F454123

General Info

Members Datasets Scaffolds Average Seq Length
491 265 491 170

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1007333|Ga0265319_10073334
Length 196
Sequence VVRRRRSREPALTGGTGDDVVSYTRHVSVLPIITLGDPRLRLRGEPVDSFGKYLHELLDDLAHTMRAAPGVGLAAPQLGVALQACVVEVEGQLHELVNPKIVRSSGDDNDLEGCLSIPGYVAYVTRREQVWVVAQNRHGRKIKVNGKGLLSRAMQHELDHLQGKLYIDYLESMDELIPVARLHDDIAEEEALASLA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
173 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
174 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.76
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10467199 3300005295 Bacteria 784
2 Ga0070676_10131525 3300005328 Bacteria 1583
3 Ga0070683_100504488 3300005329 Bacteria 1156
4 Ga0070690_100029069 3300005330 Bacteria 3426
5 Ga0070670_100537936 3300005331 Bacteria 1041
6 Ga0070670_100752893 3300005331 Bacteria 878
7 Ga0068869_100055944 3300005334 Bacteria 2876
8 Ga0068869_100599138 3300005334 Bacteria 931
9 Ga0070682_100041226 3300005337 Bacteria 2845
10 Ga0068868_100031420 3300005338 Bacteria 4078
11 Ga0068868_101221671 3300005338 Bacteria 696
12 Ga0070660_100038861 3300005339 Bacteria 3615
13 Ga0070689_100005480 3300005340 Bacteria 8675
14 Ga0070691_10022093 3300005341 Bacteria 2950
15 Ga0070691_10787380 3300005341 Bacteria 578
16 Ga0070687_100005483 3300005343 Bacteria 5140
17 Ga0070661_100196322 3300005344 Bacteria 1541
18 Ga0070692_10092987 3300005345 Bacteria 1641
19 Ga0070692_10176287 3300005345 Bacteria 1236
20 Ga0070669_100012524 3300005353 Bacteria 6017
21 Ga0070675_100002114 3300005354 Bacteria 14669
22 Ga0070675_100449647 3300005354 Bacteria 1155
23 Ga0070675_100588596 3300005354 Bacteria 1008
24 Ga0070671_100652735 3300005355 Bacteria 911
25 Ga0070673_100069340 3300005364 Bacteria 2826
26 Ga0070673_100098980 3300005364 Bacteria 2398
27 Ga0070673_100714254 3300005364 Bacteria 921
28 Ga0070688_100002293 3300005365 Bacteria 9667
29 Ga0070688_100195811 3300005365 Bacteria 1411
30 Ga0070659_100020494 3300005366 Bacteria 5023
31 Ga0070713_100675673 3300005436 Bacteria 985
32 Ga0070701_10006052 3300005438 Bacteria 5057
33 Ga0070700_100001617 3300005441 Bacteria 11239
34 Ga0070694_100005419 3300005444 Bacteria 7723
35 Ga0070694_100074379 3300005444 Bacteria 2348
36 Ga0070694_100137279 3300005444 Bacteria 1773
37 Ga0070694_100501822 3300005444 Unclassified 966
38 Ga0070708_100023242 3300005445 Bacteria 5269
39 Ga0070708_100312947 3300005445 Bacteria 1479
40 Ga0070663_100010500 3300005455 Bacteria 5772
41 Ga0070678_100046240 3300005456 Bacteria 3119
42 Ga0070678_100698530 3300005456 Bacteria 914
43 Ga0070662_100001685 3300005457 Bacteria 13597
44 Ga0070662_100142147 3300005457 Bacteria 1861
45 Ga0070681_10531702 3300005458 Bacteria 1089
46 Ga0068867_100018183 3300005459 Bacteria 4995
47 Ga0070685_10008107 3300005466 Bacteria 5386
48 Ga0070698_100025395 3300005471 Bacteria 6176
49 Ga0070699_100003085 3300005518 Bacteria 14766
50 Ga0070679_100729468 3300005530 Bacteria 934
51 Ga0070684_100102677 3300005535 Bacteria 2556
52 Ga0068853_100172268 3300005539 Bacteria 1959
53 Ga0070672_100927618 3300005543 Unclassified 770
54 Ga0070686_100042916 3300005544 Bacteria 2835
55 Ga0070695_100102010 3300005545 Bacteria 1934
56 Ga0070696_100061311 3300005546 Bacteria 2631
57 Ga0070696_100437007 3300005546 Bacteria 1030
58 Ga0070693_100024183 3300005547 Bacteria 3255
59 Ga0070665_100126691 3300005548 Bacteria 2556
60 Ga0068855_100140631 3300005563 Bacteria 2752
61 Ga0070664_100157650 3300005564 Bacteria 2006
62 Ga0070664_100454163 3300005564 Bacteria 1177
63 Ga0068857_100155701 3300005577 Bacteria 2072
64 Ga0068857_100190607 3300005577 Bacteria 1867
65 Ga0068854_100051581 3300005578 Bacteria 2948
66 Ga0068854_100232760 3300005578 Bacteria 1463
67 Ga0070702_100004660 3300005615 Bacteria 6287
68 Ga0068852_100125548 3300005616 Bacteria 2356
69 Ga0068859_100256458 3300005617 Bacteria 1839
70 Ga0068864_100034947 3300005618 Bacteria 4277
71 Ga0068866_10151376 3300005718 Bacteria 1344
72 Ga0068861_100100229 3300005719 Bacteria 2302
73 Ga0068861_100217254 3300005719 Bacteria 1614
74 Ga0068851_10129606 3300005834 Bacteria 1363
75 Ga0068870_10004323 3300005840 Bacteria 6114
76 Ga0068863_100580397 3300005841 Bacteria 1109
77 Ga0068858_100811525 3300005842 Bacteria 913
78 Ga0068860_100032595 3300005843 Bacteria 5006
79 Ga0068862_100685687 3300005844 Bacteria 991
80 Ga0081455_10267362 3300005937 Bacteria 1242
81 Ga0081455_10408347 3300005937 Bacteria 940
82 Ga0081539_10005392 3300005985 Bacteria 13090
83 Ga0097621_100583701 3300006237 Bacteria 1020
84 Ga0068871_100085320 3300006358 Bacteria 2622
85 Ga0068871_100649276 3300006358 Unclassified 963
86 Ga0075428_100002287 3300006844 Bacteria 20727
87 Ga0075428_100243557 3300006844 Bacteria 1940
88 Ga0075428_100389218 3300006844 Bacteria 1494
89 Ga0075428_101058395 3300006844 Bacteria 858
90 Ga0075433_10147496 3300006852 Unclassified 2092
91 Ga0075433_10441171 3300006852 Bacteria 1148
92 Ga0075433_10774327 3300006852 Bacteria 839
93 Ga0075433_10851363 3300006852 Bacteria 796
94 Ga0075434_100015047 3300006871 Bacteria 7409
95 Ga0075434_100934079 3300006871 Bacteria 882
96 Ga0075429_100084348 3300006880 Bacteria 2769
97 Ga0068865_100045359 3300006881 Bacteria 3013
98 Ga0097620_100256454 3300006931 Bacteria 1839
99 Ga0111539_10015431 3300009094 Bacteria 9503
100 Ga0111539_10021155 3300009094 Bacteria 8011
101 Ga0111539_10109697 3300009094 Bacteria 3238
102 Ga0111539_10180108 3300009094 Bacteria 2469
103 Ga0111539_10336784 3300009094 Bacteria 1756
104 Ga0105245_10027436 3300009098 Bacteria 5017
105 Ga0105245_10319329 3300009098 Bacteria 1529
106 Ga0105245_10450028 3300009098 Bacteria 1296
107 Ga0105245_10939461 3300009098 Unclassified 907
108 Ga0105245_11735611 3300009098 Bacteria 677
109 Ga0105247_10038009 3300009101 Bacteria 2936
110 Ga0114129_10006046 3300009147 Bacteria 17162
111 Ga0114129_10134026 3300009147 Bacteria 3400
112 Ga0114129_10200798 3300009147 Bacteria 2701
113 Ga0105243_10003529 3300009148 Bacteria 12639
114 Ga0105243_10925310 3300009148 Bacteria 869
115 Ga0105242_10071293 3300009176 Bacteria 2883
116 Ga0105248_10018770 3300009177 Bacteria 7647
117 Ga0105248_10926744 3300009177 Bacteria 984
118 Ga0105248_11720492 3300009177 Bacteria 711
119 Ga0105238_10045631 3300009551 Bacteria 4427
120 Ga0105238_11404974 3300009551 Bacteria 725
121 Ga0105249_10013021 3300009553 Bacteria 7340
122 Ga0105249_10141131 3300009553 Bacteria 2310
123 Ga0105249_10691878 3300009553 Bacteria 1079
124 Ga0105239_10030065 3300010375 Bacteria 5974
125 Ga0105239_11456412 3300010375 Bacteria 791
126 Ga0105246_10366983 3300011119 Bacteria 1185
127 Ga0105246_10710910 3300011119 Bacteria 882
128 Ga0157343_1010718 3300012488 Bacteria 699
129 Ga0157371_10447126 3300013102 Bacteria 950
130 Ga0157378_10014926 3300013297 Bacteria 6798
131 Ga0157375_10024240 3300013308 Bacteria 5612
132 Ga0157375_10229777 3300013308 Bacteria 2014
133 Ga0163163_10043715 3300014325 Bacteria 4393
134 Ga0163163_10105325 3300014325 Bacteria 2846
135 Ga0163163_10183984 3300014325 Bacteria 2137
136 Ga0157380_10526303 3300014326 Bacteria 1154
137 Ga0157380_12103579 3300014326 Bacteria 627
138 Ga0157377_10007593 3300014745 Bacteria 5244
139 Ga0157377_10070482 3300014745 Bacteria 2019
140 Ga0157377_10154147 3300014745 Bacteria 1423
141 Ga0163161_10558041 3300017792 Bacteria 939
142 Ga0207688_10088341 3300025901 Bacteria 1777
143 Ga0207688_10193178 3300025901 Bacteria 1218
144 Ga0207688_10293455 3300025901 Bacteria 993
145 Ga0207645_10147645 3300025907 Bacteria 1534
146 Ga0207643_10056930 3300025908 Bacteria 2224
147 Ga0207671_10707517 3300025914 Bacteria 801
148 Ga0207662_10007234 3300025918 Bacteria 6037
149 Ga0207657_10288132 3300025919 Bacteria 1303
150 Ga0207657_10424536 3300025919 Bacteria 1045
151 Ga0207649_10399299 3300025920 Bacteria 1028
152 Ga0207646_10342121 3300025922 Bacteria 1352
153 Ga0207681_10139824 3300025923 Bacteria 1802
154 Ga0207659_10283927 3300025926 Bacteria 1354
155 Ga0207659_10360586 3300025926 Bacteria 1208
156 Ga0207659_10804606 3300025926 Bacteria 807
157 Ga0207687_10021332 3300025927 Bacteria 4303
158 Ga0207700_10237848 3300025928 Bacteria 1551
159 Ga0207644_10229089 3300025931 Bacteria 1476
160 Ga0207690_10365415 3300025932 Bacteria 1144
161 Ga0207706_10006368 3300025933 Bacteria 10970
162 Ga0207706_10100149 3300025933 Bacteria 2549
163 Ga0207706_10246406 3300025933 Bacteria 1561
164 Ga0207706_10909783 3300025933 Bacteria 743
165 Ga0207686_10039594 3300025934 Bacteria 2860
166 Ga0207686_10130981 3300025934 Bacteria 1720
167 Ga0207686_10784962 3300025934 Bacteria 762
168 Ga0207709_10027751 3300025935 Bacteria 3266
169 Ga0207709_10875505 3300025935 Bacteria 729
170 Ga0207670_10054404 3300025936 Bacteria 2700
171 Ga0207669_10105393 3300025937 Bacteria 1875
172 Ga0207669_10256816 3300025937 Bacteria 1305
173 Ga0207704_10507192 3300025938 Bacteria 973
174 Ga0207691_10174437 3300025940 Bacteria 1881
175 Ga0207691_10311361 3300025940 Bacteria 1351
176 Ga0207689_10039677 3300025942 Bacteria 3897
177 Ga0207689_10053948 3300025942 Bacteria 3311
178 Ga0207661_11116208 3300025944 Bacteria 726
179 Ga0207651_10066888 3300025960 Bacteria 2527
180 Ga0207651_10378605 3300025960 Bacteria 1199
181 Ga0207712_10324419 3300025961 Bacteria 1272
182 Ga0207712_10400450 3300025961 Bacteria 1154
183 Ga0207712_10482535 3300025961 Bacteria 1057
184 Ga0207668_10406011 3300025972 Bacteria 1153
185 Ga0207640_10035524 3300025981 Bacteria 3120
186 Ga0207658_10248722 3300025986 Bacteria 1510
187 Ga0207658_10656034 3300025986 Bacteria 946
188 Ga0207703_10182149 3300026035 Bacteria 1854
189 Ga0207703_10413054 3300026035 Bacteria 1254
190 Ga0207703_11129571 3300026035 Bacteria 753
191 Ga0207639_10119405 3300026041 Bacteria 2164
192 Ga0207639_10254560 3300026041 Bacteria 1532
193 Ga0207708_10003389 3300026075 Bacteria 11744
194 Ga0207708_10620850 3300026075 Unclassified 917
195 Ga0207648_10001801 3300026089 Bacteria 23481
196 Ga0207648_11297575 3300026089 Bacteria 684
197 Ga0207676_10146066 3300026095 Bacteria 2031
198 Ga0207676_10231318 3300026095 Bacteria 1653
199 Ga0207674_10026907 3300026116 Bacteria 6100
200 Ga0207674_10122274 3300026116 Bacteria 2569
201 Ga0207674_11378614 3300026116 Bacteria 674
202 Ga0207675_100090725 3300026118 Bacteria 2873
203 Ga0207675_100134942 3300026118 Bacteria 2341
204 Ga0207683_10035257 3300026121 Bacteria 4351
205 Ga0207683_10113417 3300026121 Bacteria 2428
206 Ga0207698_10046980 3300026142 Bacteria 3266
207 Ga0209973_1025827 3300027252 Bacteria 807
208 Ga0209981_1042213 3300027378 Bacteria 683
209 Ga0209995_1019579 3300027471 Bacteria 1117
210 Ga0209999_1032553 3300027543 Bacteria 969
211 Ga0209983_1062763 3300027665 Bacteria 822
212 Ga0209971_1031622 3300027682 Bacteria 1269
213 Ga0209966_1019958 3300027695 Bacteria 1295
214 Ga0209974_10077697 3300027876 Bacteria 1138
215 Ga0209974_10094348 3300027876 Bacteria 1040
216 Ga0207428_10021500 3300027907 Bacteria 5463
217 Ga0207428_10086135 3300027907 Bacteria 2445
218 Ga0207428_10285056 3300027907 Bacteria 1225
219 Ga0268265_10021391 3300028380 Bacteria 4531
220 Ga0268264_10074396 3300028381 Bacteria 2886
221 Ga0268264_10235480 3300028381 Bacteria 1693
222 Ga0268264_10302498 3300028381 Bacteria 1506
223 Ga0265326_10004832 3300028558 Bacteria 4274
224 Ga0265326_10071296 3300028558 Bacteria 982
225 Ga0265319_1003781 3300028563 Bacteria 7762
226 Ga0265319_1007333 3300028563 Bacteria 4971
227 Ga0265334_10075516 3300028573 Bacteria 1249
228 Ga0265334_10087140 3300028573 Bacteria 1143
229 Ga0265318_10036118 3300028577 Bacteria 1897
230 Ga0265318_10081724 3300028577 Bacteria 1193
231 Ga0265323_10019712 3300028653 Bacteria 2600
232 Ga0265336_10018674 3300028666 Bacteria 2245
233 Ga0265338_10081720 3300028800 Bacteria 2708
234 Ga0265338_10214936 3300028800 Bacteria 1440
235 Ga0265324_10004352 3300029957 Bacteria 6442
236 Ga0265332_10026773 3300031238 Bacteria 2527
237 Ga0265320_10020347 3300031240 Bacteria 3600
238 Ga0265320_10066900 3300031240 Bacteria 1702
239 Ga0265329_10041490 3300031242 Bacteria 1475
240 Ga0265340_10008260 3300031247 Bacteria 5624
241 Ga0265340_10131768 3300031247 Bacteria 1146
242 Ga0265339_10139914 3300031249 Bacteria 1232
243 Ga0265339_10229610 3300031249 Bacteria 905
244 Ga0265339_10335367 3300031249 Bacteria 715
245 Ga0265331_10019837 3300031250 Bacteria 3463
246 Ga0265316_10074885 3300031344 Bacteria 2604
247 Ga0265316_10091831 3300031344 Bacteria 2315
248 Ga0265316_10138546 3300031344 Bacteria 1830
249 Ga0265316_10146406 3300031344 Bacteria 1771
250 Ga0265316_10242120 3300031344 Bacteria 1326
251 Ga0265316_10521279 3300031344 Bacteria 848
252 Ga0265313_10099322 3300031595 Bacteria 1294
253 Ga0265313_10276737 3300031595 Bacteria 679
254 Ga0316579_10178506 3300031691 Bacteria 1027
255 Ga0265314_10005043 3300031711 Bacteria 12035
256 Ga0265342_10055211 3300031712 Bacteria 2358
257 Ga0316576_10006767 3300031727 Bacteria 7166
258 Ga0316576_10063802 3300031727 Bacteria 2704
259 Ga0316576_10291129 3300031727 Bacteria 1222
260 Ga0307413_10588071 3300031824 Bacteria 909
261 Ga0307407_10963818 3300031903 Bacteria 657
262 Ga0307409_100118946 3300031995 Bacteria 2233
263 Ga0307409_100189570 3300031995 Bacteria 1829
264 Ga0307409_100293144 3300031995 Bacteria 1509
265 Ga0307416_102573406 3300032002 Bacteria 607
266 Ga0373943_0136967 3300035170 Unclassified 1316
267 Ga0373943_0756011 3300035170 Bacteria 577
268 Ga0373962_0045249 3300035242 Unclassified 1253
269 Ga0373962_0134696 3300035242 Bacteria 798
270 Ga0316574_0232590 3300035398 Bacteria 1179
271 Ga0316574_0299783 3300035398 Bacteria 1022
272 Ga0373931_0091125 3300035691 Bacteria 1698
273 Ga0373947_0889637 3300035725 Bacteria 608
274 Ga0373937_0552989 3300036401 Bacteria 1093
275 Ga0373937_0609439 3300036401 Bacteria 1036
276 Ga0373937_1463475 3300036401 Bacteria 631
277 Ga0316582_0376227 3300036647 Bacteria 978
278 Ga0316582_0520535 3300036647 Bacteria 820
279 Ga0316584_0149508 3300036712 Bacteria 1739
280 Ga0316584_0653176 3300036712 Bacteria 725
281 Ga0395900_0597086 3300037418 Bacteria 1045
282 Ga0436365_1892110 3300039437 Bacteria 1946
283 Ga0439438_090892 3300041405 Bacteria 744
284 Ga0439466_0040731 3300041411 Bacteria 1553
285 Ga0451798_0721429 3300041458 Bacteria 872
286 Ga0451800_1338201 3300041459 Bacteria 747
287 Ga0451807_2441806 3300041486 Bacteria 730
288 Ga0439431_0164595 3300041997 Bacteria 635
289 Ga0450920_042034 3300042122 Bacteria 912
290 Ga0439434_0147568 3300042435 Bacteria 777
291 Ga0451577_0073393 3300042876 Bacteria 3053
292 Ga0466972_0406090 3300044658 Bacteria 639
293 Ga0453684_0670168 3300044712 Bacteria 1130
294 Ga0466960_0550837 3300044901 Bacteria 680
295 Ga0495603_0067777 3300046455 Bacteria 2100
296 Ga0495651_0103158 3300046462 Bacteria 2120
297 Ga0495608_0519082 3300046511 Bacteria 720
298 Ga0495618_0174356 3300046514 Unclassified 1368
299 Ga0495628_0150567 3300046516 Bacteria 1773
300 Ga0495630_0753277 3300046517 Bacteria 744
301 Ga0495652_0114201 3300046529 Unclassified 2167
302 Ga0495645_0120922 3300046543 Unclassified 1844
303 Ga0495645_0467560 3300046543 Bacteria 793
304 Ga0495667_0194610 3300046559 Bacteria 1299
305 Ga0495667_0359941 3300046559 Bacteria 919
306 Ga0495656_0267422 3300046615 Bacteria 868
307 Ga0495634_0109945 3300046642 Unclassified 1773
308 Ga0495635_0112012 3300046663 Bacteria 1864
309 Ga0495635_0225800 3300046663 Unclassified 1266
310 Ga0495657_0326311 3300046675 Bacteria 911
311 Ga0495599_0564931 3300046678 Bacteria 665
312 Ga0495623_0354410 3300046679 Bacteria 799
313 Ga0495613_0107662 3300046689 Bacteria 2011
314 Ga0495624_0323547 3300046690 Bacteria 929
315 Ga0495600_0049854 3300046809 Bacteria 2732
316 Ga0495600_0532045 3300046809 Bacteria 720
317 Ga0495604_0386378 3300047317 Bacteria 924
318 Ga0495674_0200446 3300047319 Bacteria 1656
319 Ga0495676_0742457 3300047321 Bacteria 634
320 Ga0495676_0879307 3300047321 Bacteria 575
321 Ga0495680_0157694 3300047322 Bacteria 1650
322 Ga0495680_0481439 3300047322 Bacteria 845
323 Ga0495680_0559687 3300047322 Unclassified 769
324 Ga0495684_0520555 3300047471 Unclassified 815
325 Ga0495602_0156088 3300048088 Bacteria 1787
326 Ga0495602_0352997 3300048088 Bacteria 1061
327 Ga0495602_0392299 3300048088 Bacteria 992
328 Ga0496100_0303843 3300048903 Bacteria 1195
329 Ga0496100_0450930 3300048903 Bacteria 986
330 Ga0496100_0548373 3300048903 Bacteria 894
331 Ga0496100_0590951 3300048903 Bacteria 861
332 Ga0496101_0138260 3300048904 Bacteria 1855
333 Ga0496101_0371630 3300048904 Bacteria 1124
334 Ga0496102_0303478 3300048905 Bacteria 1505
335 Ga0496102_0755109 3300048905 Bacteria 895
336 Ga0496103_0123712 3300048906 Bacteria 1649
337 Ga0496104_0010092 3300048907 Bacteria 8433
338 Ga0496104_0056715 3300048907 Bacteria 3705
339 Ga0496104_0266744 3300048907 Bacteria 1625
340 Ga0496104_0612272 3300048907 Bacteria 999
341 Ga0496105_0002597 3300048908 Bacteria 13140
342 Ga0496105_0069664 3300048908 Bacteria 2907
343 Ga0496105_0329231 3300048908 Bacteria 1223
344 Ga0496106_0018325 3300048909 Bacteria 5174
345 Ga0496107_0070608 3300048910 Bacteria 2536
346 Ga0496108_0021332 3300048911 Bacteria 5324
347 Ga0496108_0031570 3300048911 Bacteria 4395
348 Ga0496108_0048171 3300048911 Bacteria 3563
349 Ga0496109_0030365 3300048912 Bacteria 4844
350 Ga0496109_0039455 3300048912 Bacteria 4274
351 Ga0496109_0093881 3300048912 Bacteria 2777
352 Ga0496109_0094017 3300048912 Bacteria 2775
353 Ga0496109_0826003 3300048912 Bacteria 865
354 Ga0496109_1209384 3300048912 Bacteria 692
355 Ga0496110_0008071 3300048913 Bacteria 8451
356 Ga0496110_0021157 3300048913 Bacteria 5500
357 Ga0496110_0144768 3300048913 Bacteria 2149
358 Ga0496111_0010849 3300048914 Bacteria 6127
359 Ga0496111_0026604 3300048914 Bacteria 4086
360 Ga0496112_0028837 3300048915 Bacteria 5362
361 Ga0496112_0131128 3300048915 Bacteria 2477
362 Ga0496112_0162125 3300048915 Bacteria 2203
363 Ga0496113_0002757 3300048916 Bacteria 10328
364 Ga0496113_0109793 3300048916 Bacteria 2146
365 Ga0496113_0321025 3300048916 Bacteria 1241
366 Ga0496114_0382250 3300048917 Bacteria 1246
367 Ga0496114_0879212 3300048917 Bacteria 777
368 Ga0501031_0310564 3300049568 Bacteria 1022
369 Ga0501032_0054227 3300049569 Unclassified 2699
370 Ga0501033_0051201 3300049570 Unclassified 3061
371 Ga0501033_0116115 3300049570 Bacteria 1945
372 Ga0501033_0484781 3300049570 Bacteria 856
373 Ga0501034_0438007 3300049571 Unclassified 1226
374 Ga0501036_0121013 3300049572 Unclassified 2210
375 Ga0501037_0103850 3300049573 Bacteria 2049
376 Ga0501038_0238179 3300049574 Bacteria 1446
377 Ga0501038_0337119 3300049574 Bacteria 1177
378 Ga0501038_0859112 3300049574 Bacteria 672
379 Ga0501039_0022179 3300049575 Bacteria 4874
380 Ga0501039_0259075 3300049575 Bacteria 1367
381 Ga0501040_0053774 3300049576 Bacteria 2759
382 Ga0501040_0060794 3300049576 Bacteria 2597
383 Ga0501040_0060938 3300049576 Bacteria 2594
384 Ga0501040_0111674 3300049576 Unclassified 1911
385 Ga0501040_0140709 3300049576 Bacteria 1700
386 Ga0501040_0591995 3300049576 Bacteria 801
387 Ga0501040_0805615 3300049576 Bacteria 680
388 Ga0501041_0176722 3300049577 Unclassified 1336
389 Ga0501041_0203498 3300049577 Bacteria 1241
390 Ga0501042_0011462 3300049578 Bacteria 5983
391 Ga0501042_0058122 3300049578 Bacteria 2760
392 Ga0501042_1259950 3300049578 Bacteria 539
393 Ga0501043_0065952 3300049579 Unclassified 2843
394 Ga0501043_1009450 3300049579 Bacteria 592
395 Ga0501046_0236087 3300049580 Bacteria 1350
396 Ga0501046_0509348 3300049580 Bacteria 861
397 Ga0501048_0046008 3300049582 Unclassified 3115
398 Ga0501048_0188789 3300049582 Bacteria 1460
399 Ga0501048_0681238 3300049582 Bacteria 738
400 Ga0501067_0180672 3300049583 Bacteria 1175
401 Ga0501068_0150228 3300049584 Bacteria 1464
402 Ga0501068_0153353 3300049584 Bacteria 1449
403 Ga0501068_0156746 3300049584 Bacteria 1434
404 Ga0501068_0237071 3300049584 Bacteria 1161
405 Ga0501069_0064481 3300049585 Unclassified 2047
406 Ga0501069_0131173 3300049585 Bacteria 1435
407 Ga0501069_0456632 3300049585 Bacteria 760
408 Ga0501070_0095189 3300049586 Unclassified 2464
409 Ga0501070_0212464 3300049586 Bacteria 1588
410 Ga0501071_0014751 3300049587 Bacteria 5349
411 Ga0501071_0065594 3300049587 Bacteria 2636
412 Ga0501071_0089567 3300049587 Bacteria 2258
413 Ga0501071_0143511 3300049587 Unclassified 1779
414 Ga0501071_0153394 3300049587 Bacteria 1719
415 Ga0501071_0271155 3300049587 Bacteria 1283
416 Ga0501072_0027548 3300049588 Bacteria 4433
417 Ga0501072_0038198 3300049588 Unclassified 3767
418 Ga0501073_0044332 3300049589 Unclassified 3135
419 Ga0501074_0055207 3300049590 Unclassified 2863
420 Ga0501074_0296881 3300049590 Bacteria 1148
421 Ga0501075_0019229 3300049591 Bacteria 4953
422 Ga0501075_0060950 3300049591 Bacteria 2842
423 Ga0501075_0086813 3300049591 Bacteria 2370
424 Ga0501075_0101364 3300049591 Bacteria 2187
425 Ga0501075_0160944 3300049591 Bacteria 1713
426 Ga0501075_0307660 3300049591 Bacteria 1208
427 Ga0501076_0053283 3300049592 Bacteria 3206
428 Ga0501076_0670980 3300049592 Bacteria 856
429 Ga0501076_0677788 3300049592 Unclassified 851
430 Ga0501077_0095315 3300049593 Unclassified 1886
431 Ga0501077_0152408 3300049593 Bacteria 1467
432 Ga0501077_0287525 3300049593 Bacteria 1047
433 Ga0501079_0007714 3300049741 Bacteria 8146
434 Ga0501079_0043901 3300049741 Unclassified 3450
435 Ga0501079_0085876 3300049741 Bacteria 2436
436 Ga0501079_0497332 3300049741 Bacteria 958
437 Ga0501079_1008899 3300049741 Bacteria 656
438 Ga0501080_0147760 3300049742 Bacteria 2173
439 Ga0501080_0159528 3300049742 Unclassified 2083
440 Ga0501080_0267728 3300049742 Bacteria 1556
441 Ga0501081_0185021 3300049743 Unclassified 1507
442 Ga0501081_0185179 3300049743 Bacteria 1507
443 Ga0501081_0368627 3300049743 Bacteria 1060
444 Ga0501081_0981348 3300049743 Unclassified 638
445 Ga0501083_0052397 3300049744 Unclassified 2741
446 Ga0501083_0172922 3300049744 Bacteria 1412
447 Ga0501083_0317130 3300049744 Bacteria 1014
448 Ga0501035_0261509 3300049822 Bacteria 1467
449 Ga0501044_0189348 3300049823 Unclassified 2021
450 Ga0501045_0028291 3300049824 Bacteria 4042
451 Ga0501045_0058851 3300049824 Bacteria 2814
452 Ga0501045_0060104 3300049824 Bacteria 2785
453 Ga0501045_0129631 3300049824 Bacteria 1875
454 Ga0501045_0252539 3300049824 Unclassified 1312
455 Ga0501045_0267916 3300049824 Bacteria 1272
456 nmdc:mga05p37_761_c1 3300050507 Bacteria 35802
457 nmdc:mga05p37_79764_c1 3300050507 Unclassified 4031
458 nmdc:mga05p37_956433_c1 3300050507 Bacteria 916
459 nmdc:mga08y16_104183_c1 3300050511 Bacteria 2953
460 nmdc:mga08y16_31934_c1 3300050511 Bacteria 4946
461 nmdc:mga08y16_38093_c1 3300050511 Bacteria 5049
462 nmdc:mga08y16_724315_c1 3300050511 Bacteria 993
463 nmdc:mga0n895_1108409_c1 3300050512 Unclassified 769
464 nmdc:mga0n895_49530_c1 3300050512 Bacteria 4116
465 nmdc:mga0a205_117194_c1 3300050515 Unclassified 2561
466 nmdc:mga0a205_443801_c1 3300050515 Bacteria 1158
467 nmdc:mga0a205_793944_c1 3300050515 Bacteria 794
468 Ga0495601_0041855 3300053077 Bacteria 2872
469 Ga0495595_0074724 3300053084 Bacteria 1607
470 Ga0495595_0137377 3300053084 Bacteria 1198
471 Ga0495619_0032651 3300053085 Bacteria 3378
472 Ga0495619_0106210 3300053085 Bacteria 1915
473 Ga0495619_0164215 3300053085 Bacteria 1534
474 Ga0501084_0083395 3300054114 Bacteria 2682
475 Ga0501084_0107879 3300054114 Bacteria 2339
476 Ga0501084_0109455 3300054114 Bacteria 2321
477 Ga0501084_0160113 3300054114 Bacteria 1899
478 Ga0501084_0242839 3300054114 Bacteria 1520
479 Ga0501084_0356489 3300054114 Bacteria 1236
480 Ga0590071_000361 3300059421 Bacteria 13441
481 Ga0590075_001840 3300059424 Bacteria 5161
482 Ga0590077_009045 3300059426 Bacteria 2039
483 Ga0501082_0026145 3300060353 Bacteria 5031
484 Ga0501082_0036103 3300060353 Bacteria 4258
485 Ga0501082_0099161 3300060353 Bacteria 2519
486 Ga0501082_0322896 3300060353 Bacteria 1345
487 Ga0501082_0634753 3300060353 Bacteria 935
488 Ga0530510_0000976 3300061734 Bacteria 18901
489 Ga0530510_0194547 3300061734 Unclassified 1506
490 Ga0530510_0281111 3300061734 Bacteria 1243
491 Ga0530510_0608436 3300061734 Bacteria 831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_12103579 Ga0157380_121035791 145
2 3300028563 Ga0265319_1003781 Ga0265319_10037813 145
3 3300006844 Ga0075428_100389218 Ga0075428_1003892182 147
4 3300006871 Ga0075434_100934079 Ga0075434_1009340792 151
5 3300009094 Ga0111539_10336784 Ga0111539_103367842 151
6 3300031824 Ga0307413_10588071 Ga0307413_105880711 151
7 3300031903 Ga0307407_10963818 Ga0307407_109638181 151
8 3300031995 Ga0307409_100118946 Ga0307409_1001189463 151
9 3300031995 Ga0307409_100189570 Ga0307409_1001895703 151
10 3300041411 Ga0439466_0040731 Ga0439466_0040731_633_1148 151
11 3300044658 Ga0466972_0406090 Ga0466972_0406090_95_607 151
12 3300049569 Ga0501032_0054227 Ga0501032_0054227_362_877 151
13 3300049570 Ga0501033_0051201 Ga0501033_0051201_2069_2584 151
14 3300049571 Ga0501034_0438007 Ga0501034_0438007_336_851 151
15 3300049572 Ga0501036_0121013 Ga0501036_0121013_1417_1932 151
16 3300049573 Ga0501037_0103850 Ga0501037_0103850_440_955 151
17 3300049576 Ga0501040_0111674 Ga0501040_0111674_455_970 151
18 3300049577 Ga0501041_0176722 Ga0501041_0176722_557_1072 151
19 3300049578 Ga0501042_0011462 Ga0501042_0011462_1428_1943 151
20 3300049579 Ga0501043_0065952 Ga0501043_0065952_816_1331 151
21 3300049582 Ga0501048_0046008 Ga0501048_0046008_1984_2499 151
22 3300049585 Ga0501069_0064481 Ga0501069_0064481_1325_1840 151
23 3300049586 Ga0501070_0095189 Ga0501070_0095189_440_955 151
24 3300049587 Ga0501071_0065594 Ga0501071_0065594_675_1190 151
25 3300049588 Ga0501072_0038198 Ga0501072_0038198_386_901 151
26 3300049589 Ga0501073_0044332 Ga0501073_0044332_970_1485 151
27 3300049590 Ga0501074_0055207 Ga0501074_0055207_2254_2769 151
28 3300049593 Ga0501077_0095315 Ga0501077_0095315_883_1398 151
29 3300049741 Ga0501079_0043901 Ga0501079_0043901_108_623 151
30 3300049742 Ga0501080_0159528 Ga0501080_0159528_245_760 151
31 3300049743 Ga0501081_0185021 Ga0501081_0185021_347_862 151
32 3300049744 Ga0501083_0052397 Ga0501083_0052397_2072_2587 151
33 3300049823 Ga0501044_0189348 Ga0501044_0189348_607_1122 151
34 3300049824 Ga0501045_0252539 Ga0501045_0252539_445_960 151
35 3300054114 Ga0501084_0083395 Ga0501084_0083395_1464_1979 151
36 3300060353 Ga0501082_0036103 Ga0501082_0036103_3440_3955 151
37 3300005354 Ga0070675_100449647 Ga0070675_1004496472 152
38 3300005444 Ga0070694_100074379 Ga0070694_1000743793 152
39 3300005457 Ga0070662_100142147 Ga0070662_1001421473 152
40 3300005577 Ga0068857_100155701 Ga0068857_1001557012 152
41 3300005578 Ga0068854_100232760 Ga0068854_1002327602 152
42 3300005719 Ga0068861_100100229 Ga0068861_1001002292 152
43 3300006844 Ga0075428_101058395 Ga0075428_1010583952 152
44 3300009094 Ga0111539_10015431 Ga0111539_100154316 152
45 3300014745 Ga0157377_10070482 Ga0157377_100704822 152
46 3300025901 Ga0207688_10193178 Ga0207688_101931782 152
47 3300025926 Ga0207659_10360586 Ga0207659_103605862 152
48 3300025933 Ga0207706_10100149 Ga0207706_101001493 152
49 3300025961 Ga0207712_10400450 Ga0207712_104004502 152
50 3300025972 Ga0207668_10406011 Ga0207668_104060112 152
51 3300026116 Ga0207674_10122274 Ga0207674_101222742 152
52 3300026118 Ga0207675_100134942 Ga0207675_1001349422 152
53 3300027907 Ga0207428_10021500 Ga0207428_100215005 152
54 3300027907 Ga0207428_10285056 Ga0207428_102850562 152
55 3300050511 nmdc:mga08y16_38093_c1 nmdc:mga08y16_38093_c1_4004_4519 152
56 3300050511 nmdc:mga08y16_724315_c1 nmdc:mga08y16_724315_c1_28_543 152
57 3300059421 Ga0590071_000361 Ga0590071_000361_2209_2721 152
58 3300059424 Ga0590075_001840 Ga0590075_001840_3825_4337 152
59 3300059426 Ga0590077_009045 Ga0590077_009045_642_1154 152
60 3300028558 Ga0265326_10071296 Ga0265326_100712961 153
61 3300028573 Ga0265334_10075516 Ga0265334_100755162 153
62 3300031344 Ga0265316_10146406 Ga0265316_101464062 153
63 3300031249 Ga0265339_10139914 Ga0265339_101399141 154
64 3300005445 Ga0070708_100023242 Ga0070708_1000232423 155
65 3300031595 Ga0265313_10276737 Ga0265313_102767371 155
66 3300035170 Ga0373943_0136967 Ga0373943_0136967_313_864 155
67 3300005329 Ga0070683_100504488 Ga0070683_1005044882 156
68 3300005331 Ga0070670_100752893 Ga0070670_1007528932 156
69 3300005334 Ga0068869_100599138 Ga0068869_1005991382 156
70 3300005354 Ga0070675_100588596 Ga0070675_1005885961 156
71 3300005364 Ga0070673_100098980 Ga0070673_1000989803 156
72 3300005365 Ga0070688_100195811 Ga0070688_1001958111 156
73 3300005455 Ga0070663_100010500 Ga0070663_1000105007 156
74 3300005535 Ga0070684_100102677 Ga0070684_1001026773 156
75 3300005544 Ga0070686_100042916 Ga0070686_1000429163 156
76 3300005564 Ga0070664_100454163 Ga0070664_1004541632 156
77 3300005937 Ga0081455_10408347 Ga0081455_104083472 156
78 3300006358 Ga0068871_100085320 Ga0068871_1000853202 156
79 3300009098 Ga0105245_10450028 Ga0105245_104500282 156
80 3300009177 Ga0105248_10926744 Ga0105248_109267442 156
81 3300011119 Ga0105246_10366983 Ga0105246_103669831 156
82 3300011119 Ga0105246_10710910 Ga0105246_107109102 156
83 3300014325 Ga0163163_10105325 Ga0163163_101053253 156
84 3300014325 Ga0163163_10183984 Ga0163163_101839842 156
85 3300014326 Ga0157380_10526303 Ga0157380_105263032 156
86 3300025901 Ga0207688_10293455 Ga0207688_102934552 156
87 3300025926 Ga0207659_10804606 Ga0207659_108046062 156
88 3300025931 Ga0207644_10229089 Ga0207644_102290892 156
89 3300025932 Ga0207690_10365415 Ga0207690_103654152 156
90 3300025934 Ga0207686_10130981 Ga0207686_101309813 156
91 3300025935 Ga0207709_10875505 Ga0207709_108755052 156
92 3300025940 Ga0207691_10311361 Ga0207691_103113613 156
93 3300025942 Ga0207689_10053948 Ga0207689_100539483 156
94 3300025960 Ga0207651_10378605 Ga0207651_103786052 156
95 3300025986 Ga0207658_10656034 Ga0207658_106560342 156
96 3300026095 Ga0207676_10231318 Ga0207676_102313183 156
97 3300026116 Ga0207674_11378614 Ga0207674_113786142 156
98 3300026121 Ga0207683_10035257 Ga0207683_100352572 156
99 3300028381 Ga0268264_10074396 Ga0268264_100743963 156
100 3300028577 Ga0265318_10036118 Ga0265318_100361182 156
101 3300028666 Ga0265336_10018674 Ga0265336_100186743 156
102 3300031249 Ga0265339_10229610 Ga0265339_102296102 156
103 3300035170 Ga0373943_0756011 Ga0373943_0756011_12_557 156
104 3300035242 Ga0373962_0134696 Ga0373962_0134696_102_620 156
105 3300036647 Ga0316582_0520535 Ga0316582_0520535_169_705 156
106 3300036712 Ga0316584_0653176 Ga0316584_0653176_80_616 156
107 3300047321 Ga0495676_0879307 Ga0495676_0879307_25_534 156
108 3300048903 Ga0496100_0548373 Ga0496100_0548373_125_643 156
109 3300048907 Ga0496104_0056715 Ga0496104_0056715_24_542 156
110 3300048908 Ga0496105_0002597 Ga0496105_0002597_4433_4951 156
111 3300048911 Ga0496108_0031570 Ga0496108_0031570_3003_3521 156
112 3300048911 Ga0496108_0048171 Ga0496108_0048171_2650_3168 156
113 3300048912 Ga0496109_0030365 Ga0496109_0030365_1245_1763 156
114 3300048912 Ga0496109_0094017 Ga0496109_0094017_309_827 156
115 3300048913 Ga0496110_0008071 Ga0496110_0008071_6487_7005 156
116 3300048914 Ga0496111_0026604 Ga0496111_0026604_2191_2709 156
117 3300048915 Ga0496112_0131128 Ga0496112_0131128_715_1233 156
118 3300048916 Ga0496113_0002757 Ga0496113_0002757_3809_4327 156
119 3300005530 Ga0070679_100729468 Ga0070679_1007294682 157
120 3300006852 Ga0075433_10851363 Ga0075433_108513632 157
121 3300009551 Ga0105238_11404974 Ga0105238_114049741 157
122 3300028558 Ga0265326_10004832 Ga0265326_100048323 157
123 3300028563 Ga0265319_1007333 Ga0265319_10073334 157
124 3300028573 Ga0265334_10087140 Ga0265334_100871401 157
125 3300028800 Ga0265338_10081720 Ga0265338_100817202 157
126 3300031240 Ga0265320_10020347 Ga0265320_100203472 157
127 3300031240 Ga0265320_10066900 Ga0265320_100669002 157
128 3300031242 Ga0265329_10041490 Ga0265329_100414901 157
129 3300031247 Ga0265340_10131768 Ga0265340_101317682 157
130 3300031249 Ga0265339_10335367 Ga0265339_103353672 157
131 3300031344 Ga0265316_10074885 Ga0265316_100748852 157
132 3300031344 Ga0265316_10242120 Ga0265316_102421202 157
133 3300031712 Ga0265342_10055211 Ga0265342_100552112 157
134 3300041405 Ga0439438_090892 Ga0439438_090892_235_726 157
135 3300046462 Ga0495651_0103158 Ga0495651_0103158_666_1181 157
136 3300048903 Ga0496100_0303843 Ga0496100_0303843_483_998 157
137 3300048917 Ga0496114_0879212 Ga0496114_0879212_126_620 157
138 3300049575 Ga0501039_0022179 Ga0501039_0022179_1249_1740 157
139 3300049576 Ga0501040_0140709 Ga0501040_0140709_140_652 157
140 3300049576 Ga0501040_0591995 Ga0501040_0591995_20_511 157
141 3300049583 Ga0501067_0180672 Ga0501067_0180672_121_636 157
142 3300049584 Ga0501068_0156746 Ga0501068_0156746_33_572 157
143 3300049585 Ga0501069_0131173 Ga0501069_0131173_187_699 157
144 3300049587 Ga0501071_0153394 Ga0501071_0153394_276_788 157
145 3300049587 Ga0501071_0271155 Ga0501071_0271155_422_961 157
146 3300049591 Ga0501075_0086813 Ga0501075_0086813_1200_1691 157
147 3300049591 Ga0501075_0307660 Ga0501075_0307660_158_670 157
148 3300049592 Ga0501076_0670980 Ga0501076_0670980_184_699 157
149 3300049743 Ga0501081_0368627 Ga0501081_0368627_89_601 157
150 3300049824 Ga0501045_0060104 Ga0501045_0060104_1392_1883 157
151 3300049824 Ga0501045_0129631 Ga0501045_0129631_395_907 157
152 3300054114 Ga0501084_0242839 Ga0501084_0242839_181_672 157
153 3300061734 Ga0530510_0281111 Ga0530510_0281111_60_572 157
154 3300005295 Ga0065707_10467199 Ga0065707_104671991 158
155 3300005328 Ga0070676_10131525 Ga0070676_101315252 158
156 3300005330 Ga0070690_100029069 Ga0070690_1000290695 158
157 3300005331 Ga0070670_100537936 Ga0070670_1005379362 158
158 3300005334 Ga0068869_100055944 Ga0068869_1000559443 158
159 3300005337 Ga0070682_100041226 Ga0070682_1000412262 158
160 3300005338 Ga0068868_100031420 Ga0068868_1000314205 158
161 3300005338 Ga0068868_101221671 Ga0068868_1012216711 158
162 3300005339 Ga0070660_100038861 Ga0070660_1000388615 158
163 3300005340 Ga0070689_100005480 Ga0070689_1000054808 158
164 3300005341 Ga0070691_10022093 Ga0070691_100220935 158
165 3300005341 Ga0070691_10787380 Ga0070691_107873801 158
166 3300005343 Ga0070687_100005483 Ga0070687_1000054834 158
167 3300005344 Ga0070661_100196322 Ga0070661_1001963222 158
168 3300005345 Ga0070692_10092987 Ga0070692_100929872 158
169 3300005345 Ga0070692_10176287 Ga0070692_101762871 158
170 3300005353 Ga0070669_100012524 Ga0070669_1000125245 158
171 3300005354 Ga0070675_100002114 Ga0070675_10000211414 158
172 3300005355 Ga0070671_100652735 Ga0070671_1006527351 158
173 3300005364 Ga0070673_100069340 Ga0070673_1000693404 158
174 3300005364 Ga0070673_100714254 Ga0070673_1007142542 158
175 3300005365 Ga0070688_100002293 Ga0070688_1000022935 158
176 3300005366 Ga0070659_100020494 Ga0070659_1000204945 158
177 3300005436 Ga0070713_100675673 Ga0070713_1006756732 158
178 3300005438 Ga0070701_10006052 Ga0070701_100060523 158
179 3300005441 Ga0070700_100001617 Ga0070700_1000016179 158
180 3300005444 Ga0070694_100005419 Ga0070694_1000054192 158
181 3300005444 Ga0070694_100137279 Ga0070694_1001372793 158
182 3300005444 Ga0070694_100501822 Ga0070694_1005018222 158
183 3300005445 Ga0070708_100312947 Ga0070708_1003129472 158
184 3300005456 Ga0070678_100046240 Ga0070678_1000462405 158
185 3300005456 Ga0070678_100698530 Ga0070678_1006985302 158
186 3300005457 Ga0070662_100001685 Ga0070662_1000016859 158
187 3300005458 Ga0070681_10531702 Ga0070681_105317022 158
188 3300005459 Ga0068867_100018183 Ga0068867_1000181835 158
189 3300005466 Ga0070685_10008107 Ga0070685_100081074 158
190 3300005471 Ga0070698_100025395 Ga0070698_1000253955 158
191 3300005518 Ga0070699_100003085 Ga0070699_1000030856 158
192 3300005539 Ga0068853_100172268 Ga0068853_1001722683 158
193 3300005543 Ga0070672_100927618 Ga0070672_1009276182 158
194 3300005545 Ga0070695_100102010 Ga0070695_1001020103 158
195 3300005546 Ga0070696_100061311 Ga0070696_1000613112 158
196 3300005546 Ga0070696_100437007 Ga0070696_1004370072 158
197 3300005547 Ga0070693_100024183 Ga0070693_1000241834 158
198 3300005548 Ga0070665_100126691 Ga0070665_1001266912 158
199 3300005563 Ga0068855_100140631 Ga0068855_1001406311 158
200 3300005564 Ga0070664_100157650 Ga0070664_1001576504 158
201 3300005577 Ga0068857_100190607 Ga0068857_1001906072 158
202 3300005578 Ga0068854_100051581 Ga0068854_1000515813 158
203 3300005615 Ga0070702_100004660 Ga0070702_1000046607 158
204 3300005616 Ga0068852_100125548 Ga0068852_1001255484 158
205 3300005617 Ga0068859_100256458 Ga0068859_1002564582 158
206 3300005618 Ga0068864_100034947 Ga0068864_1000349473 158
207 3300005718 Ga0068866_10151376 Ga0068866_101513762 158
208 3300005719 Ga0068861_100217254 Ga0068861_1002172542 158
209 3300005834 Ga0068851_10129606 Ga0068851_101296062 158
210 3300005840 Ga0068870_10004323 Ga0068870_100043236 158
211 3300005841 Ga0068863_100580397 Ga0068863_1005803972 158
212 3300005842 Ga0068858_100811525 Ga0068858_1008115252 158
213 3300005843 Ga0068860_100032595 Ga0068860_1000325953 158
214 3300005844 Ga0068862_100685687 Ga0068862_1006856871 158
215 3300005937 Ga0081455_10267362 Ga0081455_102673622 158
216 3300005985 Ga0081539_10005392 Ga0081539_100053929 158
217 3300006237 Ga0097621_100583701 Ga0097621_1005837012 158
218 3300006358 Ga0068871_100649276 Ga0068871_1006492762 158
219 3300006844 Ga0075428_100002287 Ga0075428_10000228713 158
220 3300006844 Ga0075428_100243557 Ga0075428_1002435573 158
221 3300006852 Ga0075433_10147496 Ga0075433_101474962 158
222 3300006852 Ga0075433_10441171 Ga0075433_104411712 158
223 3300006852 Ga0075433_10774327 Ga0075433_107743272 158
224 3300006871 Ga0075434_100015047 Ga0075434_1000150475 158
225 3300006880 Ga0075429_100084348 Ga0075429_1000843483 158
226 3300006881 Ga0068865_100045359 Ga0068865_1000453595 158
227 3300006931 Ga0097620_100256454 Ga0097620_1002564542 158
228 3300009094 Ga0111539_10021155 Ga0111539_100211553 158
229 3300009094 Ga0111539_10109697 Ga0111539_101096972 158
230 3300009094 Ga0111539_10180108 Ga0111539_101801081 158
231 3300009098 Ga0105245_10027436 Ga0105245_100274365 158
232 3300009098 Ga0105245_10319329 Ga0105245_103193293 158
233 3300009098 Ga0105245_10939461 Ga0105245_109394612 158
234 3300009098 Ga0105245_11735611 Ga0105245_117356111 158
235 3300009101 Ga0105247_10038009 Ga0105247_100380093 158
236 3300009147 Ga0114129_10006046 Ga0114129_100060465 158
237 3300009147 Ga0114129_10134026 Ga0114129_101340264 158
238 3300009147 Ga0114129_10200798 Ga0114129_102007985 158
239 3300009148 Ga0105243_10003529 Ga0105243_100035292 158
240 3300009148 Ga0105243_10925310 Ga0105243_109253101 158
241 3300009176 Ga0105242_10071293 Ga0105242_100712932 158
242 3300009177 Ga0105248_10018770 Ga0105248_100187709 158
243 3300009177 Ga0105248_11720492 Ga0105248_117204922 158
244 3300009551 Ga0105238_10045631 Ga0105238_100456314 158
245 3300009553 Ga0105249_10013021 Ga0105249_100130219 158
246 3300009553 Ga0105249_10141131 Ga0105249_101411312 158
247 3300009553 Ga0105249_10691878 Ga0105249_106918782 158
248 3300010375 Ga0105239_10030065 Ga0105239_100300658 158
249 3300010375 Ga0105239_11456412 Ga0105239_114564121 158
250 3300012488 Ga0157343_1010718 Ga0157343_10107182 158
251 3300013102 Ga0157371_10447126 Ga0157371_104471262 158
252 3300013297 Ga0157378_10014926 Ga0157378_100149264 158
253 3300013308 Ga0157375_10024240 Ga0157375_100242402 158
254 3300013308 Ga0157375_10229777 Ga0157375_102297773 158
255 3300014325 Ga0163163_10043715 Ga0163163_100437152 158
256 3300014745 Ga0157377_10007593 Ga0157377_100075934 158
257 3300014745 Ga0157377_10154147 Ga0157377_101541472 158
258 3300017792 Ga0163161_10558041 Ga0163161_105580412 158
259 3300025901 Ga0207688_10088341 Ga0207688_100883414 158
260 3300025907 Ga0207645_10147645 Ga0207645_101476452 158
261 3300025908 Ga0207643_10056930 Ga0207643_100569303 158
262 3300025914 Ga0207671_10707517 Ga0207671_107075172 158
263 3300025918 Ga0207662_10007234 Ga0207662_100072345 158
264 3300025919 Ga0207657_10288132 Ga0207657_102881322 158
265 3300025919 Ga0207657_10424536 Ga0207657_104245361 158
266 3300025920 Ga0207649_10399299 Ga0207649_103992992 158
267 3300025922 Ga0207646_10342121 Ga0207646_103421212 158
268 3300025923 Ga0207681_10139824 Ga0207681_101398243 158
269 3300025926 Ga0207659_10283927 Ga0207659_102839272 158
270 3300025927 Ga0207687_10021332 Ga0207687_100213324 158
271 3300025928 Ga0207700_10237848 Ga0207700_102378483 158
272 3300025933 Ga0207706_10006368 Ga0207706_100063684 158
273 3300025933 Ga0207706_10246406 Ga0207706_102464061 158
274 3300025933 Ga0207706_10909783 Ga0207706_109097832 158
275 3300025934 Ga0207686_10039594 Ga0207686_100395945 158
276 3300025934 Ga0207686_10784962 Ga0207686_107849621 158
277 3300025935 Ga0207709_10027751 Ga0207709_100277515 158
278 3300025936 Ga0207670_10054404 Ga0207670_100544042 158
279 3300025937 Ga0207669_10105393 Ga0207669_101053932 158
280 3300025937 Ga0207669_10256816 Ga0207669_102568162 158
281 3300025938 Ga0207704_10507192 Ga0207704_105071921 158
282 3300025940 Ga0207691_10174437 Ga0207691_101744374 158
283 3300025942 Ga0207689_10039677 Ga0207689_100396775 158
284 3300025944 Ga0207661_11116208 Ga0207661_111162081 158
285 3300025960 Ga0207651_10066888 Ga0207651_100668884 158
286 3300025961 Ga0207712_10324419 Ga0207712_103244192 158
287 3300025961 Ga0207712_10482535 Ga0207712_104825352 158
288 3300025981 Ga0207640_10035524 Ga0207640_100355243 158
289 3300025986 Ga0207658_10248722 Ga0207658_102487222 158
290 3300026035 Ga0207703_10182149 Ga0207703_101821492 158
291 3300026035 Ga0207703_10413054 Ga0207703_104130542 158
292 3300026035 Ga0207703_11129571 Ga0207703_111295712 158
293 3300026041 Ga0207639_10119405 Ga0207639_101194052 158
294 3300026041 Ga0207639_10254560 Ga0207639_102545602 158
295 3300026075 Ga0207708_10003389 Ga0207708_100033895 158
296 3300026075 Ga0207708_10620850 Ga0207708_106208502 158
297 3300026089 Ga0207648_10001801 Ga0207648_100018019 158
298 3300026089 Ga0207648_11297575 Ga0207648_112975751 158
299 3300026095 Ga0207676_10146066 Ga0207676_101460662 158
300 3300026116 Ga0207674_10026907 Ga0207674_100269074 158
301 3300026118 Ga0207675_100090725 Ga0207675_1000907253 158
302 3300026121 Ga0207683_10113417 Ga0207683_101134172 158
303 3300026142 Ga0207698_10046980 Ga0207698_100469803 158
304 3300027252 Ga0209973_1025827 Ga0209973_10258272 158
305 3300027378 Ga0209981_1042213 Ga0209981_10422132 158
306 3300027471 Ga0209995_1019579 Ga0209995_10195792 158
307 3300027543 Ga0209999_1032553 Ga0209999_10325532 158
308 3300027665 Ga0209983_1062763 Ga0209983_10627631 158
309 3300027682 Ga0209971_1031622 Ga0209971_10316222 158
310 3300027695 Ga0209966_1019958 Ga0209966_10199582 158
311 3300027876 Ga0209974_10077697 Ga0209974_100776972 158
312 3300027876 Ga0209974_10094348 Ga0209974_100943482 158
313 3300027907 Ga0207428_10086135 Ga0207428_100861355 158
314 3300028380 Ga0268265_10021391 Ga0268265_100213912 158
315 3300028381 Ga0268264_10235480 Ga0268264_102354803 158
316 3300028381 Ga0268264_10302498 Ga0268264_103024982 158
317 3300028577 Ga0265318_10081724 Ga0265318_100817241 158
318 3300028653 Ga0265323_10019712 Ga0265323_100197122 158
319 3300028800 Ga0265338_10214936 Ga0265338_102149362 158
320 3300029957 Ga0265324_10004352 Ga0265324_100043525 158
321 3300031238 Ga0265332_10026773 Ga0265332_100267732 158
322 3300031247 Ga0265340_10008260 Ga0265340_100082602 158
323 3300031250 Ga0265331_10019837 Ga0265331_100198373 158
324 3300031344 Ga0265316_10091831 Ga0265316_100918313 158
325 3300031344 Ga0265316_10138546 Ga0265316_101385462 158
326 3300031344 Ga0265316_10521279 Ga0265316_105212791 158
327 3300031595 Ga0265313_10099322 Ga0265313_100993222 158
328 3300031691 Ga0316579_10178506 Ga0316579_101785062 158
329 3300031711 Ga0265314_10005043 Ga0265314_100050437 158
330 3300031727 Ga0316576_10006767 Ga0316576_100067673 158
331 3300031727 Ga0316576_10063802 Ga0316576_100638022 158
332 3300031727 Ga0316576_10291129 Ga0316576_102911292 158
333 3300031995 Ga0307409_100293144 Ga0307409_1002931442 158
334 3300032002 Ga0307416_102573406 Ga0307416_1025734061 158
335 3300035242 Ga0373962_0045249 Ga0373962_0045249_704_1219 158
336 3300035398 Ga0316574_0232590 Ga0316574_0232590_166_681 158
337 3300035398 Ga0316574_0299783 Ga0316574_0299783_444_959 158
338 3300035691 Ga0373931_0091125 Ga0373931_0091125_1131_1646 158
339 3300035725 Ga0373947_0889637 Ga0373947_0889637_20_544 158
340 3300036401 Ga0373937_0552989 Ga0373937_0552989_111_635 158
341 3300036401 Ga0373937_0609439 Ga0373937_0609439_410_925 158
342 3300036401 Ga0373937_1463475 Ga0373937_1463475_42_557 158
343 3300036647 Ga0316582_0376227 Ga0316582_0376227_199_714 158
344 3300036712 Ga0316584_0149508 Ga0316584_0149508_1049_1564 158
345 3300037418 Ga0395900_0597086 Ga0395900_0597086_364_879 158
346 3300039437 Ga0436365_1892110 Ga0436365_1892110_395_916 158
347 3300041458 Ga0451798_0721429 Ga0451798_0721429_217_732 158
348 3300041459 Ga0451800_1338201 Ga0451800_1338201_169_684 158
349 3300041486 Ga0451807_2441806 Ga0451807_2441806_205_720 158
350 3300041997 Ga0439431_0164595 Ga0439431_0164595_51_587 158
351 3300042122 Ga0450920_042034 Ga0450920_042034_26_541 158
352 3300042435 Ga0439434_0147568 Ga0439434_0147568_225_761 158
353 3300042876 Ga0451577_0073393 Ga0451577_0073393_1010_1525 158
354 3300044712 Ga0453684_0670168 Ga0453684_0670168_522_1037 158
355 3300044901 Ga0466960_0550837 Ga0466960_0550837_94_609 158
356 3300046455 Ga0495603_0067777 Ga0495603_0067777_303_818 158
357 3300046511 Ga0495608_0519082 Ga0495608_0519082_44_559 158
358 3300046514 Ga0495618_0174356 Ga0495618_0174356_679_1194 158
359 3300046516 Ga0495628_0150567 Ga0495628_0150567_460_975 158
360 3300046517 Ga0495630_0753277 Ga0495630_0753277_186_701 158
361 3300046529 Ga0495652_0114201 Ga0495652_0114201_1179_1694 158
362 3300046543 Ga0495645_0120922 Ga0495645_0120922_1201_1716 158
363 3300046543 Ga0495645_0467560 Ga0495645_0467560_130_648 158
364 3300046559 Ga0495667_0194610 Ga0495667_0194610_729_1244 158
365 3300046559 Ga0495667_0359941 Ga0495667_0359941_362_877 158
366 3300046615 Ga0495656_0267422 Ga0495656_0267422_169_684 158
367 3300046642 Ga0495634_0109945 Ga0495634_0109945_396_911 158
368 3300046663 Ga0495635_0112012 Ga0495635_0112012_395_910 158
369 3300046663 Ga0495635_0225800 Ga0495635_0225800_236_751 158
370 3300046675 Ga0495657_0326311 Ga0495657_0326311_14_529 158
371 3300046678 Ga0495599_0564931 Ga0495599_0564931_89_604 158
372 3300046679 Ga0495623_0354410 Ga0495623_0354410_188_703 158
373 3300046689 Ga0495613_0107662 Ga0495613_0107662_1459_1974 158
374 3300046690 Ga0495624_0323547 Ga0495624_0323547_119_634 158
375 3300046809 Ga0495600_0049854 Ga0495600_0049854_1648_2163 158
376 3300046809 Ga0495600_0532045 Ga0495600_0532045_154_669 158
377 3300047317 Ga0495604_0386378 Ga0495604_0386378_367_882 158
378 3300047319 Ga0495674_0200446 Ga0495674_0200446_348_866 158
379 3300047321 Ga0495676_0742457 Ga0495676_0742457_71_586 158
380 3300047322 Ga0495680_0157694 Ga0495680_0157694_356_871 158
381 3300047322 Ga0495680_0481439 Ga0495680_0481439_243_758 158
382 3300047322 Ga0495680_0559687 Ga0495680_0559687_55_570 158
383 3300047471 Ga0495684_0520555 Ga0495684_0520555_26_541 158
384 3300048088 Ga0495602_0156088 Ga0495602_0156088_1020_1535 158
385 3300048088 Ga0495602_0352997 Ga0495602_0352997_501_1016 158
386 3300048088 Ga0495602_0392299 Ga0495602_0392299_180_698 158
387 3300048903 Ga0496100_0450930 Ga0496100_0450930_64_579 158
388 3300048903 Ga0496100_0590951 Ga0496100_0590951_109_624 158
389 3300048904 Ga0496101_0138260 Ga0496101_0138260_952_1467 158
390 3300048904 Ga0496101_0371630 Ga0496101_0371630_335_850 158
391 3300048905 Ga0496102_0303478 Ga0496102_0303478_94_609 158
392 3300048905 Ga0496102_0755109 Ga0496102_0755109_349_864 158
393 3300048906 Ga0496103_0123712 Ga0496103_0123712_608_1123 158
394 3300048907 Ga0496104_0010092 Ga0496104_0010092_2789_3304 158
395 3300048907 Ga0496104_0266744 Ga0496104_0266744_661_1176 158
396 3300048907 Ga0496104_0612272 Ga0496104_0612272_440_955 158
397 3300048908 Ga0496105_0069664 Ga0496105_0069664_910_1425 158
398 3300048908 Ga0496105_0329231 Ga0496105_0329231_608_1123 158
399 3300048909 Ga0496106_0018325 Ga0496106_0018325_2197_2712 158
400 3300048910 Ga0496107_0070608 Ga0496107_0070608_608_1123 158
401 3300048911 Ga0496108_0021332 Ga0496108_0021332_1529_2044 158
402 3300048912 Ga0496109_0039455 Ga0496109_0039455_742_1257 158
403 3300048912 Ga0496109_0093881 Ga0496109_0093881_1836_2351 158
404 3300048912 Ga0496109_0826003 Ga0496109_0826003_318_833 158
405 3300048912 Ga0496109_1209384 Ga0496109_1209384_89_604 158
406 3300048913 Ga0496110_0021157 Ga0496110_0021157_3340_3855 158
407 3300048913 Ga0496110_0144768 Ga0496110_0144768_1538_2053 158
408 3300048914 Ga0496111_0010849 Ga0496111_0010849_2700_3215 158
409 3300048915 Ga0496112_0028837 Ga0496112_0028837_1146_1661 158
410 3300048915 Ga0496112_0162125 Ga0496112_0162125_300_815 158
411 3300048916 Ga0496113_0109793 Ga0496113_0109793_576_1091 158
412 3300048916 Ga0496113_0321025 Ga0496113_0321025_378_893 158
413 3300048917 Ga0496114_0382250 Ga0496114_0382250_109_624 158
414 3300049568 Ga0501031_0310564 Ga0501031_0310564_479_994 158
415 3300049570 Ga0501033_0116115 Ga0501033_0116115_1056_1556 158
416 3300049570 Ga0501033_0484781 Ga0501033_0484781_152_667 158
417 3300049574 Ga0501038_0238179 Ga0501038_0238179_157_672 158
418 3300049574 Ga0501038_0337119 Ga0501038_0337119_591_1085 158
419 3300049574 Ga0501038_0859112 Ga0501038_0859112_103_618 158
420 3300049575 Ga0501039_0259075 Ga0501039_0259075_164_679 158
421 3300049576 Ga0501040_0053774 Ga0501040_0053774_1416_1931 158
422 3300049576 Ga0501040_0060794 Ga0501040_0060794_1043_1543 158
423 3300049576 Ga0501040_0060938 Ga0501040_0060938_1760_2275 158
424 3300049576 Ga0501040_0805615 Ga0501040_0805615_84_599 158
425 3300049577 Ga0501041_0203498 Ga0501041_0203498_502_1023 158
426 3300049578 Ga0501042_0058122 Ga0501042_0058122_1525_2025 158
427 3300049578 Ga0501042_1259950 Ga0501042_1259950_10_525 158
428 3300049579 Ga0501043_1009450 Ga0501043_1009450_26_541 158
429 3300049580 Ga0501046_0236087 Ga0501046_0236087_66_560 158
430 3300049580 Ga0501046_0509348 Ga0501046_0509348_290_805 158
431 3300049582 Ga0501048_0188789 Ga0501048_0188789_885_1400 158
432 3300049582 Ga0501048_0681238 Ga0501048_0681238_200_715 158
433 3300049584 Ga0501068_0150228 Ga0501068_0150228_486_1007 158
434 3300049584 Ga0501068_0153353 Ga0501068_0153353_153_668 158
435 3300049584 Ga0501068_0237071 Ga0501068_0237071_119_613 158
436 3300049585 Ga0501069_0456632 Ga0501069_0456632_220_714 158
437 3300049586 Ga0501070_0212464 Ga0501070_0212464_124_624 158
438 3300049587 Ga0501071_0014751 Ga0501071_0014751_4136_4636 158
439 3300049587 Ga0501071_0089567 Ga0501071_0089567_300_815 158
440 3300049587 Ga0501071_0143511 Ga0501071_0143511_1219_1734 158
441 3300049588 Ga0501072_0027548 Ga0501072_0027548_305_820 158
442 3300049590 Ga0501074_0296881 Ga0501074_0296881_97_597 158
443 3300049591 Ga0501075_0019229 Ga0501075_0019229_2456_2971 158
444 3300049591 Ga0501075_0060950 Ga0501075_0060950_1148_1663 158
445 3300049591 Ga0501075_0101364 Ga0501075_0101364_41_556 158
446 3300049591 Ga0501075_0160944 Ga0501075_0160944_90_626 158
447 3300049592 Ga0501076_0053283 Ga0501076_0053283_1417_1917 158
448 3300049592 Ga0501076_0677788 Ga0501076_0677788_105_641 158
449 3300049593 Ga0501077_0152408 Ga0501077_0152408_296_811 158
450 3300049593 Ga0501077_0287525 Ga0501077_0287525_370_885 158
451 3300049741 Ga0501079_0007714 Ga0501079_0007714_4893_5393 158
452 3300049741 Ga0501079_0085876 Ga0501079_0085876_833_1348 158
453 3300049741 Ga0501079_0497332 Ga0501079_0497332_433_927 158
454 3300049741 Ga0501079_1008899 Ga0501079_1008899_116_631 158
455 3300049742 Ga0501080_0147760 Ga0501080_0147760_232_747 158
456 3300049742 Ga0501080_0267728 Ga0501080_0267728_21_515 158
457 3300049743 Ga0501081_0185179 Ga0501081_0185179_537_1052 158
458 3300049743 Ga0501081_0981348 Ga0501081_0981348_29_544 158
459 3300049744 Ga0501083_0172922 Ga0501083_0172922_237_752 158
460 3300049744 Ga0501083_0317130 Ga0501083_0317130_441_956 158
461 3300049822 Ga0501035_0261509 Ga0501035_0261509_575_1075 158
462 3300049824 Ga0501045_0028291 Ga0501045_0028291_3349_3864 158
463 3300049824 Ga0501045_0058851 Ga0501045_0058851_1082_1582 158
464 3300049824 Ga0501045_0267916 Ga0501045_0267916_349_864 158
465 3300050507 nmdc:mga05p37_761_c1 nmdc:mga05p37_761_c1_29211_29726 158
466 3300050507 nmdc:mga05p37_79764_c1 nmdc:mga05p37_79764_c1_1428_1943 158
467 3300050507 nmdc:mga05p37_956433_c1 nmdc:mga05p37_956433_c1_36_551 158
468 3300050511 nmdc:mga08y16_104183_c1 nmdc:mga08y16_104183_c1_779_1294 158
469 3300050511 nmdc:mga08y16_31934_c1 nmdc:mga08y16_31934_c1_703_1218 158
470 3300050512 nmdc:mga0n895_1108409_c1 nmdc:mga0n895_1108409_c1_154_669 158
471 3300050512 nmdc:mga0n895_49530_c1 nmdc:mga0n895_49530_c1_2449_2943 158
472 3300050515 nmdc:mga0a205_117194_c1 nmdc:mga0a205_117194_c1_1882_2397 158
473 3300050515 nmdc:mga0a205_443801_c1 nmdc:mga0a205_443801_c1_587_1102 158
474 3300050515 nmdc:mga0a205_793944_c1 nmdc:mga0a205_793944_c1_160_654 158
475 3300053077 Ga0495601_0041855 Ga0495601_0041855_442_957 158
476 3300053084 Ga0495595_0074724 Ga0495595_0074724_125_640 158
477 3300053084 Ga0495595_0137377 Ga0495595_0137377_279_794 158
478 3300053085 Ga0495619_0032651 Ga0495619_0032651_2566_3081 158
479 3300053085 Ga0495619_0106210 Ga0495619_0106210_49_564 158
480 3300053085 Ga0495619_0164215 Ga0495619_0164215_269_784 158
481 3300054114 Ga0501084_0107879 Ga0501084_0107879_201_725 158
482 3300054114 Ga0501084_0109455 Ga0501084_0109455_937_1458 158
483 3300054114 Ga0501084_0160113 Ga0501084_0160113_625_1140 158
484 3300054114 Ga0501084_0356489 Ga0501084_0356489_253_768 158
485 3300060353 Ga0501082_0026145 Ga0501082_0026145_919_1434 158
486 3300060353 Ga0501082_0099161 Ga0501082_0099161_864_1364 158
487 3300060353 Ga0501082_0322896 Ga0501082_0322896_358_873 158
488 3300060353 Ga0501082_0634753 Ga0501082_0634753_380_898 158
489 3300061734 Ga0530510_0000976 Ga0530510_0000976_12210_12725 158
490 3300061734 Ga0530510_0194547 Ga0530510_0194547_432_956 158
491 3300061734 Ga0530510_0608436 Ga0530510_0608436_40_555 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

29

175

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l87-assembly1.cif.gz_A the crystal structure of smu.143c from streptococcus mutans ua159 0.7824 51 142
3cmd-assembly1.cif.gz_A crystal structure of peptide deformylase from vre-e.faecium 0.7636 53 142
3g6n-assembly2.cif.gz_B crystal structure of an efpdf complex with met-ala-ser 0.7628 53 142
1lm6-assembly1.cif.gz_A crystal structure of peptide deformylase from streptococcus pneumoniae 0.7566 58 150
3qu1-assembly1.cif.gz_B peptide deformylase from vibrio cholerae 0.6612 19 142
ID Description Score Start End Superfamily
af_Q4D3X8_38_196_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8286 53 140 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.6611 17 138 3.90.45.10
3u04A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.6582 18 142 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.648 17 145 3.90.45.10
2defA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.6444 23 138 3.90.45.10
ID Description Score Start End GO Terms
AF-X1VDT5-F1-model_v4 Peptide deformylase 0.9103 63 136 GO:0042586
GO:0043686
AF-A0A6J6SMB3-F1-model_v4 Unannotated protein 0.9075 65 142 GO:0042586
GO:0043686
AF-A0A355HBC0-F1-model_v4 Peptide deformylase 0.8987 61 137 GO:0042586
GO:0043686
AF-A0A7C5D9T4-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.8943 63 138 GO:0042586
GO:0043686
AF-X1VED6-F1-model_v4 Peptide deformylase 0.894 59 136 GO:0042586
GO:0043686

Feature Viewer

pLDDT pTM Quality
77.18 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map