 3300049758 Ga0501241_000949 Ga0501241_000949_2585_4039 459
296 2162886007 SwRhRL2b_contig_1465543 SwRhRL2b_0932.00006380 460
297 2162886007 SwRhRL2b_contig_2462835 SwRhRL2b_0237.00004060 460
298 3300001915 JGI24741J21665_1001112 JGI24741J21665_10011128 460
299 3300003323 rootH1_10069924 rootH1_100699243 460
300 3300003578 Ga0006562J51391_1012845 Ga0006562J51391_10128452 460
301 3300005288 Ga0065714_10002783 Ga0065714_1000278311 460
302 3300005288 Ga0065714_10003592 Ga0065714_100035925 460
303 3300005288 Ga0065714_10078066 Ga0065714_100780664 460
304 3300005289 Ga0065704_10000703 Ga0065704_1000070311 460
305 3300005289 Ga0065704_10070801 Ga0065704_100708019 460
306 3300005289 Ga0065704_10072930 Ga0065704_100729307 460
307 3300005289 Ga0065704_10075387 Ga0065704_100753872 460
308 3300005293 Ga0065715_10002923 Ga0065715_100029234 460
309 3300005329 Ga0070683_100012560 Ga0070683_1000125605 460
310 3300005331 Ga0070670_100010892 Ga0070670_1000108924 460
311 3300005337 Ga0070682_100001079 Ga0070682_1000010798 460
312 3300005339 Ga0070660_100067110 Ga0070660_1000671102 460
313 3300005347 Ga0070668_100009717 Ga0070668_1000097171 460
314 3300005354 Ga0070675_100027132 Ga0070675_1000271323 460
315 3300005355 Ga0070671_100195755 Ga0070671_1001957551 460
316 3300005366 Ga0070659_100003108 Ga0070659_1000031083 460
317 3300005535 Ga0070684_100002982 Ga0070684_10000298212 460
318 3300005564 Ga0070664_100005324 Ga0070664_1000053245 460
319 3300005577 Ga0068857_100140460 Ga0068857_1001404603 460
320 3300005616 Ga0068852_100004922 Ga0068852_1000049224 460
321 3300005834 Ga0068851_10025482 Ga0068851_100254822 460
322 3300006942 Ga0099824_1000378 Ga0099824_100037836 460
323 3300006946 Ga0079104_1000108 Ga0079104_100010859 460
324 3300006948 Ga0099826_10023160 Ga0099826_100231603 460
325 3300009011 Ga0105251_10064072 Ga0105251_100640721 460
326 3300009036 Ga0105244_10000029 Ga0105244_10000029108 460
327 3300009036 Ga0105244_10000099 Ga0105244_1000009944 460
328 3300009092 Ga0105250_10009113 Ga0105250_100091132 460
329 3300009098 Ga0105245_10047331 Ga0105245_100473314 460
330 3300009148 Ga0105243_10000149 Ga0105243_1000014911 460
331 3300009545 Ga0105237_10112120 Ga0105237_101121202 460
332 3300009553 Ga0105249_10106150 Ga0105249_101061502 460
333 3300013100 Ga0157373_10000020 Ga0157373_1000002083 460
334 3300013102 Ga0157371_10000019 Ga0157371_10000019241 460
335 3300013102 Ga0157371_10015773 Ga0157371_100157735 460
336 3300013104 Ga0157370_10000403 Ga0157370_1000040320 460
337 3300013104 Ga0157370_10000420 Ga0157370_100004208 460
338 3300013104 Ga0157370_10000434 Ga0157370_1000043424 460
339 3300013104 Ga0157370_10000871 Ga0157370_1000087133 460
340 3300013104 Ga0157370_10047081 Ga0157370_100470814 460
341 3300013104 Ga0157370_10120488 Ga0157370_101204881 460
342 3300013105 Ga0157369_10000436 Ga0157369_1000043626 460
343 3300013105 Ga0157369_10017402 Ga0157369_100174024 460
344 3300013296 Ga0157374_10170697 Ga0157374_101706972 460
345 3300013307 Ga0157372_10042324 Ga0157372_100423244 460
346 3300013307 Ga0157372_10065150 Ga0157372_100651503 460
347 3300013307 Ga0157372_10092591 Ga0157372_100925912 460
348 3300013307 Ga0157372_10232400 Ga0157372_102324002 460
349 3300013308 Ga0157375_10000357 Ga0157375_100003578 460
350 3300013308 Ga0157375_10061621 Ga0157375_100616212 460
351 3300014325 Ga0163163_10002667 Ga0163163_1000266710 460
352 3300014497 Ga0182008_10000005 Ga0182008_10000005305 460
353 3300015261 Ga0182006_1000001 Ga0182006_1000001303 460
354 3300015261 Ga0182006_1012656 Ga0182006_10126563 460
355 3300017792 Ga0163161_10000023 Ga0163161_1000002347 460
356 3300017792 Ga0163161_10007936 Ga0163161_100079363 460
357 3300025291 Ga0209675_1000022 Ga0209675_1000022284 460
358 3300025728 Ga0207655_1000097 Ga0207655_100009780 460
359 3300025728 Ga0207655_1000239 Ga0207655_100023920 460
360 3300025904 Ga0207647_10000054 Ga0207647_1000005450 460
361 3300025923 Ga0207681_10080871 Ga0207681_100808712 460
362 3300025925 Ga0207650_10003750 Ga0207650_100037505 460
363 3300025932 Ga0207690_10002163 Ga0207690_100021635 460
364 3300025935 Ga0207709_10000044 Ga0207709_10000044149 460
365 3300025944 Ga0207661_10010788 Ga0207661_100107885 460
366 3300025945 Ga0207679_10003059 Ga0207679_100030597 460
367 3300025961 Ga0207712_10074622 Ga0207712_100746222 460
368 3300025972 Ga0207668_10044750 Ga0207668_100447503 460
369 3300026041 Ga0207639_10243842 Ga0207639_102438421 460
370 3300026116 Ga0207674_10161198 Ga0207674_101611982 460
371 3300026142 Ga0207698_10029915 Ga0207698_100299152 460
372 3300027111 Ga0209281_1000208 Ga0209281_100020859 460
373 3300027361 Ga0209489_113012 Ga0209489_1130122 460
374 3300028653 Ga0265323_10000021 Ga0265323_1000002146 460
375 3300028800 Ga0265338_10003003 Ga0265338_1000300314 460
376 3300028800 Ga0265338_10005037 Ga0265338_100050375 460
377 3300031344 Ga0265316_10001515 Ga0265316_1000151516 460
378 3300031344 Ga0265316_10008492 Ga0265316_100084925 460
379 3300031548 Ga0307408_100001015 Ga0307408_10000101513 460
380 3300031712 Ga0265342_10075867 Ga0265342_100758672 460
381 3300031728 Ga0316578_10008895 Ga0316578_100088952 460
382 3300031731 Ga0307405_10000002 Ga0307405_10000002432 460
383 3300031733 Ga0316577_10040158 Ga0316577_100401581 460
384 3300031824 Ga0307413_10000047 Ga0307413_1000004724 460
385 3300031852 Ga0307410_10000027 Ga0307410_1000002732 460
386 3300031852 Ga0307410_10000749 Ga0307410_100007493 460
387 3300031901 Ga0307406_10000271 Ga0307406_1000027117 460
388 3300031911 Ga0307412_10000006 Ga0307412_10000006330 460
389 3300031911 Ga0307412_10000098 Ga0307412_1000009824 460
390 3300031911 Ga0307412_10003525 Ga0307412_100035256 460
391 3300032002 Ga0307416_100000021 Ga0307416_100000021190 460
392 3300032002 Ga0307416_100029143 Ga0307416_1000291433 460
393 3300032004 Ga0307414_10000008 Ga0307414_1000000844 460
394 3300032004 Ga0307414_10000025 Ga0307414_10000025117 460
395 3300032004 Ga0307414_10004625 Ga0307414_100046256 460
396 3300032004 Ga0307414_10022799 Ga0307414_100227993 460
397 3300032004 Ga0307414_10089536 Ga0307414_100895363 460
398 3300032005 Ga0307411_10000018 Ga0307411_100000181 460
399 3300032005 Ga0307411_10006080 Ga0307411_100060803 460
400 3300033180 Ga0307510_10113942 Ga0307510_101139423 460
401 3300036712 Ga0316584_0000112 Ga0316584_0000112_19930_21327 460
402 3300036712 Ga0316584_0026831 Ga0316584_0026831_1167_2558 460
403 3300037471 Ga0395905_0066024 Ga0395905_0066024_1137_2609 460
404 3300039062 Ga0400483_242687 Ga0400483_242687_8651_10039 460
405 3300041407 Ga0439447_000624 Ga0439447_000624_4225_5613 460
406 3300041411 Ga0439466_0002727 Ga0439466_0002727_3944_5326 460
407 3300041413 Ga0439465_0000007 Ga0439465_0000007_23406_24788 460
408 3300041456 Ga0451795_0040079 Ga0451795_0040079_1318_2709 460
409 3300042004 Ga0439445_0000049 Ga0439445_0000049_13627_15009 460
410 3300042876 Ga0451577_0178357 Ga0451577_0178357_371_1756 460
411 3300044712 Ga0453684_0001838 Ga0453684_0001838_31263_32774 460
412 3300044712 Ga0453684_0002274 Ga0453684_0002274_6625_8010 460
413 3300044712 Ga0453684_0004651 Ga0453684_0004651_8213_9652 460
414 3300044712 Ga0453684_0008816 Ga0453684_0008816_8683_10074 460
415 3300044712 Ga0453684_0015606 Ga0453684_0015606_9512_10897 460
416 3300044712 Ga0453684_0023448 Ga0453684_0023448_2090_3487 460
417 3300044712 Ga0453684_0048314 Ga0453684_0048314_250_1638 460
418 3300044712 Ga0453684_0068155 Ga0453684_0068155_1868_3256 460
419 3300044712 Ga0453684_0246636 Ga0453684_0246636_549_1934 460
420 3300044712 Ga0453684_0271549 Ga0453684_0271549_85_1473 460
421 3300045049 Ga0466959_0087776 Ga0466959_0087776_536_1936 460
422 3300046453 Ga0495627_000012 Ga0495627_000012_89820_91202 460
423 3300046453 Ga0495627_002756 Ga0495627_002756_1962_3344 460
424 3300046453 Ga0495627_005575 Ga0495627_005575_246_1637 460
425 3300046507 Ga0495606_0004755 Ga0495606_0004755_4990_6372 460
426 3300046507 Ga0495606_0013783 Ga0495606_0013783_2626_4014 460
427 3300046512 Ga0495610_0000005 Ga0495610_0000005_777922_779304 460
428 3300046519 Ga0495632_0007160 Ga0495632_0007160_1203_2585 460
429 3300046522 Ga0495643_0001055 Ga0495643_0001055_5579_6970 460
430 3300046525 Ga0495663_0000047 Ga0495663_0000047_9302_10684 460
431 3300046530 Ga0495654_0000003 Ga0495654_0000003_230475_231857 460
432 3300046538 Ga0495609_0000003 Ga0495609_0000003_242661_244043 460
433 3300046558 Ga0495633_0003662 Ga0495633_0003662_1851_3233 460
434 3300046660 Ga0495625_0000549 Ga0495625_0000549_33211_34593 460
435 3300046660 Ga0495625_0021610 Ga0495625_0021610_1910_3301 460
436 3300046810 Ga0495660_0029914 Ga0495660_0029914_241_1623 460
437 3300047472 Ga0495686_0000122 Ga0495686_0000122_68066_69448 460
438 3300047472 Ga0495686_0009106 Ga0495686_0009106_3321_4703 460
439 3300048919 Ga0496116_0000004 Ga0496116_0000004_677750_679138 460
440 3300048919 Ga0496116_0000051 Ga0496116_0000051_82562_83944 460
441 3300048920 Ga0496117_0000007 Ga0496117_0000007_636542_637924 460
442 3300048921 Ga0496118_0000118 Ga0496118_0000118_82521_83903 460
443 3300048921 Ga0496118_0086095 Ga0496118_0086095_414_1796 460
444 3300048922 Ga0496119_0000028 Ga0496119_0000028_82480_83862 460
445 3300048923 Ga0496120_0076473 Ga0496120_0076473_226_1608 460
446 3300048924 Ga0496121_0011962 Ga0496121_0011962_3920_5308 460
447 3300048924 Ga0496121_0032586 Ga0496121_0032586_1491_2873 460
448 3300048924 Ga0496121_0158366 Ga0496121_0158366_51_1439 460
449 3300048925 Ga0496122_0000368 Ga0496122_0000368_6104_7486 460
450 3300048925 Ga0496122_0000406 Ga0496122_0000406_82849_84231 460
451 3300048925 Ga0496122_0000875 Ga0496122_0000875_49551_50933 460
452 3300048925 Ga0496122_0003781 Ga0496122_0003781_6840_8222 460
453 3300048925 Ga0496122_0022883 Ga0496122_0022883_339_1721 460
454 3300048926 Ga0496123_0001690 Ga0496123_0001690_11532_12914 460
455 3300048926 Ga0496123_0006116 Ga0496123_0006116_6742_8124 460
456 3300048926 Ga0496123_0007222 Ga0496123_0007222_3422_4804 460
457 3300048927 Ga0496124_0001239 Ga0496124_0001239_13151_14533 460
458 3300048927 Ga0496124_0068644 Ga0496124_0068644_932_2320 460
459 3300048927 Ga0496124_0070147 Ga0496124_0070147_742_2124 460
460 3300048928 Ga0496125_0000082 Ga0496125_0000082_67517_68905 460
461 3300048928 Ga0496125_0000184 Ga0496125_0000184_1060_2442 460
462 3300048928 Ga0496125_0001005 Ga0496125_0001005_39159_40541 460
463 3300048928 Ga0496125_0037568 Ga0496125_0037568_2532_3914 460
464 3300048929 Ga0496126_0012255 Ga0496126_0012255_1361_2743 460
465 3300048929 Ga0496126_0036877 Ga0496126_0036877_1660_3048 460
466 3300049569 Ga0501032_0025374 Ga0501032_0025374_1652_3049 460
467 3300049570 Ga0501033_0000005 Ga0501033_0000005_376839_378317 460
468 3300049571 Ga0501034_0000052 Ga0501034_0000052_12247_13740 460
469 3300049571 Ga0501034_0102450 Ga0501034_0102450_566_1957 460
470 3300049572 Ga0501036_0002416 Ga0501036_0002416_8180_9658 460
471 3300049575 Ga0501039_0005537 Ga0501039_0005537_6134_7612 460
472 3300049579 Ga0501043_0001363 Ga0501043_0001363_19610_21088 460
473 3300049580 Ga0501046_0167006 Ga0501046_0167006_178_1566 460
474 3300049671 Ga0501238_000067 Ga0501238_000067_6270_7658 460
475 3300049674 Ga0501242_000414 Ga0501242_000414_1409_2800 460
476 3300049679 Ga0501249_000219 Ga0501249_000219_10136_11524 460
477 3300049688 Ga0501259_000574 Ga0501259_000574_1577_2968 460
478 3300049758 Ga0501241_000008 Ga0501241_000008_39340_40722 460
479 3300049763 Ga0501266_000030 Ga0501266_000030_8401_9789 460
480 3300049766 Ga0501269_000257 Ga0501269_000257_11047_12429 460
481 3300049776 Ga0501280_000548 Ga0501280_000548_2511_3899 460
482 3300049776 Ga0501280_005116 Ga0501280_005116_117_1499 460
483 3300049822 Ga0501035_0041480 Ga0501035_0041480_1996_3384 460
484 3300049822 Ga0501035_0071201 Ga0501035_0071201_1589_3067 460
485 3300049823 Ga0501044_0002047 Ga0501044_0002047_12345_13823 460
486 3300049824 Ga0501045_0000192 Ga0501045_0000192_1420_2898 460
487 3300053096 Ga0500641_0000009 Ga0500641_0000009_159749_161137 460
488 3300053096 Ga0500641_0000092 Ga0500641_0000092_23265_24884 460
489 3300053134 Ga0500658_0000061 Ga0500658_0000061_8274_9662 460
490 3300053136 Ga0500559_0003612 Ga0500559_0003612_1522_2910 460
491 3300053136 Ga0500559_0043404 Ga0500559_0043404_10_1392 460

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

80

221

0.97

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

344

454

0.93

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

238

340

0.91

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

459

532

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f7l-assembly1.cif.gz_A crystal structure of sulfolobus tokodaii phosphomannomutase/phosphoglucomutase 0.9248 1 458
2f7l-assembly1.cif.gz_A crystal structure of sulfolobus tokodaii phosphomannomutase/phosphoglucomutase 0.9208 1 458
1wqa-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+ 0.9193 6 456
1p5g-assembly1.cif.gz_X enzyme-ligand complex of p. aeruginosa pmm/pgm 0.9117 8 458
7olh-assembly3.cif.gz_E bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) 0.9075 5 371
ID Description Score Start End Superfamily
1wqaC03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9501 269 346 3.40.120.10
1wqaB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9471 160 263 3.40.120.10
af_Q54TE6_385_467_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9456 379 458 3.30.310.50
af_Q54TE6_2_156_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9452 1 154 3.40.120.10
af_O86374_256_373_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9362 260 371 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A355Z8J4-F1-model_v4 deleted 0.995 255 460
AF-A0A848U1F6-F1-model_v4 Phosphoglucosamine mutase 0.9948 235 459 GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A2D5V1U8-F1-model_v4 cysteine desulfurase (EC 2.8.1.7) 0.9945 1 460 GO:0000287
GO:0005975
GO:0008966
GO:0016226
GO:0051536
AF-A0A2G2DUP6-F1-model_v4 Phosphoglucosamine mutase 0.9924 1 460 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A2D5V1U8-F1-model_v4 cysteine desulfurase (EC 2.8.1.7) 0.9924 1 460 GO:0000287
GO:0005975
GO:0008966
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
94.85 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map