F454001

General Info

Members Datasets Scaffolds Average Seq Length
490 220 980 340

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0080480|Ga0496105_0080480_1515_2600
Length 361
Sequence MCADGSLPDTGGFVQTSVTTIERFILDQEERYPEATGELSNLLYDIALAAKIIAAAIRRAGLVNILGTQGARNVQGEEQQKLDVLANETLKNCLKHTGRVCAMGSEEDEDIIPVPPEYPIGKYAVLFDPLDGSSNIDVNSAVGTIFSIHRRRSLEGRGTKADVLQPGCQQVAAGYVMYGSSTMLVYTTGQGVHGFTLDPTIGEFLLSHERIITPRVGQYYSVNESNFPRWDRAVQVAVRGLKGDIADGMKPKNSRYIGSLVADFHRNLISGGVFLYPADTKNTGGKLRLLYEASPMAFIAEQAEGSATDGTNRILDIVPTDLHQRTPLVIGSREDVGFVADMIRKVSMSSRVSGAVSQPAL

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
206 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.35
Rhizosphere 92.45
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0080480 3300048908 Bacteria 2691
2 Ga0065712_10089732 3300005290 Bacteria 2456
3 Ga0065715_10149782 3300005293 Bacteria 1743
4 Ga0070676_10028621 3300005328 Unclassified 3165
5 Ga0070683_100003698 3300005329 Bacteria 12482
6 Ga0070683_100058831 3300005329 Bacteria 3570
7 Ga0068869_100261197 3300005334 Bacteria 1386
8 Ga0070680_100004716 3300005336 Bacteria 10258
9 Ga0070680_100011266 3300005336 Bacteria 6915
10 Ga0070680_100015869 3300005336 Bacteria 5913
11 Ga0070691_10028528 3300005341 Bacteria 2608
12 Ga0070661_100323625 3300005344 Bacteria 1205
13 Ga0070692_10004983 3300005345 Bacteria 5611
14 Ga0070668_100013493 3300005347 Bacteria 6098
15 Ga0070675_100216434 3300005354 Bacteria 1667
16 Ga0070675_100319807 3300005354 Bacteria 1371
17 Ga0070671_100013604 3300005355 Bacteria 6561
18 Ga0070674_100049569 3300005356 Bacteria 2887
19 Ga0070673_100046855 3300005364 Bacteria 3360
20 Ga0070659_100128800 3300005366 Bacteria 2054
21 Ga0070667_100074654 3300005367 Bacteria 2893
22 Ga0070667_100301753 3300005367 Bacteria 1442
23 Ga0070703_10000872 3300005406 Bacteria 9725
24 Ga0070709_10011419 3300005434 Bacteria 4950
25 Ga0070709_10026690 3300005434 Bacteria 3426
26 Ga0070701_10007246 3300005438 Bacteria 4723
27 Ga0070711_100000212 3300005439 Bacteria 30680
28 Ga0070711_100001482 3300005439 Bacteria 12864
29 Ga0070711_100170412 3300005439 Bacteria 1659
30 Ga0070705_100004515 3300005440 Bacteria 6778
31 Ga0070705_100007150 3300005440 Bacteria 5494
32 Ga0070705_100007197 3300005440 Bacteria 5474
33 Ga0070705_100033185 3300005440 Bacteria 2875
34 Ga0070705_100053562 3300005440 Bacteria 2362
35 Ga0070705_100105200 3300005440 Bacteria 1791
36 Ga0070705_100118198 3300005440 Bacteria 1707
37 Ga0070700_100195338 3300005441 Bacteria 1418
38 Ga0070694_100003358 3300005444 Bacteria 9585
39 Ga0070694_100003672 3300005444 Bacteria 9152
40 Ga0070694_100035689 3300005444 Bacteria 3289
41 Ga0070694_100083126 3300005444 Bacteria 2231
42 Ga0070708_100000025 3300005445 Bacteria 98091
43 Ga0070708_100006097 3300005445 Bacteria 9592
44 Ga0070708_100010208 3300005445 Bacteria 7602
45 Ga0070708_100015262 3300005445 Bacteria 6338
46 Ga0070708_100032729 3300005445 Bacteria 4512
47 Ga0070708_100053091 3300005445 Bacteria 3595
48 Ga0070708_100211195 3300005445 Bacteria 1818
49 Ga0070678_100045095 3300005456 Unclassified 3152
50 Ga0070681_10041592 3300005458 Bacteria 4607
51 Ga0070681_10096694 3300005458 Bacteria 2901
52 Ga0070681_10176095 3300005458 Bacteria 2061
53 Ga0068867_100079962 3300005459 Bacteria 2461
54 Ga0068867_100267076 3300005459 Bacteria 1397
55 Ga0070706_100013084 3300005467 Bacteria 7679
56 Ga0070706_100019176 3300005467 Bacteria 6311
57 Ga0070706_100054655 3300005467 Bacteria 3685
58 Ga0070706_100125456 3300005467 Bacteria 2394
59 Ga0070707_100020014 3300005468 Bacteria 6310
60 Ga0070707_100106354 3300005468 Bacteria 2721
61 Ga0070707_100239872 3300005468 Bacteria 1764
62 Ga0070707_100266317 3300005468 Bacteria 1666
63 Ga0070707_100375663 3300005468 Bacteria 1381
64 Ga0070698_100023273 3300005471 Bacteria 6477
65 Ga0070698_100054552 3300005471 Bacteria 4057
66 Ga0070698_100059801 3300005471 Bacteria 3847
67 Ga0070698_100079251 3300005471 Bacteria 3282
68 Ga0070698_100168214 3300005471 Bacteria 2134
69 Ga0070698_100224215 3300005471 Bacteria 1813
70 Ga0070699_100002752 3300005518 Bacteria 15676
71 Ga0070699_100011054 3300005518 Bacteria 7806
72 Ga0070699_100013177 3300005518 Bacteria 7130
73 Ga0070699_100038138 3300005518 Bacteria 4161
74 Ga0070679_100058707 3300005530 Bacteria 3834
75 Ga0070697_100008446 3300005536 Bacteria 8035
76 Ga0070697_100146346 3300005536 Bacteria 1989
77 Ga0070672_100044135 3300005543 Bacteria 3441
78 Ga0070686_100071936 3300005544 Bacteria 2266
79 Ga0070695_100008943 3300005545 Bacteria 5949
80 Ga0070695_100020171 3300005545 Bacteria 4068
81 Ga0070695_100029247 3300005545 Bacteria 3422
82 Ga0070695_100040664 3300005545 Bacteria 2944
83 Ga0070695_100075869 3300005545 Bacteria 2213
84 Ga0070696_100013106 3300005546 Bacteria 5561
85 Ga0070696_100088672 3300005546 Bacteria 2199
86 Ga0070696_100123943 3300005546 Bacteria 1873
87 Ga0070696_100147080 3300005546 Bacteria 1727
88 Ga0070704_100004619 3300005549 Bacteria 7966
89 Ga0070704_100007953 3300005549 Bacteria 6329
90 Ga0070704_100017713 3300005549 Bacteria 4538
91 Ga0070704_100029301 3300005549 Bacteria 3673
92 Ga0070704_100033589 3300005549 Bacteria 3470
93 Ga0070704_100041926 3300005549 Bacteria 3163
94 Ga0070704_100063391 3300005549 Bacteria 2653
95 Ga0070664_100009932 3300005564 Bacteria 7715
96 Ga0070664_100045567 3300005564 Bacteria 3704
97 Ga0070664_100131455 3300005564 Bacteria 2199
98 Ga0068857_100042365 3300005577 Bacteria 4038
99 Ga0070702_100128929 3300005615 Bacteria 1595
100 Ga0068852_100368949 3300005616 Unclassified 1406
101 Ga0068859_100174862 3300005617 Bacteria 2229
102 Ga0068859_100197135 3300005617 Bacteria 2098
103 Ga0068864_100113583 3300005618 Bacteria 2414
104 Ga0068861_100034853 3300005719 Bacteria 3724
105 Ga0068870_10063811 3300005840 Bacteria 1988
106 Ga0068863_100031655 3300005841 Bacteria 5047
107 Ga0068863_100206606 3300005841 Bacteria 1890
108 Ga0068858_100290717 3300005842 Bacteria 1558
109 Ga0081455_10227238 3300005937 Bacteria 1380
110 Ga0068871_100064027 3300006358 Bacteria 3009
111 Ga0075428_100006971 3300006844 Bacteria 12535
112 Ga0075428_100020261 3300006844 Bacteria 7366
113 Ga0075428_100032461 3300006844 Bacteria 5767
114 Ga0075428_100156379 3300006844 Bacteria 2477
115 Ga0075430_100033592 3300006846 Bacteria 4353
116 Ga0075430_100143032 3300006846 Bacteria 1992
117 Ga0075430_100295844 3300006846 Bacteria 1339
118 Ga0075431_100020345 3300006847 Bacteria 6779
119 Ga0075431_100035955 3300006847 Bacteria 5101
120 Ga0075431_100226267 3300006847 Bacteria 1907
121 Ga0075433_10000214 3300006852 Bacteria 32840
122 Ga0075433_10013817 3300006852 Bacteria 6581
123 Ga0075433_10030842 3300006852 Bacteria 4577
124 Ga0075433_10037900 3300006852 Bacteria 4160
125 Ga0075433_10274478 3300006852 Bacteria 1494
126 Ga0075434_100068777 3300006871 Bacteria 3529
127 Ga0075434_100184974 3300006871 Bacteria 2104
128 Ga0075434_100205747 3300006871 Bacteria 1988
129 Ga0075434_100212436 3300006871 Bacteria 1955
130 Ga0075434_100220002 3300006871 Bacteria 1918
131 Ga0075434_100385232 3300006871 Bacteria 1423
132 Ga0075429_100008249 3300006880 Bacteria 9057
133 Ga0075429_100041989 3300006880 Bacteria 3981
134 Ga0068865_100005861 3300006881 Bacteria 7475
135 Ga0068865_100306297 3300006881 Bacteria 1273
136 Ga0075436_100011963 3300006914 Bacteria 5951
137 Ga0075436_100025603 3300006914 Bacteria 4060
138 Ga0075436_100034625 3300006914 Bacteria 3483
139 Ga0075436_100054419 3300006914 Bacteria 2762
140 Ga0075436_100056183 3300006914 Bacteria 2719
141 Ga0075436_100062392 3300006914 Bacteria 2575
142 Ga0097620_100174850 3300006931 Bacteria 2229
143 Ga0097620_100197150 3300006931 Bacteria 2098
144 Ga0075435_100014636 3300007076 Bacteria 5874
145 Ga0075435_100032541 3300007076 Bacteria 4119
146 Ga0075435_100053448 3300007076 Bacteria 3258
147 Ga0075435_100064706 3300007076 Bacteria 2972
148 Ga0099794_10000059 3300007265 Bacteria 42270
149 Ga0111539_10031569 3300009094 Bacteria 6434
150 Ga0111539_10354376 3300009094 Bacteria 1708
151 Ga0105245_10091830 3300009098 Bacteria 2795
152 Ga0105245_10265751 3300009098 Bacteria 1671
153 Ga0114129_10015211 3300009147 Bacteria 10952
154 Ga0114129_10016986 3300009147 Bacteria 10360
155 Ga0114129_10017790 3300009147 Bacteria 10121
156 Ga0114129_10121407 3300009147 Bacteria 3595
157 Ga0114129_10124015 3300009147 Bacteria 3553
158 Ga0114129_10352272 3300009147 Bacteria 1950
159 Ga0114129_10551302 3300009147 Bacteria 1499
160 Ga0114129_10579526 3300009147 Unclassified 1456
161 Ga0105243_10029083 3300009148 Bacteria 4248
162 Ga0105241_10057108 3300009174 Bacteria 2994
163 Ga0105248_10048413 3300009177 Bacteria 4769
164 Ga0105248_10073366 3300009177 Bacteria 3846
165 Ga0105248_10139765 3300009177 Bacteria 2732
166 Ga0105248_10411092 3300009177 Bacteria 1523
167 Ga0105248_10593998 3300009177 Bacteria 1249
168 Ga0105249_10462018 3300009553 Bacteria 1309
169 Ga0105239_10003670 3300010375 Bacteria 18744
170 Ga0105239_10501407 3300010375 Bacteria 1380
171 Ga0157378_10028115 3300013297 Bacteria 4959
172 Ga0163162_10108850 3300013306 Unclassified 2868
173 Ga0157372_10293256 3300013307 Bacteria 1892
174 Ga0163163_10055699 3300014325 Bacteria 3908
175 Ga0163163_10115011 3300014325 Bacteria 2722
176 Ga0163163_10308339 3300014325 Bacteria 1635
177 Ga0157380_10119416 3300014326 Bacteria 2230
178 Ga0157380_10609374 3300014326 Bacteria 1082
179 Ga0157379_10027073 3300014968 Bacteria 5103
180 Ga0207653_10000067 3300025885 Bacteria 79276
181 Ga0207653_10024156 3300025885 Bacteria 1939
182 Ga0207682_10030721 3300025893 Bacteria 2153
183 Ga0207642_10002119 3300025899 Bacteria 6140
184 Ga0207688_10173537 3300025901 Bacteria 1283
185 Ga0207699_10042700 3300025906 Bacteria 2629
186 Ga0207699_10079315 3300025906 Bacteria 2031
187 Ga0207645_10005646 3300025907 Bacteria 9041
188 Ga0207645_10259801 3300025907 Bacteria 1150
189 Ga0207643_10019963 3300025908 Bacteria 3675
190 Ga0207684_10006378 3300025910 Bacteria 10753
191 Ga0207684_10029727 3300025910 Bacteria 4652
192 Ga0207684_10049559 3300025910 Bacteria 3562
193 Ga0207684_10064390 3300025910 Bacteria 3112
194 Ga0207684_10283404 3300025910 Bacteria 1429
195 Ga0207654_10094095 3300025911 Bacteria 1833
196 Ga0207707_10032129 3300025912 Bacteria 4595
197 Ga0207663_10000153 3300025916 Bacteria 31913
198 Ga0207663_10066442 3300025916 Bacteria 2308
199 Ga0207663_10291615 3300025916 Bacteria 1216
200 Ga0207660_10007779 3300025917 Bacteria 6938
201 Ga0207660_10315919 3300025917 Bacteria 1246
202 Ga0207649_10280196 3300025920 Bacteria 1212
203 Ga0207652_10004666 3300025921 Bacteria 11112
204 Ga0207652_10157453 3300025921 Bacteria 2035
205 Ga0207646_10003133 3300025922 Bacteria 18961
206 Ga0207646_10003920 3300025922 Bacteria 16523
207 Ga0207646_10030856 3300025922 Bacteria 4856
208 Ga0207646_10069410 3300025922 Bacteria 3147
209 Ga0207646_10082509 3300025922 Bacteria 2875
210 Ga0207646_10106641 3300025922 Bacteria 2513
211 Ga0207646_10118450 3300025922 Bacteria 2379
212 Ga0207646_10258915 3300025922 Bacteria 1572
213 Ga0207646_10328737 3300025922 Bacteria 1381
214 Ga0207687_10058525 3300025927 Bacteria 2711
215 Ga0207700_10045637 3300025928 Bacteria 3235
216 Ga0207644_10008888 3300025931 Bacteria 6581
217 Ga0207690_10297174 3300025932 Bacteria 1262
218 Ga0207686_10000415 3300025934 Bacteria 29150
219 Ga0207709_10005433 3300025935 Bacteria 7242
220 Ga0207669_10012067 3300025937 Bacteria 4234
221 Ga0207669_10025762 3300025937 Bacteria 3185
222 Ga0207665_10038230 3300025939 Bacteria 3195
223 Ga0207665_10046748 3300025939 Bacteria 2900
224 Ga0207691_10032474 3300025940 Bacteria 4866
225 Ga0207691_10078314 3300025940 Bacteria 2976
226 Ga0207711_10021554 3300025941 Bacteria 5383
227 Ga0207711_10081657 3300025941 Unclassified 2825
228 Ga0207711_10254867 3300025941 Bacteria 1612
229 Ga0207711_10288645 3300025941 Bacteria 1512
230 Ga0207689_10263745 3300025942 Bacteria 1425
231 Ga0207661_10025218 3300025944 Bacteria 4518
232 Ga0207661_10294754 3300025944 Bacteria 1453
233 Ga0207679_10019832 3300025945 Bacteria 4527
234 Ga0207679_10031396 3300025945 Bacteria 3718
235 Ga0207679_10363442 3300025945 Bacteria 1265
236 Ga0207651_10028788 3300025960 Bacteria 3510
237 Ga0207651_10327285 3300025960 Bacteria 1283
238 Ga0207712_10151081 3300025961 Bacteria 1794
239 Ga0207712_10327412 3300025961 Bacteria 1266
240 Ga0207668_10008332 3300025972 Bacteria 6172
241 Ga0207658_10102080 3300025986 Bacteria 2249
242 Ga0207703_10157466 3300026035 Bacteria 1986
243 Ga0207678_10243841 3300026067 Bacteria 1539
244 Ga0207708_10013839 3300026075 Bacteria 6029
245 Ga0207708_10065202 3300026075 Bacteria 2783
246 Ga0207708_10200719 3300026075 Bacteria 1591
247 Ga0207641_10186964 3300026088 Bacteria 1901
248 Ga0207648_10065753 3300026089 Bacteria 3161
249 Ga0207648_10072479 3300026089 Bacteria 3002
250 Ga0207676_10059445 3300026095 Bacteria 3018
251 Ga0207676_10092688 3300026095 Bacteria 2485
252 Ga0207674_10053779 3300026116 Bacteria 4102
253 Ga0207674_10317455 3300026116 Bacteria 1507
254 Ga0207675_100064963 3300026118 Bacteria 3411
255 Ga0207683_10002770 3300026121 Bacteria 15319
256 Ga0207698_10347899 3300026142 Bacteria 1399
257 Ga0209588_1001813 3300027671 Bacteria 5682
258 Ga0209588_1015581 3300027671 Bacteria 2339
259 Ga0209974_10021849 3300027876 Bacteria 2119
260 Ga0268264_10065054 3300028381 Unclassified 3071
261 Ga0307408_100126752 3300031548 Bacteria 1986
262 Ga0307408_100150875 3300031548 Bacteria 1834
263 Ga0316578_10082058 3300031728 Bacteria 1919
264 Ga0307405_10008688 3300031731 Bacteria 5161
265 Ga0307405_10319670 3300031731 Bacteria 1185
266 Ga0307413_10002193 3300031824 Bacteria 7855
267 Ga0307413_10027642 3300031824 Bacteria 3146
268 Ga0307413_10155582 3300031824 Bacteria 1599
269 Ga0307413_10210607 3300031824 Bacteria 1411
270 Ga0307413_10358498 3300031824 Bacteria 1128
271 Ga0307410_10000656 3300031852 Bacteria 14282
272 Ga0307410_10001510 3300031852 Bacteria 10569
273 Ga0307410_10011227 3300031852 Bacteria 5112
274 Ga0307410_10023753 3300031852 Bacteria 3818
275 Ga0307410_10025138 3300031852 Bacteria 3731
276 Ga0307410_10049624 3300031852 Bacteria 2818
277 Ga0307410_10060111 3300031852 Bacteria 2596
278 Ga0307410_10063037 3300031852 Bacteria 2542
279 Ga0307410_10080484 3300031852 Bacteria 2285
280 Ga0307406_10005395 3300031901 Bacteria 6999
281 Ga0307406_10015551 3300031901 Bacteria 4406
282 Ga0307406_10088551 3300031901 Bacteria 2077
283 Ga0307407_10020840 3300031903 Bacteria 3367
284 Ga0307407_10030778 3300031903 Bacteria 2899
285 Ga0307412_10066960 3300031911 Bacteria 2436
286 Ga0307409_100000984 3300031995 Bacteria 13323
287 Ga0307409_100023628 3300031995 Bacteria 4266
288 Ga0307409_100027431 3300031995 Bacteria 4036
289 Ga0307409_100050160 3300031995 Bacteria 3186
290 Ga0307409_100071622 3300031995 Bacteria 2757
291 Ga0307409_100196979 3300031995 Bacteria 1799
292 Ga0307409_100318030 3300031995 Bacteria 1455
293 Ga0307409_100489343 3300031995 Bacteria 1195
294 Ga0307416_100000890 3300032002 Bacteria 15771
295 Ga0307416_100047658 3300032002 Bacteria 3393
296 Ga0307416_100086411 3300032002 Bacteria 2674
297 Ga0307416_100183788 3300032002 Bacteria 1962
298 Ga0307416_100202198 3300032002 Bacteria 1886
299 Ga0307416_100257434 3300032002 Bacteria 1703
300 Ga0307416_100292529 3300032002 Bacteria 1613
301 Ga0307414_10008710 3300032004 Bacteria 5780
302 Ga0307414_10181929 3300032004 Bacteria 1691
303 Ga0307414_10255339 3300032004 Bacteria 1459
304 Ga0307414_10394193 3300032004 Bacteria 1201
305 Ga0307411_10000908 3300032005 Bacteria 11240
306 Ga0307411_10005469 3300032005 Bacteria 6245
307 Ga0307411_10013136 3300032005 Bacteria 4554
308 Ga0307411_10013821 3300032005 Bacteria 4471
309 Ga0307411_10019702 3300032005 Bacteria 3904
310 Ga0307411_10274525 3300032005 Bacteria 1338
311 Ga0307415_100000703 3300032126 Bacteria 14900
312 Ga0307415_100010808 3300032126 Bacteria 5187
313 Ga0307415_100015526 3300032126 Bacteria 4512
314 Ga0307415_100049674 3300032126 Bacteria 2838
315 Ga0373940_0004009 3300035088 Bacteria 3074
316 Ga0395898_0321610 3300037466 Bacteria 1476
317 Ga0395905_0159143 3300037471 Bacteria 2123
318 Ga0242420_012203 3300038996 Bacteria 1451
319 Ga0439439_0001003 3300041406 Bacteria 5303
320 Ga0451839_1508706 3300041496 Bacteria 990
321 Ga0439455_0026434 3300042012 Bacteria 1417
322 Ga0451577_0011615 3300042876 Bacteria 8317
323 Ga0451577_0126601 3300042876 Bacteria 2289
324 Ga0451577_0153071 3300042876 Bacteria 2075
325 Ga0453683_0006397 3300044673 Bacteria 8084
326 Ga0453683_0039101 3300044673 Bacteria 2981
327 Ga0453683_0078935 3300044673 Bacteria 2061
328 Ga0453683_0099838 3300044673 Bacteria 1822
329 Ga0451576_0004763 3300045051 Bacteria 17412
330 Ga0451576_0006273 3300045051 Bacteria 14631
331 Ga0451576_0009533 3300045051 Bacteria 11249
332 Ga0451576_0115333 3300045051 Bacteria 2797
333 Ga0451576_0197310 3300045051 Bacteria 2102
334 Ga0495603_0026039 3300046455 Bacteria 3536
335 Ga0495603_0026951 3300046455 Bacteria 3470
336 Ga0495582_0058792 3300046473 Bacteria 2120
337 Ga0495639_0025499 3300046475 Bacteria 2608
338 Ga0495664_0034774 3300046477 Bacteria 2965
339 Ga0495594_0025073 3300046499 Bacteria 3205
340 Ga0495618_0190675 3300046514 Bacteria 1300
341 Ga0495628_0029175 3300046516 Bacteria 4476
342 Ga0495630_0072034 3300046517 Bacteria 2601
343 Ga0495666_0011305 3300046526 Bacteria 4451
344 Ga0495665_0066924 3300046531 Bacteria 1895
345 Ga0495640_0040301 3300046533 Bacteria 3271
346 Ga0495586_0019898 3300046535 Bacteria 3575
347 Ga0495621_0020491 3300046539 Bacteria 2171
348 Ga0495621_0061830 3300046539 Bacteria 1361
349 Ga0495634_0028901 3300046642 Bacteria 3843
350 Ga0495658_0019775 3300046683 Bacteria 3520
351 Ga0495613_0009570 3300046689 Bacteria 7199
352 Ga0495680_0001042 3300047322 Bacteria 30684
353 Ga0495684_0032663 3300047471 Bacteria 3997
354 Ga0496101_0007417 3300048904 Bacteria 7108
355 Ga0496101_0057826 3300048904 Bacteria 2806
356 Ga0496102_0008245 3300048905 Bacteria 8922
357 Ga0496102_0072154 3300048905 Bacteria 3172
358 Ga0496103_0096856 3300048906 Bacteria 1865
359 Ga0496103_0231123 3300048906 Bacteria 1190
360 Ga0496104_0008995 3300048907 Bacteria 8882
361 Ga0496104_0104435 3300048907 Bacteria 2715
362 Ga0496105_0020605 3300048908 Bacteria 5330
363 Ga0496106_0016131 3300048909 Bacteria 5525
364 Ga0496106_0043730 3300048909 Unclassified 3361
365 Ga0496106_0045644 3300048909 Bacteria 3292
366 Ga0496107_0122510 3300048910 Bacteria 1916
367 Ga0496108_0005399 3300048911 Bacteria 10331
368 Ga0496108_0033767 3300048911 Bacteria 4249
369 Ga0496108_0129417 3300048911 Bacteria 2169
370 Ga0496109_0001525 3300048912 Bacteria 19271
371 Ga0496109_0004817 3300048912 Bacteria 11263
372 Ga0496109_0015911 3300048912 Bacteria 6569
373 Ga0496109_0157078 3300048912 Bacteria 2130
374 Ga0496110_0017389 3300048913 Bacteria 6015
375 Ga0496110_0092145 3300048913 Bacteria 2711
376 Ga0496110_0427470 3300048913 Bacteria 1207
377 Ga0496111_0012224 3300048914 Bacteria 5807
378 Ga0496111_0015522 3300048914 Bacteria 5231
379 Ga0496112_0003643 3300048915 Bacteria 12831
380 Ga0496112_0014230 3300048915 Bacteria 7372
381 Ga0496112_0039980 3300048915 Bacteria 4584
382 Ga0496112_0310644 3300048915 Bacteria 1521
383 Ga0496113_0001518 3300048916 Bacteria 12994
384 Ga0496113_0017558 3300048916 Bacteria 4969
385 Ga0496113_0024811 3300048916 Bacteria 4267
386 Ga0496114_0129613 3300048917 Bacteria 2177
387 Ga0496114_0192198 3300048917 Bacteria 1786
388 Ga0496115_0025886 3300048918 Bacteria 4572
389 Ga0501298_004884 3300049521 Bacteria 2134
390 Ga0501031_0246787 3300049568 Bacteria 1160
391 Ga0501034_0000797 3300049571 Bacteria 46917
392 Ga0501034_0009873 3300049571 Bacteria 9979
393 Ga0501036_0064115 3300049572 Bacteria 3110
394 Ga0501036_0249103 3300049572 Bacteria 1489
395 Ga0501037_0151415 3300049573 Bacteria 1658
396 Ga0501040_0090880 3300049576 Bacteria 2122
397 Ga0501041_0067657 3300049577 Bacteria 2189
398 Ga0501041_0129096 3300049577 Bacteria 1574
399 Ga0501042_0113408 3300049578 Bacteria 1952
400 Ga0501046_0053169 3300049580 Bacteria 3190
401 Ga0501048_0039570 3300049582 Bacteria 3382
402 Ga0501067_0000557 3300049583 Bacteria 20188
403 Ga0501067_0010625 3300049583 Bacteria 5094
404 Ga0501067_0025913 3300049583 Bacteria 3249
405 Ga0501067_0205544 3300049583 Bacteria 1097
406 Ga0501068_0002674 3300049584 Bacteria 9440
407 Ga0501068_0003506 3300049584 Bacteria 8470
408 Ga0501069_0000189 3300049585 Bacteria 27235
409 Ga0501069_0009533 3300049585 Bacteria 5124
410 Ga0501069_0027027 3300049585 Bacteria 3145
411 Ga0501070_0000897 3300049586 Bacteria 27107
412 Ga0501070_0077439 3300049586 Bacteria 2752
413 Ga0501070_0262629 3300049586 Bacteria 1411
414 Ga0501071_0000072 3300049587 Bacteria 35900
415 Ga0501071_0001951 3300049587 Bacteria 12296
416 Ga0501071_0017735 3300049587 Bacteria 4916
417 Ga0501072_0000727 3300049588 Bacteria 23987
418 Ga0501072_0001815 3300049588 Bacteria 15899
419 Ga0501073_0018989 3300049589 Bacteria 4966
420 Ga0501073_0068018 3300049589 Bacteria 2483
421 Ga0501074_0000155 3300049590 Bacteria 35855
422 Ga0501074_0001153 3300049590 Bacteria 17283
423 Ga0501074_0157622 3300049590 Bacteria 1621
424 Ga0501075_0046757 3300049591 Bacteria 3251
425 Ga0501075_0143101 3300049591 Bacteria 1823
426 Ga0501076_0006454 3300049592 Bacteria 8512
427 Ga0501076_0012319 3300049592 Bacteria 6396
428 Ga0501076_0088852 3300049592 Bacteria 2484
429 Ga0501076_0164188 3300049592 Bacteria 1810
430 Ga0501077_0002583 3300049593 Bacteria 10860
431 Ga0501077_0026681 3300049593 Bacteria 3667
432 Ga0501216_001447 3300049660 Bacteria 3203
433 Ga0501235_016868 3300049669 Bacteria 1615
434 Ga0501249_001580 3300049679 Bacteria 4669
435 Ga0501079_0006848 3300049741 Bacteria 8583
436 Ga0501079_0009345 3300049741 Bacteria 7431
437 Ga0501079_0054975 3300049741 Bacteria 3071
438 Ga0501079_0114692 3300049741 Bacteria 2094
439 Ga0501080_0000657 3300049742 Bacteria 27465
440 Ga0501080_0012551 3300049742 Bacteria 7768
441 Ga0501080_0047526 3300049742 Bacteria 3995
442 Ga0501081_0042086 3300049743 Bacteria 3130
443 Ga0501081_0087620 3300049743 Bacteria 2187
444 Ga0501083_0004023 3300049744 Bacteria 10332
445 Ga0501083_0037401 3300049744 Bacteria 3307
446 Ga0501263_000046 3300049760 Bacteria 5824
447 Ga0501273_000657 3300049770 Bacteria 2898
448 Ga0501045_0200098 3300049824 Bacteria 1488
449 Ga0501212_007335 3300049851 Bacteria 1509
450 nmdc:mga05p37_117194_c1 3300050507 Bacteria 3273
451 nmdc:mga05p37_254423_c1 3300050507 Bacteria 2105
452 nmdc:mga05p37_458528_c1 3300050507 Bacteria 1474
453 nmdc:mga05p37_9228_c1 3300050507 Bacteria 11657
454 nmdc:mga09592_28904_c1 3300050508 Bacteria 4609
455 nmdc:mga09592_32856_c1 3300050508 Bacteria 4326
456 nmdc:mga09592_7847_c1 3300050508 Bacteria 8676
457 nmdc:mga06r32_255241_c1 3300050510 Bacteria 1741
458 nmdc:mga06r32_375594_c1 3300050510 Bacteria 1404
459 nmdc:mga06r32_60845_c1 3300050510 Bacteria 3634
460 nmdc:mga06r32_8146_c1 3300050510 Bacteria 9432
461 nmdc:mga08y16_101743_c1 3300050511 Bacteria 2991
462 nmdc:mga08y16_78287_c1 3300050511 Bacteria 3446
463 nmdc:mga0n895_149902_c1 3300050512 Bacteria 2362
464 nmdc:mga0n895_20338_c1 3300050512 Bacteria 5588
465 nmdc:mga0n895_261628_c1 3300050512 Bacteria 1756
466 nmdc:mga0n895_5702_c1 3300050512 Bacteria 10442
467 nmdc:mga0n895_62439_c1 3300050512 Bacteria 3682
468 nmdc:mga0n895_7327_c1 3300050512 Bacteria 9460
469 nmdc:mga0n895_99528_c1 3300050512 Bacteria 2916
470 nmdc:mga0rr50_12136_c1 3300050513 Bacteria 5554
471 nmdc:mga0rr50_12545_c1 3300050513 Bacteria 5484
472 nmdc:mga0rr50_429878_c1 3300050513 Bacteria 1118
473 nmdc:mga0rr50_54790_c1 3300050513 Bacteria 2972
474 nmdc:mga08x19_151306_c1 3300050514 Bacteria 1572
475 nmdc:mga0a205_101818_c1 3300050515 Bacteria 2771
476 nmdc:mga0a205_14_c2 3300050515 Bacteria 99560
477 nmdc:mga0a205_183997_c1 3300050515 Bacteria 1983
478 nmdc:mga0a205_236933_c1 3300050515 Bacteria 1707
479 nmdc:mga0a205_9022_c1 3300050515 Bacteria 9090
480 Ga0501084_0000816 3300054114 Bacteria 23914
481 Ga0501084_0008937 3300054114 Bacteria 8288
482 Ga0501084_0049395 3300054114 Bacteria 3522
483 Ga0501084_0094050 3300054114 Bacteria 2517
484 Ga0590071_000089 3300059421 Bacteria 25178
485 Ga0501082_0003693 3300060353 Bacteria 13366
486 Ga0501082_0024671 3300060353 Bacteria 5183
487 Ga0501082_0084960 3300060353 Bacteria 2729
488 Ga0501082_0393630 3300060353 Bacteria 1209
489 Ga0530510_0057691 3300061734 Bacteria 2806
490 Ga0530510_0140956 3300061734 Bacteria 1776
491 Ga0496105_0080480
492 Ga0065712_10089732
493 Ga0065715_10149782
494 Ga0070676_10028621
495 Ga0070683_100003698
496 Ga0070683_100058831
497 Ga0068869_100261197
498 Ga0070680_100004716
499 Ga0070680_100011266
500 Ga0070680_100015869
501 Ga0070691_10028528
502 Ga0070661_100323625
503 Ga0070692_10004983
504 Ga0070668_100013493
505 Ga0070675_100216434
506 Ga0070675_100319807
507 Ga0070671_100013604
508 Ga0070674_100049569
509 Ga0070673_100046855
510 Ga0070659_100128800
511 Ga0070667_100074654
512 Ga0070667_100301753
513 Ga0070703_10000872
514 Ga0070709_10011419
515 Ga0070709_10026690
516 Ga0070701_10007246
517 Ga0070711_100000212
518 Ga0070711_100001482
519 Ga0070711_100170412
520 Ga0070705_100004515
521 Ga0070705_100007150
522 Ga0070705_100007197
523 Ga0070705_100033185
524 Ga0070705_100053562
525 Ga0070705_100105200
526 Ga0070705_100118198
527 Ga0070700_100195338
528 Ga0070694_100003358
529 Ga0070694_100003672
530 Ga0070694_100035689
531 Ga0070694_100083126
532 Ga0070708_100000025
533 Ga0070708_100006097
534 Ga0070708_100010208
535 Ga0070708_100015262
536 Ga0070708_100032729
537 Ga0070708_100053091
538 Ga0070708_100211195
539 Ga0070678_100045095
540 Ga0070681_10041592
541 Ga0070681_10096694
542 Ga0070681_10176095
543 Ga0068867_100079962
544 Ga0068867_100267076
545 Ga0070706_100013084
546 Ga0070706_100019176
547 Ga0070706_100054655
548 Ga0070706_100125456
549 Ga0070707_100020014
550 Ga0070707_100106354
551 Ga0070707_100239872
552 Ga0070707_100266317
553 Ga0070707_100375663
554 Ga0070698_100023273
555 Ga0070698_100054552
556 Ga0070698_100059801
557 Ga0070698_100079251
558 Ga0070698_100168214
559 Ga0070698_100224215
560 Ga0070699_100002752
561 Ga0070699_100011054
562 Ga0070699_100013177
563 Ga0070699_100038138
564 Ga0070679_100058707
565 Ga0070697_100008446
566 Ga0070697_100146346
567 Ga0070672_100044135
568 Ga0070686_100071936
569 Ga0070695_100008943
570 Ga0070695_100020171
571 Ga0070695_100029247
572 Ga0070695_100040664
573 Ga0070695_100075869
574 Ga0070696_100013106
575 Ga0070696_100088672
576 Ga0070696_100123943
577 Ga0070696_100147080
578 Ga0070704_100004619
579 Ga0070704_100007953
580 Ga0070704_100017713
581 Ga0070704_100029301
582 Ga0070704_100033589
583 Ga0070704_100041926
584 Ga0070704_100063391
585 Ga0070664_100009932
586 Ga0070664_100045567
587 Ga0070664_100131455
588 Ga0068857_100042365
589 Ga0070702_100128929
590 Ga0068852_100368949
591 Ga0068859_100174862
592 Ga0068859_100197135
593 Ga0068864_100113583
594 Ga0068861_100034853
595 Ga0068870_10063811
596 Ga0068863_100031655
597 Ga0068863_100206606
598 Ga0068858_100290717
599 Ga0081455_10227238
600 Ga0068871_100064027
601 Ga0075428_100006971
602 Ga0075428_100020261
603 Ga0075428_100032461
604 Ga0075428_100156379
605 Ga0075430_100033592
606 Ga0075430_100143032
607 Ga0075430_100295844
608 Ga0075431_100020345
609 Ga0075431_100035955
610 Ga0075431_100226267
611 Ga0075433_10000214
612 Ga0075433_10013817
613 Ga0075433_10030842
614 Ga0075433_10037900
615 Ga0075433_10274478
616 Ga0075434_100068777
617 Ga0075434_100184974
618 Ga0075434_100205747
619 Ga0075434_100212436
620 Ga0075434_100220002
621 Ga0075434_100385232
622 Ga0075429_100008249
623 Ga0075429_100041989
624 Ga0068865_100005861
625 Ga0068865_100306297
626 Ga0075436_100011963
627 Ga0075436_100025603
628 Ga0075436_100034625
629 Ga0075436_100054419
630 Ga0075436_100056183
631 Ga0075436_100062392
632 Ga0097620_100174850
633 Ga0097620_100197150
634 Ga0075435_100014636
635 Ga0075435_100032541
636 Ga0075435_100053448
637 Ga0075435_100064706
638 Ga0099794_10000059
639 Ga0111539_10031569
640 Ga0111539_10354376
641 Ga0105245_10091830
642 Ga0105245_10265751
643 Ga0114129_10015211
644 Ga0114129_10016986
645 Ga0114129_10017790
646 Ga0114129_10121407
647 Ga0114129_10124015
648 Ga0114129_10352272
649 Ga0114129_10551302
650 Ga0114129_10579526
651 Ga0105243_10029083
652 Ga0105241_10057108
653 Ga0105248_10048413
654 Ga0105248_10073366
655 Ga0105248_10139765
656 Ga0105248_10411092
657 Ga0105248_10593998
658 Ga0105249_10462018
659 Ga0105239_10003670
660 Ga0105239_10501407
661 Ga0157378_10028115
662 Ga0163162_10108850
663 Ga0157372_10293256
664 Ga0163163_10055699
665 Ga0163163_10115011
666 Ga0163163_10308339
667 Ga0157380_10119416
668 Ga0157380_10609374
669 Ga0157379_10027073
670 Ga0207653_10000067
671 Ga0207653_10024156
672 Ga0207682_10030721
673 Ga0207642_10002119
674 Ga0207688_10173537
675 Ga0207699_10042700
676 Ga0207699_10079315
677 Ga0207645_10005646
678 Ga0207645_10259801
679 Ga0207643_10019963
680 Ga0207684_10006378
681 Ga0207684_10029727
682 Ga0207684_10049559
683 Ga0207684_10064390
684 Ga0207684_10283404
685 Ga0207654_10094095
686 Ga0207707_10032129
687 Ga0207663_10000153
688 Ga0207663_10066442
689 Ga0207663_10291615
690 Ga0207660_10007779
691 Ga0207660_10315919
692 Ga0207649_10280196
693 Ga0207652_10004666
694 Ga0207652_10157453
695 Ga0207646_10003133
696 Ga0207646_10003920
697 Ga0207646_10030856
698 Ga0207646_10069410
699 Ga0207646_10082509
700 Ga0207646_10106641
701 Ga0207646_10118450
702 Ga0207646_10258915
703 Ga0207646_10328737
704 Ga0207687_10058525
705 Ga0207700_10045637
706 Ga0207644_10008888
707 Ga0207690_10297174
708 Ga0207686_10000415
709 Ga0207709_10005433
710 Ga0207669_10012067
711 Ga0207669_10025762
712 Ga0207665_10038230
713 Ga0207665_10046748
714 Ga0207691_10032474
715 Ga0207691_10078314
716 Ga0207711_10021554
717 Ga0207711_10081657
718 Ga0207711_10254867
719 Ga0207711_10288645
720 Ga0207689_10263745
721 Ga0207661_10025218
722 Ga0207661_10294754
723 Ga0207679_10019832
724 Ga0207679_10031396
725 Ga0207679_10363442
726 Ga0207651_10028788
727 Ga0207651_10327285
728 Ga0207712_10151081
729 Ga0207712_10327412
730 Ga0207668_10008332
731 Ga0207658_10102080
732 Ga0207703_10157466
733 Ga0207678_10243841
734 Ga0207708_10013839
735 Ga0207708_10065202
736 Ga0207708_10200719
737 Ga0207641_10186964
738 Ga0207648_10065753
739 Ga0207648_10072479
740 Ga0207676_10059445
741 Ga0207676_10092688
742 Ga0207674_10053779
743 Ga0207674_10317455
744 Ga0207675_100064963
745 Ga0207683_10002770
746 Ga0207698_10347899
747 Ga0209588_1001813
748 Ga0209588_1015581
749 Ga0209974_10021849
750 Ga0268264_10065054
751 Ga0307408_100126752
752 Ga0307408_100150875
753 Ga0316578_10082058
754 Ga0307405_10008688
755 Ga0307405_10319670
756 Ga0307413_10002193
757 Ga0307413_10027642
758 Ga0307413_10155582
759 Ga0307413_10210607
760 Ga0307413_10358498
761 Ga0307410_10000656
762 Ga0307410_10001510
763 Ga0307410_10011227
764 Ga0307410_10023753
765 Ga0307410_10025138
766 Ga0307410_10049624
767 Ga0307410_10060111
768 Ga0307410_10063037
769 Ga0307410_10080484
770 Ga0307406_10005395
771 Ga0307406_10015551
772 Ga0307406_10088551
773 Ga0307407_10020840
774 Ga0307407_10030778
775 Ga0307412_10066960
776 Ga0307409_100000984
777 Ga0307409_100023628
778 Ga0307409_100027431
779 Ga0307409_100050160
780 Ga0307409_100071622
781 Ga0307409_100196979
782 Ga0307409_100318030
783 Ga0307409_100489343
784 Ga0307416_100000890
785 Ga0307416_100047658
786 Ga0307416_100086411
787 Ga0307416_100183788
788 Ga0307416_100202198
789 Ga0307416_100257434
790 Ga0307416_100292529
791 Ga0307414_10008710
792 Ga0307414_10181929
793 Ga0307414_10255339
794 Ga0307414_10394193
795 Ga0307411_10000908
796 Ga0307411_10005469
797 Ga0307411_10013136
798 Ga0307411_10013821
799 Ga0307411_10019702
800 Ga0307411_10274525
801 Ga0307415_100000703
802 Ga0307415_100010808
803 Ga0307415_100015526
804 Ga0307415_100049674
805 Ga0373940_0004009
806 Ga0395898_0321610
807 Ga0395905_0159143
808 Ga0242420_012203
809 Ga0439439_0001003
810 Ga0451839_1508706
811 Ga0439455_0026434
812 Ga0451577_0011615
813 Ga0451577_0126601
814 Ga0451577_0153071
815 Ga0453683_0006397
816 Ga0453683_0039101
817 Ga0453683_0078935
818 Ga0453683_0099838
819 Ga0451576_0004763
820 Ga0451576_0006273
821 Ga0451576_0009533
822 Ga0451576_0115333
823 Ga0451576_0197310
824 Ga0495603_0026039
825 Ga0495603_0026951
826 Ga0495582_0058792
827 Ga0495639_0025499
828 Ga0495664_0034774
829 Ga0495594_0025073
830 Ga0495618_0190675
831 Ga0495628_0029175
832 Ga0495630_0072034
833 Ga0495666_0011305
834 Ga0495665_0066924
835 Ga0495640_0040301
836 Ga0495586_0019898
837 Ga0495621_0020491
838 Ga0495621_0061830
839 Ga0495634_0028901
840 Ga0495658_0019775
841 Ga0495613_0009570
842 Ga0495680_0001042
843 Ga0495684_0032663
844 Ga0496101_0007417
845 Ga0496101_0057826
846 Ga0496102_0008245
847 Ga0496102_0072154
848 Ga0496103_0096856
849 Ga0496103_0231123
850 Ga0496104_0008995
851 Ga0496104_0104435
852 Ga0496105_0020605
853 Ga0496106_0016131
854 Ga0496106_0043730
855 Ga0496106_0045644
856 Ga0496107_0122510
857 Ga0496108_0005399
858 Ga0496108_0033767
859 Ga0496108_0129417
860 Ga0496109_0001525
861 Ga0496109_0004817
862 Ga0496109_0015911
863 Ga0496109_0157078
864 Ga0496110_0017389
865 Ga0496110_0092145
866 Ga0496110_0427470
867 Ga0496111_0012224
868 Ga0496111_0015522
869 Ga0496112_0003643
870 Ga0496112_0014230
871 Ga0496112_0039980
872 Ga0496112_0310644
873 Ga0496113_0001518
874 Ga0496113_0017558
875 Ga0496113_0024811
876 Ga0496114_0129613
877 Ga0496114_0192198
878 Ga0496115_0025886
879 Ga0501298_004884
880 Ga0501031_0246787
881 Ga0501034_0000797
882 Ga0501034_0009873
883 Ga0501036_0064115
884 Ga0501036_0249103
885 Ga0501037_0151415
886 Ga0501040_0090880
887 Ga0501041_0067657
888 Ga0501041_0129096
889 Ga0501042_0113408
890 Ga0501046_0053169
891 Ga0501048_0039570
892 Ga0501067_0000557
893 Ga0501067_0010625
894 Ga0501067_0025913
895 Ga0501067_0205544
896 Ga0501068_0002674
897 Ga0501068_0003506
898 Ga0501069_0000189
899 Ga0501069_0009533
900 Ga0501069_0027027
901 Ga0501070_0000897
902 Ga0501070_0077439
903 Ga0501070_0262629
904 Ga0501071_0000072
905 Ga0501071_0001951
906 Ga0501071_0017735
907 Ga0501072_0000727
908 Ga0501072_0001815
909 Ga0501073_0018989
910 Ga0501073_0068018
911 Ga0501074_0000155
912 Ga0501074_0001153
913 Ga0501074_0157622
914 Ga0501075_0046757
915 Ga0501075_0143101
916 Ga0501076_0006454
917 Ga0501076_0012319
918 Ga0501076_0088852
919 Ga0501076_0164188
920 Ga0501077_0002583
921 Ga0501077_0026681
922 Ga0501216_001447
923 Ga0501235_016868
924 Ga0501249_001580
925 Ga0501079_0006848
926 Ga0501079_0009345
927 Ga0501079_0054975
928 Ga0501079_0114692
929 Ga0501080_0000657
930 Ga0501080_0012551
931 Ga0501080_0047526
932 Ga0501081_0042086
933 Ga0501081_0087620
934 Ga0501083_0004023
935 Ga0501083_0037401
936 Ga0501263_000046
937 Ga0501273_000657
938 Ga0501045_0200098
939 Ga0501212_007335
940 nmdc:mga05p37_117194_c1
941 nmdc:mga05p37_254423_c1
942 nmdc:mga05p37_458528_c1
943 nmdc:mga05p37_9228_c1
944 nmdc:mga09592_28904_c1
945 nmdc:mga09592_32856_c1
946 nmdc:mga09592_7847_c1
947 nmdc:mga06r32_255241_c1
948 nmdc:mga06r32_375594_c1
949 nmdc:mga06r32_60845_c1
950 nmdc:mga06r32_8146_c1
951 nmdc:mga08y16_101743_c1
952 nmdc:mga08y16_78287_c1
953 nmdc:mga0n895_149902_c1
954 nmdc:mga0n895_20338_c1
955 nmdc:mga0n895_261628_c1
956 nmdc:mga0n895_5702_c1
957 nmdc:mga0n895_62439_c1
958 nmdc:mga0n895_7327_c1
959 nmdc:mga0n895_99528_c1
960 nmdc:mga0rr50_12136_c1
961 nmdc:mga0rr50_12545_c1
962 nmdc:mga0rr50_429878_c1
963 nmdc:mga0rr50_54790_c1
964 nmdc:mga08x19_151306_c1
965 nmdc:mga0a205_101818_c1
966 nmdc:mga0a205_14_c2
967 nmdc:mga0a205_183997_c1
968 nmdc:mga0a205_236933_c1
969 nmdc:mga0a205_9022_c1
970 Ga0501084_0000816
971 Ga0501084_0008937
972 Ga0501084_0049395
973 Ga0501084_0094050
974 Ga0590071_000089
975 Ga0501082_0003693
976 Ga0501082_0024671
977 Ga0501082_0084960
978 Ga0501082_0393630
979 Ga0530510_0057691
980 Ga0530510_0140956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00316

FBPase

Fructose-1-6-bisphosphatase, N-terminal domain

19

209

0.96

PF18913

FBPase_C

Fructose-1-6-bisphosphatase, C-terminal domain

213

344

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4he0-assembly1.cif.gz_A crystal structure of human muscle fructose-1,6-bisphosphatase 0.9699 7 335
4gwy-assembly1.cif.gz_A crystal structure of amp complexes of porcine liver fructose-1,6-bisphosphatase with blocked subunit pair rotation 0.9696 9 336
5et7-assembly1.cif.gz_A-2 human muscle fructose-1,6-bisphosphatase in inactive t-state 0.9695 10 337
5l0a-assembly1.cif.gz_A human muscle fructose-1,6-bisphosphatase e69q mutant in active r-state in complex with fructose-1,6-bisphosphate 0.9693 29 335
1lev-assembly1.cif.gz_A porcine kidney fructose-1,6-bisphosphatase complexed with an amp-site inhibitor 0.969 8 336
ID Description Score Start End Superfamily
af_P0A993_1_193_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9694 11 201 3.30.540.10
af_P09201_12_210_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.963 7 201 3.30.540.10
5l0aA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9606 29 202 3.30.540.10
af_P0A993_1_193_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9546 11 201 3.30.540.10
af_Q6RYT0_1_196_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9475 5 199 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A815NCM1-F1-model_v4 D-fructose-1,6-bisphosphate 1-phosphohydrolase 0.9957 251 335 GO:0005829
GO:0005986
GO:0006000
GO:0006002
GO:0006094
GO:0030388
GO:0042132
AF-A0A383D0C6-F1-model_v4 Fructose-1-6-bisphosphatase class 1 C-terminal domain-containing protein 0.9913 249 334 GO:0005829
GO:0005986
GO:0006000
GO:0006002
GO:0006094
GO:0030388
GO:0042132
AF-A0A558FZQ9-F1-model_v4 Class 1 fructose-bisphosphatase 0.9896 249 330 GO:0005737
GO:0005986
GO:0006000
GO:0006002
GO:0006094
GO:0030388
GO:0042132
AF-A0A2R7W8K0-F1-model_v4 deleted 0.9835 251 337
AF-A0A7C3QE80-F1-model_v4 fructose-bisphosphatase (EC 3.1.3.11) 0.9814 7 222 GO:0005829
GO:0005986
GO:0006000
GO:0006002
GO:0006094
GO:0030388
GO:0042132

Map