F454166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 491 | 324 | 982 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300047443|Ga0495687_000018|Ga0495687_000018_190392_191081 |
| Length | 222 |
| Sequence | MNMYELGVVYRNISRADGDAATKLGTLGSATVHEAMGRVGLMKTYMRPIYPGAQASGTAVTVLLQPGDNWMLHVAAEQIQPGDIVVAACTTDNTDGFFGDLLATSFKARGARALIIDGGVRDVRVLTEMNFPVWSRAISSKGTVKATLGSVNIPVVCAGALVTPGDVIVADPSASAHNVLQKAVAREALEEEKRAKLATGVLGLDMYSMREPLERAGLRYID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 3 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 153 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 183 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 184 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 187 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 254 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 255 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 283 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 291 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 292 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 294 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 297 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 298 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 299 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 300 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 301 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 302 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 303 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 304 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 305 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 306 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 307 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 308 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 309 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 310 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 311 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 312 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 313 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 314 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 315 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 316 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 317 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 318 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 319 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 320 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 321 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 322 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 323 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 324 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.5 |
| Metatranscriptomes | 0 |
| Isolates | 5.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.54 |
| Nodule | 1.22 |
| Rhizoplane | 4.89 |
| Rhizosphere | 78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495687_000018 | 3300047443 | Bacteria | 342973 |
| 2 | Ga0055526_1001623 | 3300003771 | Bacteria | 15773 |
| 3 | Ga0055530_10003376 | 3300003791 | Bacteria | 9129 |
| 4 | Ga0055540_1000016 | 3300003792 | Bacteria | 232942 |
| 5 | Ga0055531_10001335 | 3300003794 | Bacteria | 18427 |
| 6 | Ga0055531_10034742 | 3300003794 | Bacteria | 1593 |
| 7 | Ga0065165_1000323 | 3300005262 | Bacteria | 78079 |
| 8 | Ga0070658_10000534 | 3300005327 | Bacteria | 33047 |
| 9 | Ga0070658_10007844 | 3300005327 | Bacteria | 8600 |
| 10 | Ga0070676_10069517 | 3300005328 | Bacteria | 2110 |
| 11 | Ga0070683_100005207 | 3300005329 | Bacteria | 10822 |
| 12 | Ga0070683_100024988 | 3300005329 | Bacteria | 5358 |
| 13 | Ga0070683_100411370 | 3300005329 | Bacteria | 1290 |
| 14 | Ga0070690_100009057 | 3300005330 | Bacteria | 5755 |
| 15 | Ga0070670_100090130 | 3300005331 | Bacteria | 2636 |
| 16 | Ga0068869_100038646 | 3300005334 | Bacteria | 3404 |
| 17 | Ga0070666_10282055 | 3300005335 | Bacteria | 1181 |
| 18 | Ga0070680_100011410 | 3300005336 | Bacteria | 6872 |
| 19 | Ga0070680_100340915 | 3300005336 | Bacteria | 1273 |
| 20 | Ga0070680_100598556 | 3300005336 | Bacteria | 946 |
| 21 | Ga0070682_100000252 | 3300005337 | Bacteria | 38842 |
| 22 | Ga0070682_100018824 | 3300005337 | Bacteria | 4043 |
| 23 | Ga0068868_100151350 | 3300005338 | Bacteria | 1911 |
| 24 | Ga0070660_100270491 | 3300005339 | Bacteria | 1389 |
| 25 | Ga0070689_100000047 | 3300005340 | Bacteria | 75697 |
| 26 | Ga0070689_100027445 | 3300005340 | Bacteria | 4292 |
| 27 | Ga0070689_100116814 | 3300005340 | Bacteria | 2127 |
| 28 | Ga0070689_100263908 | 3300005340 | Bacteria | 1424 |
| 29 | Ga0070689_100274029 | 3300005340 | Bacteria | 1398 |
| 30 | Ga0070689_100466512 | 3300005340 | Bacteria | 1077 |
| 31 | Ga0070689_100469860 | 3300005340 | Bacteria | 1073 |
| 32 | Ga0070687_100186290 | 3300005343 | Bacteria | 1247 |
| 33 | Ga0070669_100126172 | 3300005353 | Bacteria | 1958 |
| 34 | Ga0070675_100049771 | 3300005354 | Bacteria | 3440 |
| 35 | Ga0070675_100157985 | 3300005354 | Bacteria | 1948 |
| 36 | Ga0070671_100122732 | 3300005355 | Bacteria | 2186 |
| 37 | Ga0070674_100005518 | 3300005356 | Bacteria | 7313 |
| 38 | Ga0070673_100031352 | 3300005364 | Bacteria | 3988 |
| 39 | Ga0070673_100041477 | 3300005364 | Bacteria | 3540 |
| 40 | Ga0070673_100173617 | 3300005364 | Bacteria | 1841 |
| 41 | Ga0070673_100372271 | 3300005364 | Bacteria | 1272 |
| 42 | Ga0070659_100214915 | 3300005366 | Bacteria | 1585 |
| 43 | Ga0070667_100062521 | 3300005367 | Bacteria | 3154 |
| 44 | Ga0070667_100166370 | 3300005367 | Bacteria | 1945 |
| 45 | Ga0070709_10155636 | 3300005434 | Bacteria | 1584 |
| 46 | Ga0070710_10156659 | 3300005437 | Bacteria | 1409 |
| 47 | Ga0070710_10330116 | 3300005437 | Bacteria | 1004 |
| 48 | Ga0070701_10054981 | 3300005438 | Bacteria | 2077 |
| 49 | Ga0070711_100151260 | 3300005439 | Bacteria | 1750 |
| 50 | Ga0070705_100154819 | 3300005440 | Bacteria | 1525 |
| 51 | Ga0070700_100017294 | 3300005441 | Bacteria | 4119 |
| 52 | Ga0070663_100458545 | 3300005455 | Bacteria | 1052 |
| 53 | Ga0070678_100644166 | 3300005456 | Bacteria | 950 |
| 54 | Ga0070662_100198683 | 3300005457 | Bacteria | 1590 |
| 55 | Ga0070681_10156558 | 3300005458 | Bacteria | 2203 |
| 56 | Ga0070681_10347732 | 3300005458 | Bacteria | 1393 |
| 57 | Ga0068867_100001878 | 3300005459 | Bacteria | 14605 |
| 58 | Ga0068867_100040944 | 3300005459 | Bacteria | 3385 |
| 59 | Ga0070685_10100449 | 3300005466 | Bacteria | 1766 |
| 60 | Ga0070707_100317861 | 3300005468 | Bacteria | 1513 |
| 61 | Ga0070699_100092662 | 3300005518 | Bacteria | 2643 |
| 62 | Ga0070679_100000180 | 3300005530 | Bacteria | 50879 |
| 63 | Ga0070679_100220439 | 3300005530 | Bacteria | 1858 |
| 64 | Ga0070679_100447487 | 3300005530 | Bacteria | 1236 |
| 65 | Ga0070684_100000578 | 3300005535 | Bacteria | 25373 |
| 66 | Ga0070684_100004669 | 3300005535 | Bacteria | 10461 |
| 67 | Ga0070684_100306018 | 3300005535 | Bacteria | 1459 |
| 68 | Ga0068853_100021596 | 3300005539 | Bacteria | 5370 |
| 69 | Ga0068853_100138093 | 3300005539 | Bacteria | 2187 |
| 70 | Ga0070672_100008479 | 3300005543 | Bacteria | 7034 |
| 71 | Ga0070672_100008902 | 3300005543 | Bacteria | 6896 |
| 72 | Ga0070672_100119121 | 3300005543 | Bacteria | 2159 |
| 73 | Ga0070672_100575220 | 3300005543 | Bacteria | 980 |
| 74 | Ga0070686_100017437 | 3300005544 | Bacteria | 4196 |
| 75 | Ga0068855_100015544 | 3300005563 | Bacteria | 9162 |
| 76 | Ga0068855_100016734 | 3300005563 | Bacteria | 8819 |
| 77 | Ga0068855_100051277 | 3300005563 | Bacteria | 4860 |
| 78 | Ga0068855_100094819 | 3300005563 | Bacteria | 3440 |
| 79 | Ga0068855_100415316 | 3300005563 | Bacteria | 1472 |
| 80 | Ga0068855_100710131 | 3300005563 | Bacteria | 1075 |
| 81 | Ga0068857_100057249 | 3300005577 | Bacteria | 3460 |
| 82 | Ga0068854_100577113 | 3300005578 | Bacteria | 957 |
| 83 | Ga0068859_100027160 | 3300005617 | Bacteria | 5743 |
| 84 | Ga0068859_100142363 | 3300005617 | Bacteria | 2472 |
| 85 | Ga0068864_100308574 | 3300005618 | Bacteria | 1483 |
| 86 | Ga0068864_100712764 | 3300005618 | Bacteria | 981 |
| 87 | Ga0068861_100109272 | 3300005719 | Bacteria | 2213 |
| 88 | Ga0068870_10094652 | 3300005840 | Bacteria | 1677 |
| 89 | Ga0068863_100110610 | 3300005841 | Bacteria | 2616 |
| 90 | Ga0068863_100347031 | 3300005841 | Bacteria | 1445 |
| 91 | Ga0068858_100016017 | 3300005842 | Bacteria | 7041 |
| 92 | Ga0068860_100573878 | 3300005843 | Bacteria | 1132 |
| 93 | Ga0068862_100028032 | 3300005844 | Bacteria | 4743 |
| 94 | Ga0068862_100273760 | 3300005844 | Bacteria | 1545 |
| 95 | Ga0075365_10158449 | 3300006038 | Bacteria | 1576 |
| 96 | Ga0075365_10237046 | 3300006038 | Bacteria | 1281 |
| 97 | Ga0075368_10153481 | 3300006042 | Bacteria | 962 |
| 98 | Ga0075362_10082280 | 3300006177 | Bacteria | 1485 |
| 99 | Ga0075367_10022771 | 3300006178 | Bacteria | 3517 |
| 100 | Ga0075366_10010377 | 3300006195 | Bacteria | 5229 |
| 101 | Ga0075366_10020394 | 3300006195 | Bacteria | 3846 |
| 102 | Ga0097621_100079399 | 3300006237 | Bacteria | 2728 |
| 103 | Ga0068871_100309268 | 3300006358 | Bacteria | 1389 |
| 104 | Ga0075430_100017933 | 3300006846 | Bacteria | 6024 |
| 105 | Ga0068865_100005183 | 3300006881 | Bacteria | 7884 |
| 106 | Ga0097620_100027159 | 3300006931 | Bacteria | 5743 |
| 107 | Ga0097620_100126910 | 3300006931 | Bacteria | 2621 |
| 108 | Ga0097620_100142351 | 3300006931 | Bacteria | 2472 |
| 109 | Ga0105240_10000369 | 3300009093 | Bacteria | 84513 |
| 110 | Ga0105240_10026198 | 3300009093 | Bacteria | 7650 |
| 111 | Ga0111539_10059069 | 3300009094 | Bacteria | 4549 |
| 112 | Ga0111539_10577917 | 3300009094 | Bacteria | 1309 |
| 113 | Ga0105245_10150606 | 3300009098 | Bacteria | 2199 |
| 114 | Ga0105247_10108631 | 3300009101 | Bacteria | 1782 |
| 115 | Ga0114129_10008622 | 3300009147 | Bacteria | 14537 |
| 116 | Ga0105243_10092550 | 3300009148 | Bacteria | 2493 |
| 117 | Ga0105243_10553667 | 3300009148 | Bacteria | 1099 |
| 118 | Ga0105241_10063658 | 3300009174 | Bacteria | 2847 |
| 119 | Ga0105248_10003092 | 3300009177 | Bacteria | 18448 |
| 120 | Ga0105237_10000102 | 3300009545 | Bacteria | 118684 |
| 121 | Ga0105237_10044995 | 3300009545 | Bacteria | 4444 |
| 122 | Ga0105237_10269031 | 3300009545 | Bacteria | 1707 |
| 123 | Ga0105238_10005947 | 3300009551 | Bacteria | 12095 |
| 124 | Ga0105239_10004222 | 3300010375 | Bacteria | 17259 |
| 125 | Ga0105239_10405010 | 3300010375 | Bacteria | 1544 |
| 126 | Ga0157370_10010862 | 3300013104 | Bacteria | 9564 |
| 127 | Ga0157370_10102792 | 3300013104 | Bacteria | 2675 |
| 128 | Ga0157369_10085832 | 3300013105 | Bacteria | 3363 |
| 129 | Ga0157378_10802980 | 3300013297 | Bacteria | 967 |
| 130 | Ga0163162_10266980 | 3300013306 | Bacteria | 1843 |
| 131 | Ga0163162_10567634 | 3300013306 | Bacteria | 1262 |
| 132 | Ga0157375_10034886 | 3300013308 | Bacteria | 4796 |
| 133 | Ga0157375_10064446 | 3300013308 | Bacteria | 3648 |
| 134 | Ga0163163_10017725 | 3300014325 | Bacteria | 6647 |
| 135 | Ga0157377_10278709 | 3300014745 | Bacteria | 1095 |
| 136 | Ga0157379_10112265 | 3300014968 | Bacteria | 2449 |
| 137 | Ga0157379_10234002 | 3300014968 | Bacteria | 1666 |
| 138 | Ga0157376_10372416 | 3300014969 | Bacteria | 1373 |
| 139 | Ga0157376_10428939 | 3300014969 | Bacteria | 1285 |
| 140 | Ga0213876_10058610 | 3300021384 | Bacteria | 2033 |
| 141 | Ga0209673_1015247 | 3300025273 | Bacteria | 2930 |
| 142 | Ga0209673_1071016 | 3300025273 | Bacteria | 829 |
| 143 | Ga0209564_1000097 | 3300025295 | Bacteria | 231436 |
| 144 | Ga0209050_1000082 | 3300025298 | Bacteria | 266864 |
| 145 | Ga0209050_1001259 | 3300025298 | Bacteria | 29240 |
| 146 | Ga0207426_1019281 | 3300025302 | Bacteria | 2387 |
| 147 | Ga0209051_1000029 | 3300025303 | Bacteria | 403675 |
| 148 | Ga0209051_1000055 | 3300025303 | Bacteria | 277194 |
| 149 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 150 | Ga0209257_1000101 | 3300025304 | Bacteria | 251553 |
| 151 | Ga0207692_10059657 | 3300025898 | Bacteria | 1971 |
| 152 | Ga0207692_10100599 | 3300025898 | Bacteria | 1586 |
| 153 | Ga0207710_10075163 | 3300025900 | Bacteria | 1557 |
| 154 | Ga0207680_10388835 | 3300025903 | Bacteria | 984 |
| 155 | Ga0207699_10026499 | 3300025906 | Bacteria | 3197 |
| 156 | Ga0207699_10214631 | 3300025906 | Bacteria | 1310 |
| 157 | Ga0207645_10003433 | 3300025907 | Bacteria | 12042 |
| 158 | Ga0207645_10011482 | 3300025907 | Bacteria | 6045 |
| 159 | Ga0207643_10053958 | 3300025908 | Bacteria | 2284 |
| 160 | Ga0207643_10147740 | 3300025908 | Bacteria | 1407 |
| 161 | Ga0207705_10000642 | 3300025909 | Bacteria | 29173 |
| 162 | Ga0207705_10026384 | 3300025909 | Bacteria | 4143 |
| 163 | Ga0207654_10093437 | 3300025911 | Bacteria | 1839 |
| 164 | Ga0207695_10000923 | 3300025913 | Bacteria | 52620 |
| 165 | Ga0207695_10058910 | 3300025913 | Bacteria | 3985 |
| 166 | Ga0207695_10284063 | 3300025913 | Bacteria | 1548 |
| 167 | Ga0207671_10000201 | 3300025914 | Bacteria | 91167 |
| 168 | Ga0207671_10063062 | 3300025914 | Bacteria | 2753 |
| 169 | Ga0207671_10201527 | 3300025914 | Bacteria | 1554 |
| 170 | Ga0207693_10431655 | 3300025915 | Bacteria | 1030 |
| 171 | Ga0207660_10085076 | 3300025917 | Bacteria | 2332 |
| 172 | Ga0207660_10097466 | 3300025917 | Bacteria | 2191 |
| 173 | Ga0207660_10263846 | 3300025917 | Bacteria | 1363 |
| 174 | Ga0207662_10076027 | 3300025918 | Bacteria | 2040 |
| 175 | Ga0207657_10601943 | 3300025919 | Bacteria | 858 |
| 176 | Ga0207652_10009390 | 3300025921 | Bacteria | 7865 |
| 177 | Ga0207652_10032624 | 3300025921 | Bacteria | 4380 |
| 178 | Ga0207646_10150092 | 3300025922 | Bacteria | 2101 |
| 179 | Ga0207681_10002291 | 3300025923 | Bacteria | 12161 |
| 180 | Ga0207681_10201828 | 3300025923 | Bacteria | 1527 |
| 181 | Ga0207694_10003707 | 3300025924 | Bacteria | 12098 |
| 182 | Ga0207694_10531991 | 3300025924 | Bacteria | 986 |
| 183 | Ga0207650_10133105 | 3300025925 | Bacteria | 1948 |
| 184 | Ga0207650_10196839 | 3300025925 | Bacteria | 1612 |
| 185 | Ga0207659_10495087 | 3300025926 | Bacteria | 1034 |
| 186 | Ga0207700_10549273 | 3300025928 | Bacteria | 1025 |
| 187 | Ga0207690_10513993 | 3300025932 | Bacteria | 970 |
| 188 | Ga0207706_10052609 | 3300025933 | Bacteria | 3595 |
| 189 | Ga0207706_10091118 | 3300025933 | Bacteria | 2681 |
| 190 | Ga0207709_10085856 | 3300025935 | Bacteria | 2041 |
| 191 | Ga0207709_10436512 | 3300025935 | Bacteria | 1009 |
| 192 | Ga0207670_10000064 | 3300025936 | Bacteria | 75795 |
| 193 | Ga0207670_10141855 | 3300025936 | Bacteria | 1772 |
| 194 | Ga0207670_10602833 | 3300025936 | Bacteria | 902 |
| 195 | Ga0207704_10017670 | 3300025938 | Bacteria | 3704 |
| 196 | Ga0207691_10008844 | 3300025940 | Bacteria | 9663 |
| 197 | Ga0207691_10017331 | 3300025940 | Bacteria | 6832 |
| 198 | Ga0207691_10050504 | 3300025940 | Bacteria | 3807 |
| 199 | Ga0207691_10116516 | 3300025940 | Bacteria | 2371 |
| 200 | Ga0207711_10034266 | 3300025941 | Bacteria | 4301 |
| 201 | Ga0207689_10004241 | 3300025942 | Bacteria | 13040 |
| 202 | Ga0207661_10000444 | 3300025944 | Bacteria | 26690 |
| 203 | Ga0207661_10003085 | 3300025944 | Bacteria | 11542 |
| 204 | Ga0207661_10593604 | 3300025944 | Bacteria | 1016 |
| 205 | Ga0207679_10064658 | 3300025945 | Bacteria | 2735 |
| 206 | Ga0207667_10004969 | 3300025949 | Bacteria | 16240 |
| 207 | Ga0207667_10218838 | 3300025949 | Bacteria | 1951 |
| 208 | Ga0207667_10527448 | 3300025949 | Bacteria | 1196 |
| 209 | Ga0207651_10050939 | 3300025960 | Bacteria | 2815 |
| 210 | Ga0207651_10141766 | 3300025960 | Bacteria | 1857 |
| 211 | Ga0207651_10154611 | 3300025960 | Bacteria | 1790 |
| 212 | Ga0207651_10502351 | 3300025960 | Bacteria | 1048 |
| 213 | Ga0207668_10080871 | 3300025972 | Bacteria | 2355 |
| 214 | Ga0207668_10195674 | 3300025972 | Bacteria | 1606 |
| 215 | Ga0207658_10038169 | 3300025986 | Bacteria | 3458 |
| 216 | Ga0207658_10250915 | 3300025986 | Bacteria | 1503 |
| 217 | Ga0207658_10380445 | 3300025986 | Bacteria | 1236 |
| 218 | Ga0207677_10053078 | 3300026023 | Bacteria | 2757 |
| 219 | Ga0207677_10640915 | 3300026023 | Bacteria | 937 |
| 220 | Ga0207703_10300966 | 3300026035 | Bacteria | 1463 |
| 221 | Ga0207639_10027771 | 3300026041 | Bacteria | 4126 |
| 222 | Ga0207639_10082656 | 3300026041 | Bacteria | 2547 |
| 223 | Ga0207678_10388856 | 3300026067 | Bacteria | 1206 |
| 224 | Ga0207708_10110506 | 3300026075 | Bacteria | 2133 |
| 225 | Ga0207708_10521773 | 3300026075 | Bacteria | 998 |
| 226 | Ga0207702_10062188 | 3300026078 | Bacteria | 3187 |
| 227 | Ga0207641_10171667 | 3300026088 | Bacteria | 1980 |
| 228 | Ga0207648_10000984 | 3300026089 | Bacteria | 32138 |
| 229 | Ga0207648_10013257 | 3300026089 | Bacteria | 7680 |
| 230 | Ga0207648_10287813 | 3300026089 | Bacteria | 1471 |
| 231 | Ga0207674_10017659 | 3300026116 | Bacteria | 7778 |
| 232 | Ga0207675_100035627 | 3300026118 | Bacteria | 4642 |
| 233 | Ga0207675_100130235 | 3300026118 | Bacteria | 2385 |
| 234 | Ga0207675_100142047 | 3300026118 | Bacteria | 2281 |
| 235 | Ga0207683_10123815 | 3300026121 | Bacteria | 2322 |
| 236 | Ga0207683_10461909 | 3300026121 | Bacteria | 1171 |
| 237 | Ga0207698_10303611 | 3300026142 | Bacteria | 1487 |
| 238 | Ga0207428_10016435 | 3300027907 | Bacteria | 6367 |
| 239 | Ga0207428_10054438 | 3300027907 | Bacteria | 3187 |
| 240 | Ga0268265_10072124 | 3300028380 | Bacteria | 2693 |
| 241 | Ga0268265_10377031 | 3300028380 | Bacteria | 1304 |
| 242 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 243 | Ga0307515_10000292 | 3300028794 | Bacteria | 123160 |
| 244 | Ga0265338_10003118 | 3300028800 | Bacteria | 23705 |
| 245 | Ga0265332_10141077 | 3300031238 | Bacteria | 1010 |
| 246 | Ga0265325_10034209 | 3300031241 | Bacteria | 2705 |
| 247 | Ga0265340_10026517 | 3300031247 | Bacteria | 2928 |
| 248 | Ga0307509_10193588 | 3300031507 | Bacteria | 1880 |
| 249 | Ga0307408_100036322 | 3300031548 | Bacteria | 3463 |
| 250 | Ga0307408_100528231 | 3300031548 | Bacteria | 1038 |
| 251 | Ga0265313_10004883 | 3300031595 | Bacteria | 10056 |
| 252 | Ga0265313_10032002 | 3300031595 | Bacteria | 2691 |
| 253 | Ga0307508_10011607 | 3300031616 | Bacteria | 8050 |
| 254 | Ga0265314_10034777 | 3300031711 | Bacteria | 3677 |
| 255 | Ga0307516_10083114 | 3300031730 | Bacteria | 3044 |
| 256 | Ga0307516_10113726 | 3300031730 | Bacteria | 2505 |
| 257 | Ga0307405_10001234 | 3300031731 | Bacteria | 10638 |
| 258 | Ga0307405_10062112 | 3300031731 | Bacteria | 2364 |
| 259 | Ga0307405_10621138 | 3300031731 | Bacteria | 885 |
| 260 | Ga0307413_10002493 | 3300031824 | Bacteria | 7503 |
| 261 | Ga0307413_10149306 | 3300031824 | Bacteria | 1626 |
| 262 | Ga0307410_10010279 | 3300031852 | Bacteria | 5291 |
| 263 | Ga0307410_10156097 | 3300031852 | Bacteria | 1704 |
| 264 | Ga0307406_10073164 | 3300031901 | Bacteria | 2252 |
| 265 | Ga0307406_10170248 | 3300031901 | Bacteria | 1575 |
| 266 | Ga0307406_10188250 | 3300031901 | Bacteria | 1509 |
| 267 | Ga0307412_10004520 | 3300031911 | Bacteria | 7750 |
| 268 | Ga0307412_10206538 | 3300031911 | Bacteria | 1495 |
| 269 | Ga0307412_10469058 | 3300031911 | Bacteria | 1041 |
| 270 | Ga0307409_100104052 | 3300031995 | Bacteria | 2363 |
| 271 | Ga0307409_100215967 | 3300031995 | Bacteria | 1727 |
| 272 | Ga0307416_100023883 | 3300032002 | Bacteria | 4448 |
| 273 | Ga0307416_101032928 | 3300032002 | Bacteria | 925 |
| 274 | Ga0307414_10009478 | 3300032004 | Bacteria | 5596 |
| 275 | Ga0307414_10585624 | 3300032004 | Bacteria | 999 |
| 276 | Ga0307411_10003401 | 3300032005 | Bacteria | 7374 |
| 277 | Ga0307411_10170745 | 3300032005 | Bacteria | 1639 |
| 278 | Ga0307415_100060832 | 3300032126 | Bacteria | 2612 |
| 279 | Ga0307507_10091082 | 3300033179 | Bacteria | 2613 |
| 280 | Ga0373956_0003655 | 3300035119 | Bacteria | 6213 |
| 281 | Ga0373943_0181399 | 3300035170 | Bacteria | 1157 |
| 282 | Ga0373961_0000004 | 3300035241 | Bacteria | 147543 |
| 283 | Ga0373924_0014735 | 3300035410 | Bacteria | 2958 |
| 284 | Ga0373931_0123421 | 3300035691 | Bacteria | 1483 |
| 285 | Ga0373933_0034647 | 3300035724 | Bacteria | 2943 |
| 286 | Ga0373933_0101295 | 3300035724 | Bacteria | 1787 |
| 287 | Ga0373947_0063015 | 3300035725 | Bacteria | 2258 |
| 288 | Ga0373937_0004472 | 3300036401 | Bacteria | 11874 |
| 289 | Ga0373937_0161548 | 3300036401 | Bacteria | 2100 |
| 290 | Ga0373937_0213042 | 3300036401 | Bacteria | 1818 |
| 291 | Ga0373925_0004343 | 3300037068 | Bacteria | 10729 |
| 292 | Ga0373925_0056541 | 3300037068 | Bacteria | 2939 |
| 293 | Ga0395899_0011366 | 3300037312 | Bacteria | 6820 |
| 294 | Ga0395900_0016357 | 3300037418 | Bacteria | 7561 |
| 295 | Ga0395900_0042196 | 3300037418 | Bacteria | 4699 |
| 296 | Ga0395898_0502095 | 3300037466 | Bacteria | 1154 |
| 297 | Ga0395905_0002007 | 3300037471 | Bacteria | 23235 |
| 298 | Ga0395905_0045282 | 3300037471 | Bacteria | 4126 |
| 299 | Ga0395905_0334362 | 3300037471 | Bacteria | 1405 |
| 300 | Ga0395905_0644108 | 3300037471 | Bacteria | 961 |
| 301 | Ga0395901_0175256 | 3300038443 | Bacteria | 2249 |
| 302 | Ga0395901_0455632 | 3300038443 | Bacteria | 1308 |
| 303 | Ga0436365_0098868 | 3300039437 | Bacteria | 2592 |
| 304 | Ga0436363_1484586 | 3300039450 | Bacteria | 1638 |
| 305 | Ga0450898_003685 | 3300042134 | Bacteria | 2215 |
| 306 | Ga0439434_0020060 | 3300042435 | Bacteria | 2006 |
| 307 | Ga0450893_0004350 | 3300042532 | Bacteria | 2256 |
| 308 | Ga0451577_0616318 | 3300042876 | Bacteria | 984 |
| 309 | Ga0453683_0163569 | 3300044673 | Bacteria | 1408 |
| 310 | Ga0453684_0197961 | 3300044712 | Bacteria | 2344 |
| 311 | Ga0453684_1095707 | 3300044712 | Bacteria | 842 |
| 312 | Ga0451576_0118222 | 3300045051 | Bacteria | 2759 |
| 313 | Ga0466967_0521734 | 3300045976 | Bacteria | 1167 |
| 314 | Ga0495590_0014170 | 3300046457 | Bacteria | 2916 |
| 315 | Ga0495629_0004635 | 3300046459 | Bacteria | 10294 |
| 316 | Ga0495629_0124852 | 3300046459 | Bacteria | 1793 |
| 317 | Ga0495653_0002344 | 3300046463 | Bacteria | 15034 |
| 318 | Ga0495582_0151110 | 3300046473 | Bacteria | 1318 |
| 319 | Ga0495664_0017512 | 3300046477 | Bacteria | 4098 |
| 320 | Ga0495664_0036257 | 3300046477 | Bacteria | 2906 |
| 321 | Ga0495584_0000173 | 3300046491 | Bacteria | 45316 |
| 322 | Ga0495585_0004296 | 3300046492 | Bacteria | 9275 |
| 323 | Ga0495585_0180245 | 3300046492 | Bacteria | 1086 |
| 324 | Ga0495596_0070441 | 3300046500 | Bacteria | 1359 |
| 325 | Ga0495607_0004392 | 3300046501 | Bacteria | 10390 |
| 326 | Ga0495608_0188809 | 3300046511 | Bacteria | 1302 |
| 327 | Ga0495610_0056544 | 3300046512 | Bacteria | 1886 |
| 328 | Ga0495616_0000643 | 3300046513 | Bacteria | 26050 |
| 329 | Ga0495618_0408626 | 3300046514 | Bacteria | 829 |
| 330 | Ga0495628_0005737 | 3300046516 | Bacteria | 10875 |
| 331 | Ga0495628_0023182 | 3300046516 | Bacteria | 5097 |
| 332 | Ga0495630_0016913 | 3300046517 | Bacteria | 5337 |
| 333 | Ga0495644_0000119 | 3300046523 | Bacteria | 37559 |
| 334 | Ga0495666_0035859 | 3300046526 | Bacteria | 2416 |
| 335 | Ga0495652_0022690 | 3300046529 | Bacteria | 5569 |
| 336 | Ga0495652_0060441 | 3300046529 | Bacteria | 3202 |
| 337 | Ga0495665_0000753 | 3300046531 | Bacteria | 16782 |
| 338 | Ga0495586_0327004 | 3300046535 | Bacteria | 879 |
| 339 | Ga0495587_0232068 | 3300046536 | Bacteria | 1040 |
| 340 | Ga0495645_0199481 | 3300046543 | Bacteria | 1358 |
| 341 | Ga0495622_0177008 | 3300046557 | Bacteria | 957 |
| 342 | Ga0495633_0000742 | 3300046558 | Bacteria | 29473 |
| 343 | Ga0495656_0093437 | 3300046615 | Bacteria | 1379 |
| 344 | Ga0495611_0001188 | 3300046648 | Bacteria | 13508 |
| 345 | Ga0495611_0013006 | 3300046648 | Bacteria | 3539 |
| 346 | Ga0495625_0077111 | 3300046660 | Bacteria | 2329 |
| 347 | Ga0495635_0005475 | 3300046663 | Bacteria | 8832 |
| 348 | Ga0495661_0019488 | 3300046665 | Bacteria | 4445 |
| 349 | Ga0495599_0177956 | 3300046678 | Bacteria | 1311 |
| 350 | Ga0495623_0002882 | 3300046679 | Bacteria | 11335 |
| 351 | Ga0495623_0068778 | 3300046679 | Bacteria | 2208 |
| 352 | Ga0495646_0007531 | 3300046680 | Bacteria | 6917 |
| 353 | Ga0495646_0223119 | 3300046680 | Bacteria | 1018 |
| 354 | Ga0495647_0258936 | 3300046681 | Bacteria | 776 |
| 355 | Ga0495658_0156813 | 3300046683 | Bacteria | 1401 |
| 356 | Ga0495669_0103173 | 3300046684 | Bacteria | 1326 |
| 357 | Ga0495613_0238511 | 3300046689 | Bacteria | 1272 |
| 358 | Ga0495624_0127015 | 3300046690 | Bacteria | 1564 |
| 359 | Ga0495624_0461169 | 3300046690 | Bacteria | 761 |
| 360 | Ga0495670_0000053 | 3300046691 | Bacteria | 60401 |
| 361 | Ga0495649_0048587 | 3300046694 | Bacteria | 2306 |
| 362 | Ga0495589_0246716 | 3300046794 | Bacteria | 835 |
| 363 | Ga0495600_0118131 | 3300046809 | Bacteria | 1725 |
| 364 | Ga0495604_0000893 | 3300047317 | Bacteria | 24849 |
| 365 | Ga0495604_0012575 | 3300047317 | Bacteria | 6731 |
| 366 | Ga0495604_0171051 | 3300047317 | Bacteria | 1528 |
| 367 | Ga0495636_0137553 | 3300047318 | Bacteria | 1089 |
| 368 | Ga0495674_0073493 | 3300047319 | Bacteria | 2947 |
| 369 | Ga0495672_0003194 | 3300047320 | Bacteria | 14247 |
| 370 | Ga0495680_0010133 | 3300047322 | Bacteria | 8422 |
| 371 | Ga0495680_0138839 | 3300047322 | Bacteria | 1779 |
| 372 | Ga0495680_0141189 | 3300047322 | Bacteria | 1762 |
| 373 | Ga0495680_0153721 | 3300047322 | Bacteria | 1676 |
| 374 | Ga0495675_0020051 | 3300047444 | Bacteria | 4248 |
| 375 | Ga0495675_0049624 | 3300047444 | Bacteria | 2667 |
| 376 | Ga0495677_0000986 | 3300047445 | Bacteria | 11456 |
| 377 | Ga0495593_0003944 | 3300047673 | Bacteria | 8859 |
| 378 | Ga0495602_0001190 | 3300048088 | Bacteria | 25555 |
| 379 | Ga0495602_0021398 | 3300048088 | Bacteria | 6367 |
| 380 | Ga0496100_0075346 | 3300048903 | Bacteria | 2263 |
| 381 | Ga0496100_0122616 | 3300048903 | Bacteria | 1820 |
| 382 | Ga0496101_0115583 | 3300048904 | Bacteria | 2024 |
| 383 | Ga0496102_0229662 | 3300048905 | Bacteria | 1750 |
| 384 | Ga0496103_0158249 | 3300048906 | Bacteria | 1452 |
| 385 | Ga0496104_0001770 | 3300048907 | Bacteria | 18682 |
| 386 | Ga0496104_0008496 | 3300048907 | Bacteria | 9134 |
| 387 | Ga0496104_0632523 | 3300048907 | Bacteria | 979 |
| 388 | Ga0496105_0000769 | 3300048908 | Bacteria | 21799 |
| 389 | Ga0496105_0093582 | 3300048908 | Bacteria | 2482 |
| 390 | Ga0496106_0019847 | 3300048909 | Bacteria | 4983 |
| 391 | Ga0496106_0132160 | 3300048909 | Bacteria | 1958 |
| 392 | Ga0496106_0299277 | 3300048909 | Bacteria | 1290 |
| 393 | Ga0496107_0049325 | 3300048910 | Bacteria | 3034 |
| 394 | Ga0496107_0440791 | 3300048910 | Bacteria | 968 |
| 395 | Ga0496108_0215283 | 3300048911 | Bacteria | 1668 |
| 396 | Ga0496112_0284049 | 3300048915 | Bacteria | 1601 |
| 397 | Ga0496112_0672374 | 3300048915 | Bacteria | 964 |
| 398 | Ga0496113_0210460 | 3300048916 | Bacteria | 1548 |
| 399 | Ga0496114_0000501 | 3300048917 | Bacteria | 28631 |
| 400 | Ga0496114_0007334 | 3300048917 | Bacteria | 8706 |
| 401 | Ga0496114_0009211 | 3300048917 | Bacteria | 7829 |
| 402 | Ga0496115_0053225 | 3300048918 | Bacteria | 3248 |
| 403 | Ga0496116_0173706 | 3300048919 | Bacteria | 1164 |
| 404 | Ga0496117_0188606 | 3300048920 | Bacteria | 1177 |
| 405 | Ga0496118_0004640 | 3300048921 | Bacteria | 16123 |
| 406 | Ga0496118_0101470 | 3300048921 | Bacteria | 1943 |
| 407 | Ga0496121_0000089 | 3300048924 | Bacteria | 219007 |
| 408 | Ga0496121_0115615 | 3300048924 | Bacteria | 2036 |
| 409 | Ga0496121_0137492 | 3300048924 | Bacteria | 1818 |
| 410 | Ga0496121_0146782 | 3300048924 | Bacteria | 1742 |
| 411 | Ga0496124_0089884 | 3300048927 | Bacteria | 2506 |
| 412 | Ga0496125_0070584 | 3300048928 | Bacteria | 2734 |
| 413 | Ga0496125_0393518 | 3300048928 | Bacteria | 812 |
| 414 | Ga0496126_0003551 | 3300048929 | Bacteria | 19610 |
| 415 | Ga0496126_0264894 | 3300048929 | Bacteria | 1428 |
| 416 | Ga0496126_0467080 | 3300048929 | Bacteria | 1013 |
| 417 | Ga0495682_0041915 | 3300049460 | Bacteria | 1678 |
| 418 | Ga0495682_0130923 | 3300049460 | Bacteria | 897 |
| 419 | Ga0501031_0059474 | 3300049568 | Bacteria | 2490 |
| 420 | Ga0501032_0036917 | 3300049569 | Bacteria | 3334 |
| 421 | Ga0501032_0164743 | 3300049569 | Bacteria | 1455 |
| 422 | Ga0501033_0008619 | 3300049570 | Bacteria | 7892 |
| 423 | Ga0501034_0020044 | 3300049571 | Bacteria | 6830 |
| 424 | Ga0501036_0005963 | 3300049572 | Bacteria | 9878 |
| 425 | Ga0501037_0178909 | 3300049573 | Bacteria | 1505 |
| 426 | Ga0501038_0069632 | 3300049574 | Bacteria | 2988 |
| 427 | Ga0501043_0000643 | 3300049579 | Bacteria | 30832 |
| 428 | Ga0501046_0002679 | 3300049580 | Bacteria | 16603 |
| 429 | Ga0501047_0005052 | 3300049581 | Bacteria | 12383 |
| 430 | Ga0501047_0319103 | 3300049581 | Bacteria | 1394 |
| 431 | Ga0501067_0032984 | 3300049583 | Bacteria | 2874 |
| 432 | Ga0501068_0231166 | 3300049584 | Bacteria | 1176 |
| 433 | Ga0501069_0314796 | 3300049585 | Bacteria | 919 |
| 434 | Ga0501070_0006327 | 3300049586 | Bacteria | 10076 |
| 435 | Ga0501070_0020021 | 3300049586 | Bacteria | 5610 |
| 436 | Ga0501072_0031356 | 3300049588 | Bacteria | 4160 |
| 437 | Ga0501073_0010248 | 3300049589 | Bacteria | 6884 |
| 438 | Ga0501080_0012936 | 3300049742 | Bacteria | 7660 |
| 439 | Ga0501083_0048123 | 3300049744 | Bacteria | 2879 |
| 440 | Ga0501035_0002048 | 3300049822 | Bacteria | 20096 |
| 441 | Ga0501044_0000515 | 3300049823 | Bacteria | 47051 |
| 442 | Ga0501044_0007899 | 3300049823 | Bacteria | 11699 |
| 443 | Ga0501044_0217928 | 3300049823 | Bacteria | 1860 |
| 444 | Ga0501044_0312266 | 3300049823 | Bacteria | 1498 |
| 445 | nmdc:mga0yw44_291093_c1 | 3300050492 | Bacteria | 1093 |
| 446 | nmdc:mga0yw44_89640_c1 | 3300050492 | Bacteria | 1941 |
| 447 | nmdc:mga0k408_206_c1 | 3300050493 | Bacteria | 31456 |
| 448 | nmdc:mga0k408_65766_c1 | 3300050493 | Bacteria | 1245 |
| 449 | nmdc:mga06z11_229009_c1 | 3300050494 | Bacteria | 1088 |
| 450 | nmdc:mga05p37_52613_c1 | 3300050507 | Bacteria | 5006 |
| 451 | nmdc:mga0qj67_18883_c1 | 3300050509 | Bacteria | 5260 |
| 452 | nmdc:mga08y16_241424_c1 | 3300050511 | Bacteria | 1868 |
| 453 | nmdc:mga0n895_435785_c1 | 3300050512 | Bacteria | 1324 |
| 454 | Ga0500635_0060985 | 3300053080 | Bacteria | 1316 |
| 455 | Ga0495619_0116372 | 3300053085 | Bacteria | 1830 |
| 456 | Ga0500646_0015845 | 3300053090 | Bacteria | 1965 |
| 457 | Ga0500647_0141163 | 3300053091 | Bacteria | 1130 |
| 458 | Ga0500559_0107807 | 3300053136 | Bacteria | 1288 |
| 459 | Ga0500573_0120528 | 3300053140 | Bacteria | 1460 |
| 460 | Ga0500590_200450 | 3300053148 | Bacteria | 845 |
| 461 | Ga0500638_175021 | 3300053162 | Bacteria | 931 |
| 462 | Ga0500639_169760 | 3300053163 | Bacteria | 980 |
| 463 | Ga0500596_006719 | 3300053735 | Bacteria | 1927 |
| 464 | Ga0466962_0263917 | 3300061719 | Bacteria | 848 |
| 465 | 2510247802 | 2510065045 | Bacteria | 7761063 |
| 466 | 2512350147 | 2512047030 | Bacteria | 9031815 |
| 467 | 2512353008 | 2512047030 | Bacteria | 9031815 |
| 468 | 2515682115 | 2515154122 | Bacteria | 8609520 |
| 469 | 2599905995 | 2599185292 | Bacteria | 6290804 |
| 470 | 2616905919 | 2616644941 | Bacteria | 8510691 |
| 471 | 2643858999 | 2643221569 | Bacteria | 6064337 |
| 472 | 2643981824 | 2643221594 | Bacteria | 5811388 |
| 473 | 2719643766 | 2718217991 | Bacteria | 7829542 |
| 474 | 2723879020 | 2721755763 | Bacteria | 4464185 |
| 475 | 2738821397 | 2738541296 | Bacteria | 7285013 |
| 476 | 2738833880 | 2738541298 | Bacteria | 7286732 |
| 477 | 2738875083 | 2738541306 | Bacteria | 7284992 |
| 478 | 2739187037 | 2738543002 | Bacteria | 7284546 |
| 479 | 2739221681 | 2738543008 | Bacteria | 7282815 |
| 480 | 2746091604 | 2744054900 | Bacteria | 8399525 |
| 481 | 2746099241 | 2744054901 | Bacteria | 8397047 |
| 482 | 2774392419 | 2773857762 | Bacteria | 5971770 |
| 483 | 2808876897 | 2808606366 | Bacteria | 4415912 |
| 484 | 2809033884 | 2808606395 | Bacteria | 6020352 |
| 485 | 2831867251 | 2831864461 | Bacteria | 6502356 |
| 486 | 2866557010 | 2866552031 | Bacteria | 5824618 |
| 487 | 2885274407 | 2885270888 | Bacteria | 9831543 |
| 488 | 2902685526 | 2902682994 | Bacteria | 8951596 |
| 489 | 2919533645 | 2919527303 | Bacteria | 7718827 |
| 490 | 639787696 | 639633007 | Bacteria | 4376040 |
| 491 | 8025535349 | 8025530807 | Bacteria | 8495698 |
| 492 | Ga0495687_000018 | |||
| 493 | Ga0055526_1001623 | |||
| 494 | Ga0055530_10003376 | |||
| 495 | Ga0055540_1000016 | |||
| 496 | Ga0055531_10001335 | |||
| 497 | Ga0055531_10034742 | |||
| 498 | Ga0065165_1000323 | |||
| 499 | Ga0070658_10000534 | |||
| 500 | Ga0070658_10007844 | |||
| 501 | Ga0070676_10069517 | |||
| 502 | Ga0070683_100005207 | |||
| 503 | Ga0070683_100024988 | |||
| 504 | Ga0070683_100411370 | |||
| 505 | Ga0070690_100009057 | |||
| 506 | Ga0070670_100090130 | |||
| 507 | Ga0068869_100038646 | |||
| 508 | Ga0070666_10282055 | |||
| 509 | Ga0070680_100011410 | |||
| 510 | Ga0070680_100340915 | |||
| 511 | Ga0070680_100598556 | |||
| 512 | Ga0070682_100000252 | |||
| 513 | Ga0070682_100018824 | |||
| 514 | Ga0068868_100151350 | |||
| 515 | Ga0070660_100270491 | |||
| 516 | Ga0070689_100000047 | |||
| 517 | Ga0070689_100027445 | |||
| 518 | Ga0070689_100116814 | |||
| 519 | Ga0070689_100263908 | |||
| 520 | Ga0070689_100274029 | |||
| 521 | Ga0070689_100466512 | |||
| 522 | Ga0070689_100469860 | |||
| 523 | Ga0070687_100186290 | |||
| 524 | Ga0070669_100126172 | |||
| 525 | Ga0070675_100049771 | |||
| 526 | Ga0070675_100157985 | |||
| 527 | Ga0070671_100122732 | |||
| 528 | Ga0070674_100005518 | |||
| 529 | Ga0070673_100031352 | |||
| 530 | Ga0070673_100041477 | |||
| 531 | Ga0070673_100173617 | |||
| 532 | Ga0070673_100372271 | |||
| 533 | Ga0070659_100214915 | |||
| 534 | Ga0070667_100062521 | |||
| 535 | Ga0070667_100166370 | |||
| 536 | Ga0070709_10155636 | |||
| 537 | Ga0070710_10156659 | |||
| 538 | Ga0070710_10330116 | |||
| 539 | Ga0070701_10054981 | |||
| 540 | Ga0070711_100151260 | |||
| 541 | Ga0070705_100154819 | |||
| 542 | Ga0070700_100017294 | |||
| 543 | Ga0070663_100458545 | |||
| 544 | Ga0070678_100644166 | |||
| 545 | Ga0070662_100198683 | |||
| 546 | Ga0070681_10156558 | |||
| 547 | Ga0070681_10347732 | |||
| 548 | Ga0068867_100001878 | |||
| 549 | Ga0068867_100040944 | |||
| 550 | Ga0070685_10100449 | |||
| 551 | Ga0070707_100317861 | |||
| 552 | Ga0070699_100092662 | |||
| 553 | Ga0070679_100000180 | |||
| 554 | Ga0070679_100220439 | |||
| 555 | Ga0070679_100447487 | |||
| 556 | Ga0070684_100000578 | |||
| 557 | Ga0070684_100004669 | |||
| 558 | Ga0070684_100306018 | |||
| 559 | Ga0068853_100021596 | |||
| 560 | Ga0068853_100138093 | |||
| 561 | Ga0070672_100008479 | |||
| 562 | Ga0070672_100008902 | |||
| 563 | Ga0070672_100119121 | |||
| 564 | Ga0070672_100575220 | |||
| 565 | Ga0070686_100017437 | |||
| 566 | Ga0068855_100015544 | |||
| 567 | Ga0068855_100016734 | |||
| 568 | Ga0068855_100051277 | |||
| 569 | Ga0068855_100094819 | |||
| 570 | Ga0068855_100415316 | |||
| 571 | Ga0068855_100710131 | |||
| 572 | Ga0068857_100057249 | |||
| 573 | Ga0068854_100577113 | |||
| 574 | Ga0068859_100027160 | |||
| 575 | Ga0068859_100142363 | |||
| 576 | Ga0068864_100308574 | |||
| 577 | Ga0068864_100712764 | |||
| 578 | Ga0068861_100109272 | |||
| 579 | Ga0068870_10094652 | |||
| 580 | Ga0068863_100110610 | |||
| 581 | Ga0068863_100347031 | |||
| 582 | Ga0068858_100016017 | |||
| 583 | Ga0068860_100573878 | |||
| 584 | Ga0068862_100028032 | |||
| 585 | Ga0068862_100273760 | |||
| 586 | Ga0075365_10158449 | |||
| 587 | Ga0075365_10237046 | |||
| 588 | Ga0075368_10153481 | |||
| 589 | Ga0075362_10082280 | |||
| 590 | Ga0075367_10022771 | |||
| 591 | Ga0075366_10010377 | |||
| 592 | Ga0075366_10020394 | |||
| 593 | Ga0097621_100079399 | |||
| 594 | Ga0068871_100309268 | |||
| 595 | Ga0075430_100017933 | |||
| 596 | Ga0068865_100005183 | |||
| 597 | Ga0097620_100027159 | |||
| 598 | Ga0097620_100126910 | |||
| 599 | Ga0097620_100142351 | |||
| 600 | Ga0105240_10000369 | |||
| 601 | Ga0105240_10026198 | |||
| 602 | Ga0111539_10059069 | |||
| 603 | Ga0111539_10577917 | |||
| 604 | Ga0105245_10150606 | |||
| 605 | Ga0105247_10108631 | |||
| 606 | Ga0114129_10008622 | |||
| 607 | Ga0105243_10092550 | |||
| 608 | Ga0105243_10553667 | |||
| 609 | Ga0105241_10063658 | |||
| 610 | Ga0105248_10003092 | |||
| 611 | Ga0105237_10000102 | |||
| 612 | Ga0105237_10044995 | |||
| 613 | Ga0105237_10269031 | |||
| 614 | Ga0105238_10005947 | |||
| 615 | Ga0105239_10004222 | |||
| 616 | Ga0105239_10405010 | |||
| 617 | Ga0157370_10010862 | |||
| 618 | Ga0157370_10102792 | |||
| 619 | Ga0157369_10085832 | |||
| 620 | Ga0157378_10802980 | |||
| 621 | Ga0163162_10266980 | |||
| 622 | Ga0163162_10567634 | |||
| 623 | Ga0157375_10034886 | |||
| 624 | Ga0157375_10064446 | |||
| 625 | Ga0163163_10017725 | |||
| 626 | Ga0157377_10278709 | |||
| 627 | Ga0157379_10112265 | |||
| 628 | Ga0157379_10234002 | |||
| 629 | Ga0157376_10372416 | |||
| 630 | Ga0157376_10428939 | |||
| 631 | Ga0213876_10058610 | |||
| 632 | Ga0209673_1015247 | |||
| 633 | Ga0209673_1071016 | |||
| 634 | Ga0209564_1000097 | |||
| 635 | Ga0209050_1000082 | |||
| 636 | Ga0209050_1001259 | |||
| 637 | Ga0207426_1019281 | |||
| 638 | Ga0209051_1000029 | |||
| 639 | Ga0209051_1000055 | |||
| 640 | Ga0209257_1000030 | |||
| 641 | Ga0209257_1000101 | |||
| 642 | Ga0207692_10059657 | |||
| 643 | Ga0207692_10100599 | |||
| 644 | Ga0207710_10075163 | |||
| 645 | Ga0207680_10388835 | |||
| 646 | Ga0207699_10026499 | |||
| 647 | Ga0207699_10214631 | |||
| 648 | Ga0207645_10003433 | |||
| 649 | Ga0207645_10011482 | |||
| 650 | Ga0207643_10053958 | |||
| 651 | Ga0207643_10147740 | |||
| 652 | Ga0207705_10000642 | |||
| 653 | Ga0207705_10026384 | |||
| 654 | Ga0207654_10093437 | |||
| 655 | Ga0207695_10000923 | |||
| 656 | Ga0207695_10058910 | |||
| 657 | Ga0207695_10284063 | |||
| 658 | Ga0207671_10000201 | |||
| 659 | Ga0207671_10063062 | |||
| 660 | Ga0207671_10201527 | |||
| 661 | Ga0207693_10431655 | |||
| 662 | Ga0207660_10085076 | |||
| 663 | Ga0207660_10097466 | |||
| 664 | Ga0207660_10263846 | |||
| 665 | Ga0207662_10076027 | |||
| 666 | Ga0207657_10601943 | |||
| 667 | Ga0207652_10009390 | |||
| 668 | Ga0207652_10032624 | |||
| 669 | Ga0207646_10150092 | |||
| 670 | Ga0207681_10002291 | |||
| 671 | Ga0207681_10201828 | |||
| 672 | Ga0207694_10003707 | |||
| 673 | Ga0207694_10531991 | |||
| 674 | Ga0207650_10133105 | |||
| 675 | Ga0207650_10196839 | |||
| 676 | Ga0207659_10495087 | |||
| 677 | Ga0207700_10549273 | |||
| 678 | Ga0207690_10513993 | |||
| 679 | Ga0207706_10052609 | |||
| 680 | Ga0207706_10091118 | |||
| 681 | Ga0207709_10085856 | |||
| 682 | Ga0207709_10436512 | |||
| 683 | Ga0207670_10000064 | |||
| 684 | Ga0207670_10141855 | |||
| 685 | Ga0207670_10602833 | |||
| 686 | Ga0207704_10017670 | |||
| 687 | Ga0207691_10008844 | |||
| 688 | Ga0207691_10017331 | |||
| 689 | Ga0207691_10050504 | |||
| 690 | Ga0207691_10116516 | |||
| 691 | Ga0207711_10034266 | |||
| 692 | Ga0207689_10004241 | |||
| 693 | Ga0207661_10000444 | |||
| 694 | Ga0207661_10003085 | |||
| 695 | Ga0207661_10593604 | |||
| 696 | Ga0207679_10064658 | |||
| 697 | Ga0207667_10004969 | |||
| 698 | Ga0207667_10218838 | |||
| 699 | Ga0207667_10527448 | |||
| 700 | Ga0207651_10050939 | |||
| 701 | Ga0207651_10141766 | |||
| 702 | Ga0207651_10154611 | |||
| 703 | Ga0207651_10502351 | |||
| 704 | Ga0207668_10080871 | |||
| 705 | Ga0207668_10195674 | |||
| 706 | Ga0207658_10038169 | |||
| 707 | Ga0207658_10250915 | |||
| 708 | Ga0207658_10380445 | |||
| 709 | Ga0207677_10053078 | |||
| 710 | Ga0207677_10640915 | |||
| 711 | Ga0207703_10300966 | |||
| 712 | Ga0207639_10027771 | |||
| 713 | Ga0207639_10082656 | |||
| 714 | Ga0207678_10388856 | |||
| 715 | Ga0207708_10110506 | |||
| 716 | Ga0207708_10521773 | |||
| 717 | Ga0207702_10062188 | |||
| 718 | Ga0207641_10171667 | |||
| 719 | Ga0207648_10000984 | |||
| 720 | Ga0207648_10013257 | |||
| 721 | Ga0207648_10287813 | |||
| 722 | Ga0207674_10017659 | |||
| 723 | Ga0207675_100035627 | |||
| 724 | Ga0207675_100130235 | |||
| 725 | Ga0207675_100142047 | |||
| 726 | Ga0207683_10123815 | |||
| 727 | Ga0207683_10461909 | |||
| 728 | Ga0207698_10303611 | |||
| 729 | Ga0207428_10016435 | |||
| 730 | Ga0207428_10054438 | |||
| 731 | Ga0268265_10072124 | |||
| 732 | Ga0268265_10377031 | |||
| 733 | Ga0268264_10000030 | |||
| 734 | Ga0307515_10000292 | |||
| 735 | Ga0265338_10003118 | |||
| 736 | Ga0265332_10141077 | |||
| 737 | Ga0265325_10034209 | |||
| 738 | Ga0265340_10026517 | |||
| 739 | Ga0307509_10193588 | |||
| 740 | Ga0307408_100036322 | |||
| 741 | Ga0307408_100528231 | |||
| 742 | Ga0265313_10004883 | |||
| 743 | Ga0265313_10032002 | |||
| 744 | Ga0307508_10011607 | |||
| 745 | Ga0265314_10034777 | |||
| 746 | Ga0307516_10083114 | |||
| 747 | Ga0307516_10113726 | |||
| 748 | Ga0307405_10001234 | |||
| 749 | Ga0307405_10062112 | |||
| 750 | Ga0307405_10621138 | |||
| 751 | Ga0307413_10002493 | |||
| 752 | Ga0307413_10149306 | |||
| 753 | Ga0307410_10010279 | |||
| 754 | Ga0307410_10156097 | |||
| 755 | Ga0307406_10073164 | |||
| 756 | Ga0307406_10170248 | |||
| 757 | Ga0307406_10188250 | |||
| 758 | Ga0307412_10004520 | |||
| 759 | Ga0307412_10206538 | |||
| 760 | Ga0307412_10469058 | |||
| 761 | Ga0307409_100104052 | |||
| 762 | Ga0307409_100215967 | |||
| 763 | Ga0307416_100023883 | |||
| 764 | Ga0307416_101032928 | |||
| 765 | Ga0307414_10009478 | |||
| 766 | Ga0307414_10585624 | |||
| 767 | Ga0307411_10003401 | |||
| 768 | Ga0307411_10170745 | |||
| 769 | Ga0307415_100060832 | |||
| 770 | Ga0307507_10091082 | |||
| 771 | Ga0373956_0003655 | |||
| 772 | Ga0373943_0181399 | |||
| 773 | Ga0373961_0000004 | |||
| 774 | Ga0373924_0014735 | |||
| 775 | Ga0373931_0123421 | |||
| 776 | Ga0373933_0034647 | |||
| 777 | Ga0373933_0101295 | |||
| 778 | Ga0373947_0063015 | |||
| 779 | Ga0373937_0004472 | |||
| 780 | Ga0373937_0161548 | |||
| 781 | Ga0373937_0213042 | |||
| 782 | Ga0373925_0004343 | |||
| 783 | Ga0373925_0056541 | |||
| 784 | Ga0395899_0011366 | |||
| 785 | Ga0395900_0016357 | |||
| 786 | Ga0395900_0042196 | |||
| 787 | Ga0395898_0502095 | |||
| 788 | Ga0395905_0002007 | |||
| 789 | Ga0395905_0045282 | |||
| 790 | Ga0395905_0334362 | |||
| 791 | Ga0395905_0644108 | |||
| 792 | Ga0395901_0175256 | |||
| 793 | Ga0395901_0455632 | |||
| 794 | Ga0436365_0098868 | |||
| 795 | Ga0436363_1484586 | |||
| 796 | Ga0450898_003685 | |||
| 797 | Ga0439434_0020060 | |||
| 798 | Ga0450893_0004350 | |||
| 799 | Ga0451577_0616318 | |||
| 800 | Ga0453683_0163569 | |||
| 801 | Ga0453684_0197961 | |||
| 802 | Ga0453684_1095707 | |||
| 803 | Ga0451576_0118222 | |||
| 804 | Ga0466967_0521734 | |||
| 805 | Ga0495590_0014170 | |||
| 806 | Ga0495629_0004635 | |||
| 807 | Ga0495629_0124852 | |||
| 808 | Ga0495653_0002344 | |||
| 809 | Ga0495582_0151110 | |||
| 810 | Ga0495664_0017512 | |||
| 811 | Ga0495664_0036257 | |||
| 812 | Ga0495584_0000173 | |||
| 813 | Ga0495585_0004296 | |||
| 814 | Ga0495585_0180245 | |||
| 815 | Ga0495596_0070441 | |||
| 816 | Ga0495607_0004392 | |||
| 817 | Ga0495608_0188809 | |||
| 818 | Ga0495610_0056544 | |||
| 819 | Ga0495616_0000643 | |||
| 820 | Ga0495618_0408626 | |||
| 821 | Ga0495628_0005737 | |||
| 822 | Ga0495628_0023182 | |||
| 823 | Ga0495630_0016913 | |||
| 824 | Ga0495644_0000119 | |||
| 825 | Ga0495666_0035859 | |||
| 826 | Ga0495652_0022690 | |||
| 827 | Ga0495652_0060441 | |||
| 828 | Ga0495665_0000753 | |||
| 829 | Ga0495586_0327004 | |||
| 830 | Ga0495587_0232068 | |||
| 831 | Ga0495645_0199481 | |||
| 832 | Ga0495622_0177008 | |||
| 833 | Ga0495633_0000742 | |||
| 834 | Ga0495656_0093437 | |||
| 835 | Ga0495611_0001188 | |||
| 836 | Ga0495611_0013006 | |||
| 837 | Ga0495625_0077111 | |||
| 838 | Ga0495635_0005475 | |||
| 839 | Ga0495661_0019488 | |||
| 840 | Ga0495599_0177956 | |||
| 841 | Ga0495623_0002882 | |||
| 842 | Ga0495623_0068778 | |||
| 843 | Ga0495646_0007531 | |||
| 844 | Ga0495646_0223119 | |||
| 845 | Ga0495647_0258936 | |||
| 846 | Ga0495658_0156813 | |||
| 847 | Ga0495669_0103173 | |||
| 848 | Ga0495613_0238511 | |||
| 849 | Ga0495624_0127015 | |||
| 850 | Ga0495624_0461169 | |||
| 851 | Ga0495670_0000053 | |||
| 852 | Ga0495649_0048587 | |||
| 853 | Ga0495589_0246716 | |||
| 854 | Ga0495600_0118131 | |||
| 855 | Ga0495604_0000893 | |||
| 856 | Ga0495604_0012575 | |||
| 857 | Ga0495604_0171051 | |||
| 858 | Ga0495636_0137553 | |||
| 859 | Ga0495674_0073493 | |||
| 860 | Ga0495672_0003194 | |||
| 861 | Ga0495680_0010133 | |||
| 862 | Ga0495680_0138839 | |||
| 863 | Ga0495680_0141189 | |||
| 864 | Ga0495680_0153721 | |||
| 865 | Ga0495675_0020051 | |||
| 866 | Ga0495675_0049624 | |||
| 867 | Ga0495677_0000986 | |||
| 868 | Ga0495593_0003944 | |||
| 869 | Ga0495602_0001190 | |||
| 870 | Ga0495602_0021398 | |||
| 871 | Ga0496100_0075346 | |||
| 872 | Ga0496100_0122616 | |||
| 873 | Ga0496101_0115583 | |||
| 874 | Ga0496102_0229662 | |||
| 875 | Ga0496103_0158249 | |||
| 876 | Ga0496104_0001770 | |||
| 877 | Ga0496104_0008496 | |||
| 878 | Ga0496104_0632523 | |||
| 879 | Ga0496105_0000769 | |||
| 880 | Ga0496105_0093582 | |||
| 881 | Ga0496106_0019847 | |||
| 882 | Ga0496106_0132160 | |||
| 883 | Ga0496106_0299277 | |||
| 884 | Ga0496107_0049325 | |||
| 885 | Ga0496107_0440791 | |||
| 886 | Ga0496108_0215283 | |||
| 887 | Ga0496112_0284049 | |||
| 888 | Ga0496112_0672374 | |||
| 889 | Ga0496113_0210460 | |||
| 890 | Ga0496114_0000501 | |||
| 891 | Ga0496114_0007334 | |||
| 892 | Ga0496114_0009211 | |||
| 893 | Ga0496115_0053225 | |||
| 894 | Ga0496116_0173706 | |||
| 895 | Ga0496117_0188606 | |||
| 896 | Ga0496118_0004640 | |||
| 897 | Ga0496118_0101470 | |||
| 898 | Ga0496121_0000089 | |||
| 899 | Ga0496121_0115615 | |||
| 900 | Ga0496121_0137492 | |||
| 901 | Ga0496121_0146782 | |||
| 902 | Ga0496124_0089884 | |||
| 903 | Ga0496125_0070584 | |||
| 904 | Ga0496125_0393518 | |||
| 905 | Ga0496126_0003551 | |||
| 906 | Ga0496126_0264894 | |||
| 907 | Ga0496126_0467080 | |||
| 908 | Ga0495682_0041915 | |||
| 909 | Ga0495682_0130923 | |||
| 910 | Ga0501031_0059474 | |||
| 911 | Ga0501032_0036917 | |||
| 912 | Ga0501032_0164743 | |||
| 913 | Ga0501033_0008619 | |||
| 914 | Ga0501034_0020044 | |||
| 915 | Ga0501036_0005963 | |||
| 916 | Ga0501037_0178909 | |||
| 917 | Ga0501038_0069632 | |||
| 918 | Ga0501043_0000643 | |||
| 919 | Ga0501046_0002679 | |||
| 920 | Ga0501047_0005052 | |||
| 921 | Ga0501047_0319103 | |||
| 922 | Ga0501067_0032984 | |||
| 923 | Ga0501068_0231166 | |||
| 924 | Ga0501069_0314796 | |||
| 925 | Ga0501070_0006327 | |||
| 926 | Ga0501070_0020021 | |||
| 927 | Ga0501072_0031356 | |||
| 928 | Ga0501073_0010248 | |||
| 929 | Ga0501080_0012936 | |||
| 930 | Ga0501083_0048123 | |||
| 931 | Ga0501035_0002048 | |||
| 932 | Ga0501044_0000515 | |||
| 933 | Ga0501044_0007899 | |||
| 934 | Ga0501044_0217928 | |||
| 935 | Ga0501044_0312266 | |||
| 936 | nmdc:mga0yw44_291093_c1 | |||
| 937 | nmdc:mga0yw44_89640_c1 | |||
| 938 | nmdc:mga0k408_206_c1 | |||
| 939 | nmdc:mga0k408_65766_c1 | |||
| 940 | nmdc:mga06z11_229009_c1 | |||
| 941 | nmdc:mga05p37_52613_c1 | |||
| 942 | nmdc:mga0qj67_18883_c1 | |||
| 943 | nmdc:mga08y16_241424_c1 | |||
| 944 | nmdc:mga0n895_435785_c1 | |||
| 945 | Ga0500635_0060985 | |||
| 946 | Ga0495619_0116372 | |||
| 947 | Ga0500646_0015845 | |||
| 948 | Ga0500647_0141163 | |||
| 949 | Ga0500559_0107807 | |||
| 950 | Ga0500573_0120528 | |||
| 951 | Ga0500590_200450 | |||
| 952 | Ga0500638_175021 | |||
| 953 | Ga0500639_169760 | |||
| 954 | Ga0500596_006719 | |||
| 955 | Ga0466962_0263917 | |||
| 956 | 2510247802 | |||
| 957 | 2512350147 | |||
| 958 | 2512353008 | |||
| 959 | 2515682115 | |||
| 960 | 2599905995 | |||
| 961 | 2616905919 | |||
| 962 | 2643858999 | |||
| 963 | 2643981824 | |||
| 964 | 2719643766 | |||
| 965 | 2723879020 | |||
| 966 | 2738821397 | |||
| 967 | 2738833880 | |||
| 968 | 2738875083 | |||
| 969 | 2739187037 | |||
| 970 | 2739221681 | |||
| 971 | 2746091604 | |||
| 972 | 2746099241 | |||
| 973 | 2774392419 | |||
| 974 | 2808876897 | |||
| 975 | 2809033884 | |||
| 976 | 2831867251 | |||
| 977 | 2866557010 | |||
| 978 | 2885274407 | |||
| 979 | 2902685526 | |||
| 980 | 2919533645 | |||
| 981 | 639787696 | |||
| 982 | 8025535349 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3noj-assembly1.cif.gz_A | the structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida | 0.9831 | 2 | 227 |
| 3noj-assembly1.cif.gz_A | the structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida | 0.9746 | 2 | 227 |
| 5x15-assembly1.cif.gz_C-2 | crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family | 0.908 | 10 | 199 |
| 2pcn-assembly1.cif.gz_A | crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426 | 0.9013 | 28 | 177 |
| 1j3l-assembly1.cif.gz_A | structure of the rna-processing inhibitor rraa from thermus thermophilis | 0.8986 | 27 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3nojA01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9993 | 28 | 176 | 3.50.30.40 |
| 3nojA01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9731 | 28 | 176 | 3.50.30.40 |
| af_Q58060_12_207_3.50.30.40 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9085 | 21 | 213 | 3.50.30.40 |
| 2pcnA00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9013 | 28 | 177 | 3.50.30.40 |
| 1j3lD00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.901 | 40 | 177 | 3.50.30.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354FK52-F1-model_v4 | 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase | 0.996 | 38 | 227 |
GO:0046872
GO:0047443 |
| AF-A0A3M1C813-F1-model_v4 | 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase | 0.9947 | 3 | 186 |
GO:0046872
|
| AF-A0A6G4W5N8-F1-model_v4 | 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase (EC 4.1.3.17) | 0.9942 | 4 | 227 |
GO:0046872
GO:0047443 |
| AF-A0A6N7CV38-F1-model_v4 | 4-hydroxy-4-methyl-2-oxoglutarate aldolase/4-carboxy-4-hydroxy-2-oxoadipate aldolase | 0.9932 | 1 | 227 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 GO:0046872 GO:0047443 |
| AF-I0QYI7-F1-model_v4 | 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase | 0.993 | 3 | 226 |
GO:0046872
GO:0047443 |