F454166

General Info

Members Datasets Scaffolds Average Seq Length
491 324 982 228

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_000018|Ga0495687_000018_190392_191081
Length 222
Sequence MNMYELGVVYRNISRADGDAATKLGTLGSATVHEAMGRVGLMKTYMRPIYPGAQASGTAVTVLLQPGDNWMLHVAAEQIQPGDIVVAACTTDNTDGFFGDLLATSFKARGARALIIDGGVRDVRVLTEMNFPVWSRAISSKGTVKATLGSVNIPVVCAGALVTPGDVIVADPSASAHNVLQKAVAREALEEEKRAKLATGVLGLDMYSMREPLERAGLRYID

Samples

Sample ID Description Type Environment
1 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
291 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
294 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
295 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
296 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
297 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
300 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
301 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
302 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
303 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
304 2643221569 Achromobacter sp. Root565 Isolate Unclassified
305 2643221594 Achromobacter sp. Root170 Isolate Unclassified
306 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
307 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
308 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
309 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
310 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
311 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
312 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
313 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
314 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
315 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
316 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
317 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
318 2831864461 Roseateles noduli HZ7 Isolate Nodule
319 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
320 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
321 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
322 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
323 639633007 Azoarcus olearius BH72 Isolate Unclassified
324 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0
Isolates 5.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 1.22
Rhizoplane 4.89
Rhizosphere 78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495687_000018 3300047443 Bacteria 342973
2 Ga0055526_1001623 3300003771 Bacteria 15773
3 Ga0055530_10003376 3300003791 Bacteria 9129
4 Ga0055540_1000016 3300003792 Bacteria 232942
5 Ga0055531_10001335 3300003794 Bacteria 18427
6 Ga0055531_10034742 3300003794 Bacteria 1593
7 Ga0065165_1000323 3300005262 Bacteria 78079
8 Ga0070658_10000534 3300005327 Bacteria 33047
9 Ga0070658_10007844 3300005327 Bacteria 8600
10 Ga0070676_10069517 3300005328 Bacteria 2110
11 Ga0070683_100005207 3300005329 Bacteria 10822
12 Ga0070683_100024988 3300005329 Bacteria 5358
13 Ga0070683_100411370 3300005329 Bacteria 1290
14 Ga0070690_100009057 3300005330 Bacteria 5755
15 Ga0070670_100090130 3300005331 Bacteria 2636
16 Ga0068869_100038646 3300005334 Bacteria 3404
17 Ga0070666_10282055 3300005335 Bacteria 1181
18 Ga0070680_100011410 3300005336 Bacteria 6872
19 Ga0070680_100340915 3300005336 Bacteria 1273
20 Ga0070680_100598556 3300005336 Bacteria 946
21 Ga0070682_100000252 3300005337 Bacteria 38842
22 Ga0070682_100018824 3300005337 Bacteria 4043
23 Ga0068868_100151350 3300005338 Bacteria 1911
24 Ga0070660_100270491 3300005339 Bacteria 1389
25 Ga0070689_100000047 3300005340 Bacteria 75697
26 Ga0070689_100027445 3300005340 Bacteria 4292
27 Ga0070689_100116814 3300005340 Bacteria 2127
28 Ga0070689_100263908 3300005340 Bacteria 1424
29 Ga0070689_100274029 3300005340 Bacteria 1398
30 Ga0070689_100466512 3300005340 Bacteria 1077
31 Ga0070689_100469860 3300005340 Bacteria 1073
32 Ga0070687_100186290 3300005343 Bacteria 1247
33 Ga0070669_100126172 3300005353 Bacteria 1958
34 Ga0070675_100049771 3300005354 Bacteria 3440
35 Ga0070675_100157985 3300005354 Bacteria 1948
36 Ga0070671_100122732 3300005355 Bacteria 2186
37 Ga0070674_100005518 3300005356 Bacteria 7313
38 Ga0070673_100031352 3300005364 Bacteria 3988
39 Ga0070673_100041477 3300005364 Bacteria 3540
40 Ga0070673_100173617 3300005364 Bacteria 1841
41 Ga0070673_100372271 3300005364 Bacteria 1272
42 Ga0070659_100214915 3300005366 Bacteria 1585
43 Ga0070667_100062521 3300005367 Bacteria 3154
44 Ga0070667_100166370 3300005367 Bacteria 1945
45 Ga0070709_10155636 3300005434 Bacteria 1584
46 Ga0070710_10156659 3300005437 Bacteria 1409
47 Ga0070710_10330116 3300005437 Bacteria 1004
48 Ga0070701_10054981 3300005438 Bacteria 2077
49 Ga0070711_100151260 3300005439 Bacteria 1750
50 Ga0070705_100154819 3300005440 Bacteria 1525
51 Ga0070700_100017294 3300005441 Bacteria 4119
52 Ga0070663_100458545 3300005455 Bacteria 1052
53 Ga0070678_100644166 3300005456 Bacteria 950
54 Ga0070662_100198683 3300005457 Bacteria 1590
55 Ga0070681_10156558 3300005458 Bacteria 2203
56 Ga0070681_10347732 3300005458 Bacteria 1393
57 Ga0068867_100001878 3300005459 Bacteria 14605
58 Ga0068867_100040944 3300005459 Bacteria 3385
59 Ga0070685_10100449 3300005466 Bacteria 1766
60 Ga0070707_100317861 3300005468 Bacteria 1513
61 Ga0070699_100092662 3300005518 Bacteria 2643
62 Ga0070679_100000180 3300005530 Bacteria 50879
63 Ga0070679_100220439 3300005530 Bacteria 1858
64 Ga0070679_100447487 3300005530 Bacteria 1236
65 Ga0070684_100000578 3300005535 Bacteria 25373
66 Ga0070684_100004669 3300005535 Bacteria 10461
67 Ga0070684_100306018 3300005535 Bacteria 1459
68 Ga0068853_100021596 3300005539 Bacteria 5370
69 Ga0068853_100138093 3300005539 Bacteria 2187
70 Ga0070672_100008479 3300005543 Bacteria 7034
71 Ga0070672_100008902 3300005543 Bacteria 6896
72 Ga0070672_100119121 3300005543 Bacteria 2159
73 Ga0070672_100575220 3300005543 Bacteria 980
74 Ga0070686_100017437 3300005544 Bacteria 4196
75 Ga0068855_100015544 3300005563 Bacteria 9162
76 Ga0068855_100016734 3300005563 Bacteria 8819
77 Ga0068855_100051277 3300005563 Bacteria 4860
78 Ga0068855_100094819 3300005563 Bacteria 3440
79 Ga0068855_100415316 3300005563 Bacteria 1472
80 Ga0068855_100710131 3300005563 Bacteria 1075
81 Ga0068857_100057249 3300005577 Bacteria 3460
82 Ga0068854_100577113 3300005578 Bacteria 957
83 Ga0068859_100027160 3300005617 Bacteria 5743
84 Ga0068859_100142363 3300005617 Bacteria 2472
85 Ga0068864_100308574 3300005618 Bacteria 1483
86 Ga0068864_100712764 3300005618 Bacteria 981
87 Ga0068861_100109272 3300005719 Bacteria 2213
88 Ga0068870_10094652 3300005840 Bacteria 1677
89 Ga0068863_100110610 3300005841 Bacteria 2616
90 Ga0068863_100347031 3300005841 Bacteria 1445
91 Ga0068858_100016017 3300005842 Bacteria 7041
92 Ga0068860_100573878 3300005843 Bacteria 1132
93 Ga0068862_100028032 3300005844 Bacteria 4743
94 Ga0068862_100273760 3300005844 Bacteria 1545
95 Ga0075365_10158449 3300006038 Bacteria 1576
96 Ga0075365_10237046 3300006038 Bacteria 1281
97 Ga0075368_10153481 3300006042 Bacteria 962
98 Ga0075362_10082280 3300006177 Bacteria 1485
99 Ga0075367_10022771 3300006178 Bacteria 3517
100 Ga0075366_10010377 3300006195 Bacteria 5229
101 Ga0075366_10020394 3300006195 Bacteria 3846
102 Ga0097621_100079399 3300006237 Bacteria 2728
103 Ga0068871_100309268 3300006358 Bacteria 1389
104 Ga0075430_100017933 3300006846 Bacteria 6024
105 Ga0068865_100005183 3300006881 Bacteria 7884
106 Ga0097620_100027159 3300006931 Bacteria 5743
107 Ga0097620_100126910 3300006931 Bacteria 2621
108 Ga0097620_100142351 3300006931 Bacteria 2472
109 Ga0105240_10000369 3300009093 Bacteria 84513
110 Ga0105240_10026198 3300009093 Bacteria 7650
111 Ga0111539_10059069 3300009094 Bacteria 4549
112 Ga0111539_10577917 3300009094 Bacteria 1309
113 Ga0105245_10150606 3300009098 Bacteria 2199
114 Ga0105247_10108631 3300009101 Bacteria 1782
115 Ga0114129_10008622 3300009147 Bacteria 14537
116 Ga0105243_10092550 3300009148 Bacteria 2493
117 Ga0105243_10553667 3300009148 Bacteria 1099
118 Ga0105241_10063658 3300009174 Bacteria 2847
119 Ga0105248_10003092 3300009177 Bacteria 18448
120 Ga0105237_10000102 3300009545 Bacteria 118684
121 Ga0105237_10044995 3300009545 Bacteria 4444
122 Ga0105237_10269031 3300009545 Bacteria 1707
123 Ga0105238_10005947 3300009551 Bacteria 12095
124 Ga0105239_10004222 3300010375 Bacteria 17259
125 Ga0105239_10405010 3300010375 Bacteria 1544
126 Ga0157370_10010862 3300013104 Bacteria 9564
127 Ga0157370_10102792 3300013104 Bacteria 2675
128 Ga0157369_10085832 3300013105 Bacteria 3363
129 Ga0157378_10802980 3300013297 Bacteria 967
130 Ga0163162_10266980 3300013306 Bacteria 1843
131 Ga0163162_10567634 3300013306 Bacteria 1262
132 Ga0157375_10034886 3300013308 Bacteria 4796
133 Ga0157375_10064446 3300013308 Bacteria 3648
134 Ga0163163_10017725 3300014325 Bacteria 6647
135 Ga0157377_10278709 3300014745 Bacteria 1095
136 Ga0157379_10112265 3300014968 Bacteria 2449
137 Ga0157379_10234002 3300014968 Bacteria 1666
138 Ga0157376_10372416 3300014969 Bacteria 1373
139 Ga0157376_10428939 3300014969 Bacteria 1285
140 Ga0213876_10058610 3300021384 Bacteria 2033
141 Ga0209673_1015247 3300025273 Bacteria 2930
142 Ga0209673_1071016 3300025273 Bacteria 829
143 Ga0209564_1000097 3300025295 Bacteria 231436
144 Ga0209050_1000082 3300025298 Bacteria 266864
145 Ga0209050_1001259 3300025298 Bacteria 29240
146 Ga0207426_1019281 3300025302 Bacteria 2387
147 Ga0209051_1000029 3300025303 Bacteria 403675
148 Ga0209051_1000055 3300025303 Bacteria 277194
149 Ga0209257_1000030 3300025304 Bacteria 689812
150 Ga0209257_1000101 3300025304 Bacteria 251553
151 Ga0207692_10059657 3300025898 Bacteria 1971
152 Ga0207692_10100599 3300025898 Bacteria 1586
153 Ga0207710_10075163 3300025900 Bacteria 1557
154 Ga0207680_10388835 3300025903 Bacteria 984
155 Ga0207699_10026499 3300025906 Bacteria 3197
156 Ga0207699_10214631 3300025906 Bacteria 1310
157 Ga0207645_10003433 3300025907 Bacteria 12042
158 Ga0207645_10011482 3300025907 Bacteria 6045
159 Ga0207643_10053958 3300025908 Bacteria 2284
160 Ga0207643_10147740 3300025908 Bacteria 1407
161 Ga0207705_10000642 3300025909 Bacteria 29173
162 Ga0207705_10026384 3300025909 Bacteria 4143
163 Ga0207654_10093437 3300025911 Bacteria 1839
164 Ga0207695_10000923 3300025913 Bacteria 52620
165 Ga0207695_10058910 3300025913 Bacteria 3985
166 Ga0207695_10284063 3300025913 Bacteria 1548
167 Ga0207671_10000201 3300025914 Bacteria 91167
168 Ga0207671_10063062 3300025914 Bacteria 2753
169 Ga0207671_10201527 3300025914 Bacteria 1554
170 Ga0207693_10431655 3300025915 Bacteria 1030
171 Ga0207660_10085076 3300025917 Bacteria 2332
172 Ga0207660_10097466 3300025917 Bacteria 2191
173 Ga0207660_10263846 3300025917 Bacteria 1363
174 Ga0207662_10076027 3300025918 Bacteria 2040
175 Ga0207657_10601943 3300025919 Bacteria 858
176 Ga0207652_10009390 3300025921 Bacteria 7865
177 Ga0207652_10032624 3300025921 Bacteria 4380
178 Ga0207646_10150092 3300025922 Bacteria 2101
179 Ga0207681_10002291 3300025923 Bacteria 12161
180 Ga0207681_10201828 3300025923 Bacteria 1527
181 Ga0207694_10003707 3300025924 Bacteria 12098
182 Ga0207694_10531991 3300025924 Bacteria 986
183 Ga0207650_10133105 3300025925 Bacteria 1948
184 Ga0207650_10196839 3300025925 Bacteria 1612
185 Ga0207659_10495087 3300025926 Bacteria 1034
186 Ga0207700_10549273 3300025928 Bacteria 1025
187 Ga0207690_10513993 3300025932 Bacteria 970
188 Ga0207706_10052609 3300025933 Bacteria 3595
189 Ga0207706_10091118 3300025933 Bacteria 2681
190 Ga0207709_10085856 3300025935 Bacteria 2041
191 Ga0207709_10436512 3300025935 Bacteria 1009
192 Ga0207670_10000064 3300025936 Bacteria 75795
193 Ga0207670_10141855 3300025936 Bacteria 1772
194 Ga0207670_10602833 3300025936 Bacteria 902
195 Ga0207704_10017670 3300025938 Bacteria 3704
196 Ga0207691_10008844 3300025940 Bacteria 9663
197 Ga0207691_10017331 3300025940 Bacteria 6832
198 Ga0207691_10050504 3300025940 Bacteria 3807
199 Ga0207691_10116516 3300025940 Bacteria 2371
200 Ga0207711_10034266 3300025941 Bacteria 4301
201 Ga0207689_10004241 3300025942 Bacteria 13040
202 Ga0207661_10000444 3300025944 Bacteria 26690
203 Ga0207661_10003085 3300025944 Bacteria 11542
204 Ga0207661_10593604 3300025944 Bacteria 1016
205 Ga0207679_10064658 3300025945 Bacteria 2735
206 Ga0207667_10004969 3300025949 Bacteria 16240
207 Ga0207667_10218838 3300025949 Bacteria 1951
208 Ga0207667_10527448 3300025949 Bacteria 1196
209 Ga0207651_10050939 3300025960 Bacteria 2815
210 Ga0207651_10141766 3300025960 Bacteria 1857
211 Ga0207651_10154611 3300025960 Bacteria 1790
212 Ga0207651_10502351 3300025960 Bacteria 1048
213 Ga0207668_10080871 3300025972 Bacteria 2355
214 Ga0207668_10195674 3300025972 Bacteria 1606
215 Ga0207658_10038169 3300025986 Bacteria 3458
216 Ga0207658_10250915 3300025986 Bacteria 1503
217 Ga0207658_10380445 3300025986 Bacteria 1236
218 Ga0207677_10053078 3300026023 Bacteria 2757
219 Ga0207677_10640915 3300026023 Bacteria 937
220 Ga0207703_10300966 3300026035 Bacteria 1463
221 Ga0207639_10027771 3300026041 Bacteria 4126
222 Ga0207639_10082656 3300026041 Bacteria 2547
223 Ga0207678_10388856 3300026067 Bacteria 1206
224 Ga0207708_10110506 3300026075 Bacteria 2133
225 Ga0207708_10521773 3300026075 Bacteria 998
226 Ga0207702_10062188 3300026078 Bacteria 3187
227 Ga0207641_10171667 3300026088 Bacteria 1980
228 Ga0207648_10000984 3300026089 Bacteria 32138
229 Ga0207648_10013257 3300026089 Bacteria 7680
230 Ga0207648_10287813 3300026089 Bacteria 1471
231 Ga0207674_10017659 3300026116 Bacteria 7778
232 Ga0207675_100035627 3300026118 Bacteria 4642
233 Ga0207675_100130235 3300026118 Bacteria 2385
234 Ga0207675_100142047 3300026118 Bacteria 2281
235 Ga0207683_10123815 3300026121 Bacteria 2322
236 Ga0207683_10461909 3300026121 Bacteria 1171
237 Ga0207698_10303611 3300026142 Bacteria 1487
238 Ga0207428_10016435 3300027907 Bacteria 6367
239 Ga0207428_10054438 3300027907 Bacteria 3187
240 Ga0268265_10072124 3300028380 Bacteria 2693
241 Ga0268265_10377031 3300028380 Bacteria 1304
242 Ga0268264_10000030 3300028381 Bacteria 418542
243 Ga0307515_10000292 3300028794 Bacteria 123160
244 Ga0265338_10003118 3300028800 Bacteria 23705
245 Ga0265332_10141077 3300031238 Bacteria 1010
246 Ga0265325_10034209 3300031241 Bacteria 2705
247 Ga0265340_10026517 3300031247 Bacteria 2928
248 Ga0307509_10193588 3300031507 Bacteria 1880
249 Ga0307408_100036322 3300031548 Bacteria 3463
250 Ga0307408_100528231 3300031548 Bacteria 1038
251 Ga0265313_10004883 3300031595 Bacteria 10056
252 Ga0265313_10032002 3300031595 Bacteria 2691
253 Ga0307508_10011607 3300031616 Bacteria 8050
254 Ga0265314_10034777 3300031711 Bacteria 3677
255 Ga0307516_10083114 3300031730 Bacteria 3044
256 Ga0307516_10113726 3300031730 Bacteria 2505
257 Ga0307405_10001234 3300031731 Bacteria 10638
258 Ga0307405_10062112 3300031731 Bacteria 2364
259 Ga0307405_10621138 3300031731 Bacteria 885
260 Ga0307413_10002493 3300031824 Bacteria 7503
261 Ga0307413_10149306 3300031824 Bacteria 1626
262 Ga0307410_10010279 3300031852 Bacteria 5291
263 Ga0307410_10156097 3300031852 Bacteria 1704
264 Ga0307406_10073164 3300031901 Bacteria 2252
265 Ga0307406_10170248 3300031901 Bacteria 1575
266 Ga0307406_10188250 3300031901 Bacteria 1509
267 Ga0307412_10004520 3300031911 Bacteria 7750
268 Ga0307412_10206538 3300031911 Bacteria 1495
269 Ga0307412_10469058 3300031911 Bacteria 1041
270 Ga0307409_100104052 3300031995 Bacteria 2363
271 Ga0307409_100215967 3300031995 Bacteria 1727
272 Ga0307416_100023883 3300032002 Bacteria 4448
273 Ga0307416_101032928 3300032002 Bacteria 925
274 Ga0307414_10009478 3300032004 Bacteria 5596
275 Ga0307414_10585624 3300032004 Bacteria 999
276 Ga0307411_10003401 3300032005 Bacteria 7374
277 Ga0307411_10170745 3300032005 Bacteria 1639
278 Ga0307415_100060832 3300032126 Bacteria 2612
279 Ga0307507_10091082 3300033179 Bacteria 2613
280 Ga0373956_0003655 3300035119 Bacteria 6213
281 Ga0373943_0181399 3300035170 Bacteria 1157
282 Ga0373961_0000004 3300035241 Bacteria 147543
283 Ga0373924_0014735 3300035410 Bacteria 2958
284 Ga0373931_0123421 3300035691 Bacteria 1483
285 Ga0373933_0034647 3300035724 Bacteria 2943
286 Ga0373933_0101295 3300035724 Bacteria 1787
287 Ga0373947_0063015 3300035725 Bacteria 2258
288 Ga0373937_0004472 3300036401 Bacteria 11874
289 Ga0373937_0161548 3300036401 Bacteria 2100
290 Ga0373937_0213042 3300036401 Bacteria 1818
291 Ga0373925_0004343 3300037068 Bacteria 10729
292 Ga0373925_0056541 3300037068 Bacteria 2939
293 Ga0395899_0011366 3300037312 Bacteria 6820
294 Ga0395900_0016357 3300037418 Bacteria 7561
295 Ga0395900_0042196 3300037418 Bacteria 4699
296 Ga0395898_0502095 3300037466 Bacteria 1154
297 Ga0395905_0002007 3300037471 Bacteria 23235
298 Ga0395905_0045282 3300037471 Bacteria 4126
299 Ga0395905_0334362 3300037471 Bacteria 1405
300 Ga0395905_0644108 3300037471 Bacteria 961
301 Ga0395901_0175256 3300038443 Bacteria 2249
302 Ga0395901_0455632 3300038443 Bacteria 1308
303 Ga0436365_0098868 3300039437 Bacteria 2592
304 Ga0436363_1484586 3300039450 Bacteria 1638
305 Ga0450898_003685 3300042134 Bacteria 2215
306 Ga0439434_0020060 3300042435 Bacteria 2006
307 Ga0450893_0004350 3300042532 Bacteria 2256
308 Ga0451577_0616318 3300042876 Bacteria 984
309 Ga0453683_0163569 3300044673 Bacteria 1408
310 Ga0453684_0197961 3300044712 Bacteria 2344
311 Ga0453684_1095707 3300044712 Bacteria 842
312 Ga0451576_0118222 3300045051 Bacteria 2759
313 Ga0466967_0521734 3300045976 Bacteria 1167
314 Ga0495590_0014170 3300046457 Bacteria 2916
315 Ga0495629_0004635 3300046459 Bacteria 10294
316 Ga0495629_0124852 3300046459 Bacteria 1793
317 Ga0495653_0002344 3300046463 Bacteria 15034
318 Ga0495582_0151110 3300046473 Bacteria 1318
319 Ga0495664_0017512 3300046477 Bacteria 4098
320 Ga0495664_0036257 3300046477 Bacteria 2906
321 Ga0495584_0000173 3300046491 Bacteria 45316
322 Ga0495585_0004296 3300046492 Bacteria 9275
323 Ga0495585_0180245 3300046492 Bacteria 1086
324 Ga0495596_0070441 3300046500 Bacteria 1359
325 Ga0495607_0004392 3300046501 Bacteria 10390
326 Ga0495608_0188809 3300046511 Bacteria 1302
327 Ga0495610_0056544 3300046512 Bacteria 1886
328 Ga0495616_0000643 3300046513 Bacteria 26050
329 Ga0495618_0408626 3300046514 Bacteria 829
330 Ga0495628_0005737 3300046516 Bacteria 10875
331 Ga0495628_0023182 3300046516 Bacteria 5097
332 Ga0495630_0016913 3300046517 Bacteria 5337
333 Ga0495644_0000119 3300046523 Bacteria 37559
334 Ga0495666_0035859 3300046526 Bacteria 2416
335 Ga0495652_0022690 3300046529 Bacteria 5569
336 Ga0495652_0060441 3300046529 Bacteria 3202
337 Ga0495665_0000753 3300046531 Bacteria 16782
338 Ga0495586_0327004 3300046535 Bacteria 879
339 Ga0495587_0232068 3300046536 Bacteria 1040
340 Ga0495645_0199481 3300046543 Bacteria 1358
341 Ga0495622_0177008 3300046557 Bacteria 957
342 Ga0495633_0000742 3300046558 Bacteria 29473
343 Ga0495656_0093437 3300046615 Bacteria 1379
344 Ga0495611_0001188 3300046648 Bacteria 13508
345 Ga0495611_0013006 3300046648 Bacteria 3539
346 Ga0495625_0077111 3300046660 Bacteria 2329
347 Ga0495635_0005475 3300046663 Bacteria 8832
348 Ga0495661_0019488 3300046665 Bacteria 4445
349 Ga0495599_0177956 3300046678 Bacteria 1311
350 Ga0495623_0002882 3300046679 Bacteria 11335
351 Ga0495623_0068778 3300046679 Bacteria 2208
352 Ga0495646_0007531 3300046680 Bacteria 6917
353 Ga0495646_0223119 3300046680 Bacteria 1018
354 Ga0495647_0258936 3300046681 Bacteria 776
355 Ga0495658_0156813 3300046683 Bacteria 1401
356 Ga0495669_0103173 3300046684 Bacteria 1326
357 Ga0495613_0238511 3300046689 Bacteria 1272
358 Ga0495624_0127015 3300046690 Bacteria 1564
359 Ga0495624_0461169 3300046690 Bacteria 761
360 Ga0495670_0000053 3300046691 Bacteria 60401
361 Ga0495649_0048587 3300046694 Bacteria 2306
362 Ga0495589_0246716 3300046794 Bacteria 835
363 Ga0495600_0118131 3300046809 Bacteria 1725
364 Ga0495604_0000893 3300047317 Bacteria 24849
365 Ga0495604_0012575 3300047317 Bacteria 6731
366 Ga0495604_0171051 3300047317 Bacteria 1528
367 Ga0495636_0137553 3300047318 Bacteria 1089
368 Ga0495674_0073493 3300047319 Bacteria 2947
369 Ga0495672_0003194 3300047320 Bacteria 14247
370 Ga0495680_0010133 3300047322 Bacteria 8422
371 Ga0495680_0138839 3300047322 Bacteria 1779
372 Ga0495680_0141189 3300047322 Bacteria 1762
373 Ga0495680_0153721 3300047322 Bacteria 1676
374 Ga0495675_0020051 3300047444 Bacteria 4248
375 Ga0495675_0049624 3300047444 Bacteria 2667
376 Ga0495677_0000986 3300047445 Bacteria 11456
377 Ga0495593_0003944 3300047673 Bacteria 8859
378 Ga0495602_0001190 3300048088 Bacteria 25555
379 Ga0495602_0021398 3300048088 Bacteria 6367
380 Ga0496100_0075346 3300048903 Bacteria 2263
381 Ga0496100_0122616 3300048903 Bacteria 1820
382 Ga0496101_0115583 3300048904 Bacteria 2024
383 Ga0496102_0229662 3300048905 Bacteria 1750
384 Ga0496103_0158249 3300048906 Bacteria 1452
385 Ga0496104_0001770 3300048907 Bacteria 18682
386 Ga0496104_0008496 3300048907 Bacteria 9134
387 Ga0496104_0632523 3300048907 Bacteria 979
388 Ga0496105_0000769 3300048908 Bacteria 21799
389 Ga0496105_0093582 3300048908 Bacteria 2482
390 Ga0496106_0019847 3300048909 Bacteria 4983
391 Ga0496106_0132160 3300048909 Bacteria 1958
392 Ga0496106_0299277 3300048909 Bacteria 1290
393 Ga0496107_0049325 3300048910 Bacteria 3034
394 Ga0496107_0440791 3300048910 Bacteria 968
395 Ga0496108_0215283 3300048911 Bacteria 1668
396 Ga0496112_0284049 3300048915 Bacteria 1601
397 Ga0496112_0672374 3300048915 Bacteria 964
398 Ga0496113_0210460 3300048916 Bacteria 1548
399 Ga0496114_0000501 3300048917 Bacteria 28631
400 Ga0496114_0007334 3300048917 Bacteria 8706
401 Ga0496114_0009211 3300048917 Bacteria 7829
402 Ga0496115_0053225 3300048918 Bacteria 3248
403 Ga0496116_0173706 3300048919 Bacteria 1164
404 Ga0496117_0188606 3300048920 Bacteria 1177
405 Ga0496118_0004640 3300048921 Bacteria 16123
406 Ga0496118_0101470 3300048921 Bacteria 1943
407 Ga0496121_0000089 3300048924 Bacteria 219007
408 Ga0496121_0115615 3300048924 Bacteria 2036
409 Ga0496121_0137492 3300048924 Bacteria 1818
410 Ga0496121_0146782 3300048924 Bacteria 1742
411 Ga0496124_0089884 3300048927 Bacteria 2506
412 Ga0496125_0070584 3300048928 Bacteria 2734
413 Ga0496125_0393518 3300048928 Bacteria 812
414 Ga0496126_0003551 3300048929 Bacteria 19610
415 Ga0496126_0264894 3300048929 Bacteria 1428
416 Ga0496126_0467080 3300048929 Bacteria 1013
417 Ga0495682_0041915 3300049460 Bacteria 1678
418 Ga0495682_0130923 3300049460 Bacteria 897
419 Ga0501031_0059474 3300049568 Bacteria 2490
420 Ga0501032_0036917 3300049569 Bacteria 3334
421 Ga0501032_0164743 3300049569 Bacteria 1455
422 Ga0501033_0008619 3300049570 Bacteria 7892
423 Ga0501034_0020044 3300049571 Bacteria 6830
424 Ga0501036_0005963 3300049572 Bacteria 9878
425 Ga0501037_0178909 3300049573 Bacteria 1505
426 Ga0501038_0069632 3300049574 Bacteria 2988
427 Ga0501043_0000643 3300049579 Bacteria 30832
428 Ga0501046_0002679 3300049580 Bacteria 16603
429 Ga0501047_0005052 3300049581 Bacteria 12383
430 Ga0501047_0319103 3300049581 Bacteria 1394
431 Ga0501067_0032984 3300049583 Bacteria 2874
432 Ga0501068_0231166 3300049584 Bacteria 1176
433 Ga0501069_0314796 3300049585 Bacteria 919
434 Ga0501070_0006327 3300049586 Bacteria 10076
435 Ga0501070_0020021 3300049586 Bacteria 5610
436 Ga0501072_0031356 3300049588 Bacteria 4160
437 Ga0501073_0010248 3300049589 Bacteria 6884
438 Ga0501080_0012936 3300049742 Bacteria 7660
439 Ga0501083_0048123 3300049744 Bacteria 2879
440 Ga0501035_0002048 3300049822 Bacteria 20096
441 Ga0501044_0000515 3300049823 Bacteria 47051
442 Ga0501044_0007899 3300049823 Bacteria 11699
443 Ga0501044_0217928 3300049823 Bacteria 1860
444 Ga0501044_0312266 3300049823 Bacteria 1498
445 nmdc:mga0yw44_291093_c1 3300050492 Bacteria 1093
446 nmdc:mga0yw44_89640_c1 3300050492 Bacteria 1941
447 nmdc:mga0k408_206_c1 3300050493 Bacteria 31456
448 nmdc:mga0k408_65766_c1 3300050493 Bacteria 1245
449 nmdc:mga06z11_229009_c1 3300050494 Bacteria 1088
450 nmdc:mga05p37_52613_c1 3300050507 Bacteria 5006
451 nmdc:mga0qj67_18883_c1 3300050509 Bacteria 5260
452 nmdc:mga08y16_241424_c1 3300050511 Bacteria 1868
453 nmdc:mga0n895_435785_c1 3300050512 Bacteria 1324
454 Ga0500635_0060985 3300053080 Bacteria 1316
455 Ga0495619_0116372 3300053085 Bacteria 1830
456 Ga0500646_0015845 3300053090 Bacteria 1965
457 Ga0500647_0141163 3300053091 Bacteria 1130
458 Ga0500559_0107807 3300053136 Bacteria 1288
459 Ga0500573_0120528 3300053140 Bacteria 1460
460 Ga0500590_200450 3300053148 Bacteria 845
461 Ga0500638_175021 3300053162 Bacteria 931
462 Ga0500639_169760 3300053163 Bacteria 980
463 Ga0500596_006719 3300053735 Bacteria 1927
464 Ga0466962_0263917 3300061719 Bacteria 848
465 2510247802 2510065045 Bacteria 7761063
466 2512350147 2512047030 Bacteria 9031815
467 2512353008 2512047030 Bacteria 9031815
468 2515682115 2515154122 Bacteria 8609520
469 2599905995 2599185292 Bacteria 6290804
470 2616905919 2616644941 Bacteria 8510691
471 2643858999 2643221569 Bacteria 6064337
472 2643981824 2643221594 Bacteria 5811388
473 2719643766 2718217991 Bacteria 7829542
474 2723879020 2721755763 Bacteria 4464185
475 2738821397 2738541296 Bacteria 7285013
476 2738833880 2738541298 Bacteria 7286732
477 2738875083 2738541306 Bacteria 7284992
478 2739187037 2738543002 Bacteria 7284546
479 2739221681 2738543008 Bacteria 7282815
480 2746091604 2744054900 Bacteria 8399525
481 2746099241 2744054901 Bacteria 8397047
482 2774392419 2773857762 Bacteria 5971770
483 2808876897 2808606366 Bacteria 4415912
484 2809033884 2808606395 Bacteria 6020352
485 2831867251 2831864461 Bacteria 6502356
486 2866557010 2866552031 Bacteria 5824618
487 2885274407 2885270888 Bacteria 9831543
488 2902685526 2902682994 Bacteria 8951596
489 2919533645 2919527303 Bacteria 7718827
490 639787696 639633007 Bacteria 4376040
491 8025535349 8025530807 Bacteria 8495698
492 Ga0495687_000018
493 Ga0055526_1001623
494 Ga0055530_10003376
495 Ga0055540_1000016
496 Ga0055531_10001335
497 Ga0055531_10034742
498 Ga0065165_1000323
499 Ga0070658_10000534
500 Ga0070658_10007844
501 Ga0070676_10069517
502 Ga0070683_100005207
503 Ga0070683_100024988
504 Ga0070683_100411370
505 Ga0070690_100009057
506 Ga0070670_100090130
507 Ga0068869_100038646
508 Ga0070666_10282055
509 Ga0070680_100011410
510 Ga0070680_100340915
511 Ga0070680_100598556
512 Ga0070682_100000252
513 Ga0070682_100018824
514 Ga0068868_100151350
515 Ga0070660_100270491
516 Ga0070689_100000047
517 Ga0070689_100027445
518 Ga0070689_100116814
519 Ga0070689_100263908
520 Ga0070689_100274029
521 Ga0070689_100466512
522 Ga0070689_100469860
523 Ga0070687_100186290
524 Ga0070669_100126172
525 Ga0070675_100049771
526 Ga0070675_100157985
527 Ga0070671_100122732
528 Ga0070674_100005518
529 Ga0070673_100031352
530 Ga0070673_100041477
531 Ga0070673_100173617
532 Ga0070673_100372271
533 Ga0070659_100214915
534 Ga0070667_100062521
535 Ga0070667_100166370
536 Ga0070709_10155636
537 Ga0070710_10156659
538 Ga0070710_10330116
539 Ga0070701_10054981
540 Ga0070711_100151260
541 Ga0070705_100154819
542 Ga0070700_100017294
543 Ga0070663_100458545
544 Ga0070678_100644166
545 Ga0070662_100198683
546 Ga0070681_10156558
547 Ga0070681_10347732
548 Ga0068867_100001878
549 Ga0068867_100040944
550 Ga0070685_10100449
551 Ga0070707_100317861
552 Ga0070699_100092662
553 Ga0070679_100000180
554 Ga0070679_100220439
555 Ga0070679_100447487
556 Ga0070684_100000578
557 Ga0070684_100004669
558 Ga0070684_100306018
559 Ga0068853_100021596
560 Ga0068853_100138093
561 Ga0070672_100008479
562 Ga0070672_100008902
563 Ga0070672_100119121
564 Ga0070672_100575220
565 Ga0070686_100017437
566 Ga0068855_100015544
567 Ga0068855_100016734
568 Ga0068855_100051277
569 Ga0068855_100094819
570 Ga0068855_100415316
571 Ga0068855_100710131
572 Ga0068857_100057249
573 Ga0068854_100577113
574 Ga0068859_100027160
575 Ga0068859_100142363
576 Ga0068864_100308574
577 Ga0068864_100712764
578 Ga0068861_100109272
579 Ga0068870_10094652
580 Ga0068863_100110610
581 Ga0068863_100347031
582 Ga0068858_100016017
583 Ga0068860_100573878
584 Ga0068862_100028032
585 Ga0068862_100273760
586 Ga0075365_10158449
587 Ga0075365_10237046
588 Ga0075368_10153481
589 Ga0075362_10082280
590 Ga0075367_10022771
591 Ga0075366_10010377
592 Ga0075366_10020394
593 Ga0097621_100079399
594 Ga0068871_100309268
595 Ga0075430_100017933
596 Ga0068865_100005183
597 Ga0097620_100027159
598 Ga0097620_100126910
599 Ga0097620_100142351
600 Ga0105240_10000369
601 Ga0105240_10026198
602 Ga0111539_10059069
603 Ga0111539_10577917
604 Ga0105245_10150606
605 Ga0105247_10108631
606 Ga0114129_10008622
607 Ga0105243_10092550
608 Ga0105243_10553667
609 Ga0105241_10063658
610 Ga0105248_10003092
611 Ga0105237_10000102
612 Ga0105237_10044995
613 Ga0105237_10269031
614 Ga0105238_10005947
615 Ga0105239_10004222
616 Ga0105239_10405010
617 Ga0157370_10010862
618 Ga0157370_10102792
619 Ga0157369_10085832
620 Ga0157378_10802980
621 Ga0163162_10266980
622 Ga0163162_10567634
623 Ga0157375_10034886
624 Ga0157375_10064446
625 Ga0163163_10017725
626 Ga0157377_10278709
627 Ga0157379_10112265
628 Ga0157379_10234002
629 Ga0157376_10372416
630 Ga0157376_10428939
631 Ga0213876_10058610
632 Ga0209673_1015247
633 Ga0209673_1071016
634 Ga0209564_1000097
635 Ga0209050_1000082
636 Ga0209050_1001259
637 Ga0207426_1019281
638 Ga0209051_1000029
639 Ga0209051_1000055
640 Ga0209257_1000030
641 Ga0209257_1000101
642 Ga0207692_10059657
643 Ga0207692_10100599
644 Ga0207710_10075163
645 Ga0207680_10388835
646 Ga0207699_10026499
647 Ga0207699_10214631
648 Ga0207645_10003433
649 Ga0207645_10011482
650 Ga0207643_10053958
651 Ga0207643_10147740
652 Ga0207705_10000642
653 Ga0207705_10026384
654 Ga0207654_10093437
655 Ga0207695_10000923
656 Ga0207695_10058910
657 Ga0207695_10284063
658 Ga0207671_10000201
659 Ga0207671_10063062
660 Ga0207671_10201527
661 Ga0207693_10431655
662 Ga0207660_10085076
663 Ga0207660_10097466
664 Ga0207660_10263846
665 Ga0207662_10076027
666 Ga0207657_10601943
667 Ga0207652_10009390
668 Ga0207652_10032624
669 Ga0207646_10150092
670 Ga0207681_10002291
671 Ga0207681_10201828
672 Ga0207694_10003707
673 Ga0207694_10531991
674 Ga0207650_10133105
675 Ga0207650_10196839
676 Ga0207659_10495087
677 Ga0207700_10549273
678 Ga0207690_10513993
679 Ga0207706_10052609
680 Ga0207706_10091118
681 Ga0207709_10085856
682 Ga0207709_10436512
683 Ga0207670_10000064
684 Ga0207670_10141855
685 Ga0207670_10602833
686 Ga0207704_10017670
687 Ga0207691_10008844
688 Ga0207691_10017331
689 Ga0207691_10050504
690 Ga0207691_10116516
691 Ga0207711_10034266
692 Ga0207689_10004241
693 Ga0207661_10000444
694 Ga0207661_10003085
695 Ga0207661_10593604
696 Ga0207679_10064658
697 Ga0207667_10004969
698 Ga0207667_10218838
699 Ga0207667_10527448
700 Ga0207651_10050939
701 Ga0207651_10141766
702 Ga0207651_10154611
703 Ga0207651_10502351
704 Ga0207668_10080871
705 Ga0207668_10195674
706 Ga0207658_10038169
707 Ga0207658_10250915
708 Ga0207658_10380445
709 Ga0207677_10053078
710 Ga0207677_10640915
711 Ga0207703_10300966
712 Ga0207639_10027771
713 Ga0207639_10082656
714 Ga0207678_10388856
715 Ga0207708_10110506
716 Ga0207708_10521773
717 Ga0207702_10062188
718 Ga0207641_10171667
719 Ga0207648_10000984
720 Ga0207648_10013257
721 Ga0207648_10287813
722 Ga0207674_10017659
723 Ga0207675_100035627
724 Ga0207675_100130235
725 Ga0207675_100142047
726 Ga0207683_10123815
727 Ga0207683_10461909
728 Ga0207698_10303611
729 Ga0207428_10016435
730 Ga0207428_10054438
731 Ga0268265_10072124
732 Ga0268265_10377031
733 Ga0268264_10000030
734 Ga0307515_10000292
735 Ga0265338_10003118
736 Ga0265332_10141077
737 Ga0265325_10034209
738 Ga0265340_10026517
739 Ga0307509_10193588
740 Ga0307408_100036322
741 Ga0307408_100528231
742 Ga0265313_10004883
743 Ga0265313_10032002
744 Ga0307508_10011607
745 Ga0265314_10034777
746 Ga0307516_10083114
747 Ga0307516_10113726
748 Ga0307405_10001234
749 Ga0307405_10062112
750 Ga0307405_10621138
751 Ga0307413_10002493
752 Ga0307413_10149306
753 Ga0307410_10010279
754 Ga0307410_10156097
755 Ga0307406_10073164
756 Ga0307406_10170248
757 Ga0307406_10188250
758 Ga0307412_10004520
759 Ga0307412_10206538
760 Ga0307412_10469058
761 Ga0307409_100104052
762 Ga0307409_100215967
763 Ga0307416_100023883
764 Ga0307416_101032928
765 Ga0307414_10009478
766 Ga0307414_10585624
767 Ga0307411_10003401
768 Ga0307411_10170745
769 Ga0307415_100060832
770 Ga0307507_10091082
771 Ga0373956_0003655
772 Ga0373943_0181399
773 Ga0373961_0000004
774 Ga0373924_0014735
775 Ga0373931_0123421
776 Ga0373933_0034647
777 Ga0373933_0101295
778 Ga0373947_0063015
779 Ga0373937_0004472
780 Ga0373937_0161548
781 Ga0373937_0213042
782 Ga0373925_0004343
783 Ga0373925_0056541
784 Ga0395899_0011366
785 Ga0395900_0016357
786 Ga0395900_0042196
787 Ga0395898_0502095
788 Ga0395905_0002007
789 Ga0395905_0045282
790 Ga0395905_0334362
791 Ga0395905_0644108
792 Ga0395901_0175256
793 Ga0395901_0455632
794 Ga0436365_0098868
795 Ga0436363_1484586
796 Ga0450898_003685
797 Ga0439434_0020060
798 Ga0450893_0004350
799 Ga0451577_0616318
800 Ga0453683_0163569
801 Ga0453684_0197961
802 Ga0453684_1095707
803 Ga0451576_0118222
804 Ga0466967_0521734
805 Ga0495590_0014170
806 Ga0495629_0004635
807 Ga0495629_0124852
808 Ga0495653_0002344
809 Ga0495582_0151110
810 Ga0495664_0017512
811 Ga0495664_0036257
812 Ga0495584_0000173
813 Ga0495585_0004296
814 Ga0495585_0180245
815 Ga0495596_0070441
816 Ga0495607_0004392
817 Ga0495608_0188809
818 Ga0495610_0056544
819 Ga0495616_0000643
820 Ga0495618_0408626
821 Ga0495628_0005737
822 Ga0495628_0023182
823 Ga0495630_0016913
824 Ga0495644_0000119
825 Ga0495666_0035859
826 Ga0495652_0022690
827 Ga0495652_0060441
828 Ga0495665_0000753
829 Ga0495586_0327004
830 Ga0495587_0232068
831 Ga0495645_0199481
832 Ga0495622_0177008
833 Ga0495633_0000742
834 Ga0495656_0093437
835 Ga0495611_0001188
836 Ga0495611_0013006
837 Ga0495625_0077111
838 Ga0495635_0005475
839 Ga0495661_0019488
840 Ga0495599_0177956
841 Ga0495623_0002882
842 Ga0495623_0068778
843 Ga0495646_0007531
844 Ga0495646_0223119
845 Ga0495647_0258936
846 Ga0495658_0156813
847 Ga0495669_0103173
848 Ga0495613_0238511
849 Ga0495624_0127015
850 Ga0495624_0461169
851 Ga0495670_0000053
852 Ga0495649_0048587
853 Ga0495589_0246716
854 Ga0495600_0118131
855 Ga0495604_0000893
856 Ga0495604_0012575
857 Ga0495604_0171051
858 Ga0495636_0137553
859 Ga0495674_0073493
860 Ga0495672_0003194
861 Ga0495680_0010133
862 Ga0495680_0138839
863 Ga0495680_0141189
864 Ga0495680_0153721
865 Ga0495675_0020051
866 Ga0495675_0049624
867 Ga0495677_0000986
868 Ga0495593_0003944
869 Ga0495602_0001190
870 Ga0495602_0021398
871 Ga0496100_0075346
872 Ga0496100_0122616
873 Ga0496101_0115583
874 Ga0496102_0229662
875 Ga0496103_0158249
876 Ga0496104_0001770
877 Ga0496104_0008496
878 Ga0496104_0632523
879 Ga0496105_0000769
880 Ga0496105_0093582
881 Ga0496106_0019847
882 Ga0496106_0132160
883 Ga0496106_0299277
884 Ga0496107_0049325
885 Ga0496107_0440791
886 Ga0496108_0215283
887 Ga0496112_0284049
888 Ga0496112_0672374
889 Ga0496113_0210460
890 Ga0496114_0000501
891 Ga0496114_0007334
892 Ga0496114_0009211
893 Ga0496115_0053225
894 Ga0496116_0173706
895 Ga0496117_0188606
896 Ga0496118_0004640
897 Ga0496118_0101470
898 Ga0496121_0000089
899 Ga0496121_0115615
900 Ga0496121_0137492
901 Ga0496121_0146782
902 Ga0496124_0089884
903 Ga0496125_0070584
904 Ga0496125_0393518
905 Ga0496126_0003551
906 Ga0496126_0264894
907 Ga0496126_0467080
908 Ga0495682_0041915
909 Ga0495682_0130923
910 Ga0501031_0059474
911 Ga0501032_0036917
912 Ga0501032_0164743
913 Ga0501033_0008619
914 Ga0501034_0020044
915 Ga0501036_0005963
916 Ga0501037_0178909
917 Ga0501038_0069632
918 Ga0501043_0000643
919 Ga0501046_0002679
920 Ga0501047_0005052
921 Ga0501047_0319103
922 Ga0501067_0032984
923 Ga0501068_0231166
924 Ga0501069_0314796
925 Ga0501070_0006327
926 Ga0501070_0020021
927 Ga0501072_0031356
928 Ga0501073_0010248
929 Ga0501080_0012936
930 Ga0501083_0048123
931 Ga0501035_0002048
932 Ga0501044_0000515
933 Ga0501044_0007899
934 Ga0501044_0217928
935 Ga0501044_0312266
936 nmdc:mga0yw44_291093_c1
937 nmdc:mga0yw44_89640_c1
938 nmdc:mga0k408_206_c1
939 nmdc:mga0k408_65766_c1
940 nmdc:mga06z11_229009_c1
941 nmdc:mga05p37_52613_c1
942 nmdc:mga0qj67_18883_c1
943 nmdc:mga08y16_241424_c1
944 nmdc:mga0n895_435785_c1
945 Ga0500635_0060985
946 Ga0495619_0116372
947 Ga0500646_0015845
948 Ga0500647_0141163
949 Ga0500559_0107807
950 Ga0500573_0120528
951 Ga0500590_200450
952 Ga0500638_175021
953 Ga0500639_169760
954 Ga0500596_006719
955 Ga0466962_0263917
956 2510247802
957 2512350147
958 2512353008
959 2515682115
960 2599905995
961 2616905919
962 2643858999
963 2643981824
964 2719643766
965 2723879020
966 2738821397
967 2738833880
968 2738875083
969 2739187037
970 2739221681
971 2746091604
972 2746099241
973 2774392419
974 2808876897
975 2809033884
976 2831867251
977 2866557010
978 2885274407
979 2902685526
980 2919533645
981 639787696
982 8025535349

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

29

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3noj-assembly1.cif.gz_A the structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida 0.9831 2 227
3noj-assembly1.cif.gz_A the structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida 0.9746 2 227
5x15-assembly1.cif.gz_C-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.908 10 199
2pcn-assembly1.cif.gz_A crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426 0.9013 28 177
1j3l-assembly1.cif.gz_A structure of the rna-processing inhibitor rraa from thermus thermophilis 0.8986 27 177
ID Description Score Start End Superfamily
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9993 28 176 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9731 28 176 3.50.30.40
af_Q58060_12_207_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9085 21 213 3.50.30.40
2pcnA00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9013 28 177 3.50.30.40
1j3lD00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.901 40 177 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A354FK52-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase 0.996 38 227 GO:0046872
GO:0047443
AF-A0A3M1C813-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase 0.9947 3 186 GO:0046872
AF-A0A6G4W5N8-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase (EC 4.1.3.17) 0.9942 4 227 GO:0046872
GO:0047443
AF-A0A6N7CV38-F1-model_v4 4-hydroxy-4-methyl-2-oxoglutarate aldolase/4-carboxy-4-hydroxy-2-oxoadipate aldolase 0.9932 1 227 GO:0005737
GO:0016787
GO:0016831
GO:0019748
GO:0046872
GO:0047443
AF-I0QYI7-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase 0.993 3 226 GO:0046872
GO:0047443

Map