F453914

General Info

Members Datasets Scaffolds Average Seq Length
490 222 476 385

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100461248|Ga0068855_1004612481
Length 410
Sequence LPGCTFARMTIRQVKPISPGRSRIMVAVFFFVSGFGFSTWASRIPTIQQQLHLNEAQLGAVLFALPIGLMLTLPVTGVLLSRWDSRIIMMGGAVLFNLMLSMIGFVTRSWELVLGLFCFGASRNLLNISANAQSIGVQALYDKSIIARFHGIWSLAMFGGAALGSVMVSFKVTPGWHFLLVGLSLILISCYAFPGSLPQQPVAREKRPWFALPEKALVKFGLISFASMACEGTMIDWSGIYFRKAVNTSSKVATLGFVVYMTTMTLGRLTGDRLTSRYGIKRMLTYSGILIGSGLLLAALLPFPLTAGFGFMLTGFGVSCVIPMVFSMAGRSAGMSSGSAIAAVSTVGYFGFLLVPPMVGSVAELAGLRWSFGLMALFGMAITVLVQRLLTGEETLGAAPRDTTAAVTEI

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
5 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
13 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
14 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
208 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
209 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
210 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.98
Nodule 0
Rhizoplane 0.41
Rhizosphere 83.06
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10032399 3300001989 Bacteria 1798
2 JGI24737J22298_10000159 3300001990 Bacteria 21262
3 JGI24735J21928_10000001 3300002067 Bacteria 650042
4 JGI24744J21845_10010207 3300002077 Bacteria 1924
5 JGI25162J39368_1000020 3300002737 Bacteria 254723
6 JGI25162J39368_1000354 3300002737 Bacteria 39303
7 JGI25165J46597_1000929 3300003214 Bacteria 20285
8 rootH2_10003693 3300003320 Bacteria 23451
9 rootH2_10022771 3300003320 Bacteria 3333
10 rootH2_10035051 3300003320 Bacteria 24154
11 rootH2_10050975 3300003320 Bacteria 3910
12 rootH2_10100043 3300003320 Bacteria 12265
13 rootL2_10169438 3300003322 Bacteria 4755
14 rootL2_10188825 3300003322 Bacteria 3405
15 rootL2_10193083 3300003322 Bacteria 5664
16 rootL2_10297352 3300003322 Bacteria 1401
17 rootH1_10005872 3300003323 Bacteria 83624
18 rootH1_10036737 3300003323 Bacteria 8130
19 rootH1_10060255 3300003323 Bacteria 8266
20 rootH1_10075928 3300003323 Bacteria 4975
21 rootH1_10082212 3300003323 Bacteria 4807
22 rootH1_10331641 3300003323 Bacteria 1181
23 Ga0055535_1003105 3300003761 Bacteria 5005
24 Ga0055531_10000036 3300003794 Bacteria 147042
25 Ga0065704_10103795 3300005289 Bacteria 2161
26 Ga0070658_10000903 3300005327 Bacteria 25434
27 Ga0070658_10015448 3300005327 Bacteria 6108
28 Ga0070658_10129049 3300005327 Bacteria 2106
29 Ga0070676_10005739 3300005328 Bacteria 6616
30 Ga0070676_10016009 3300005328 Bacteria 4140
31 Ga0070690_100102997 3300005330 Bacteria 1895
32 Ga0070666_10000208 3300005335 Bacteria 40242
33 Ga0070666_10198193 3300005335 Bacteria 1412
34 Ga0070680_100000075 3300005336 Bacteria 53328
35 Ga0070680_100004596 3300005336 Bacteria 10376
36 Ga0070682_100001754 3300005337 Bacteria 12079
37 Ga0070682_100024238 3300005337 Unclassified 3609
38 Ga0068868_100002331 3300005338 Bacteria 13134
39 Ga0068868_100037111 3300005338 Unclassified 3776
40 Ga0068868_100095922 3300005338 Bacteria 2395
41 Ga0070691_10005755 3300005341 Bacteria 5653
42 Ga0070691_10015010 3300005341 Unclassified 3557
43 Ga0070691_10066707 3300005341 Unclassified 1740
44 Ga0070687_100008722 3300005343 Bacteria 4306
45 Ga0070668_100000022 3300005347 Bacteria 96336
46 Ga0070668_100168969 3300005347 Bacteria 1779
47 Ga0070671_100004973 3300005355 Bacteria 10583
48 Ga0070671_100080816 3300005355 Bacteria 2718
49 Ga0070673_100000534 3300005364 Bacteria 20508
50 Ga0070673_100026588 3300005364 Bacteria 4276
51 Ga0070659_100022323 3300005366 Bacteria 4831
52 Ga0070667_100001525 3300005367 Bacteria 20730
53 Ga0070667_100061285 3300005367 Bacteria 3185
54 Ga0070667_100274172 3300005367 Bacteria 1513
55 Ga0070701_10156846 3300005438 Bacteria 1315
56 Ga0070662_100000027 3300005457 Bacteria 83839
57 Ga0070681_10067606 3300005458 Unclassified 3541
58 Ga0068867_100003924 3300005459 Bacteria 10467
59 Ga0068867_100017526 3300005459 Bacteria 5087
60 Ga0070679_100000892 3300005530 Bacteria 25923
61 Ga0070679_100232791 3300005530 Unclassified 1801
62 Ga0070684_100006352 3300005535 Bacteria 9135
63 Ga0068853_100002065 3300005539 Bacteria 14884
64 Ga0068853_100003146 3300005539 Bacteria 12613
65 Ga0068853_100007917 3300005539 Bacteria 8521
66 Ga0068853_100032363 3300005539 Bacteria 4429
67 Ga0068853_100082720 3300005539 Bacteria 2812
68 Ga0068853_100087122 3300005539 Bacteria 2739
69 Ga0070672_100000021 3300005543 Bacteria 69249
70 Ga0070686_100046505 3300005544 Unclassified 2739
71 Ga0070693_100017030 3300005547 Bacteria 3771
72 Ga0070665_100000010 3300005548 Bacteria 529545
73 Ga0070665_100000016 3300005548 Bacteria 451538
74 Ga0070665_100011401 3300005548 Bacteria 8986
75 Ga0068855_100001195 3300005563 Bacteria 32239
76 Ga0068855_100012666 3300005563 Bacteria 10177
77 Ga0068855_100026773 3300005563 Bacteria 6900
78 Ga0068855_100041406 3300005563 Bacteria 5460
79 Ga0068855_100055349 3300005563 Bacteria 4660
80 Ga0068855_100172511 3300005563 Bacteria 2449
81 Ga0068855_100461248 3300005563 Bacteria 1385
82 Ga0068857_100033587 3300005577 Bacteria 4538
83 Ga0068857_100083069 3300005577 Bacteria 2861
84 Ga0068854_100121273 3300005578 Bacteria 1985
85 Ga0068856_100000005 3300005614 Bacteria 225505
86 Ga0068856_100014620 3300005614 Bacteria 7583
87 Ga0068856_100020378 3300005614 Bacteria 6440
88 Ga0068856_100022710 3300005614 Bacteria 6099
89 Ga0068856_100084181 3300005614 Bacteria 3159
90 Ga0068856_100106613 3300005614 Bacteria 2797
91 Ga0068852_100005321 3300005616 Bacteria 9189
92 Ga0068852_100012613 3300005616 Bacteria 6425
93 Ga0068859_100000006 3300005617 Bacteria 421509
94 Ga0068859_100135640 3300005617 Bacteria 2534
95 Ga0068864_100000402 3300005618 Bacteria 37620
96 Ga0068864_100001140 3300005618 Bacteria 22143
97 Ga0068851_10001028 3300005834 Bacteria 12107
98 Ga0068851_10005604 3300005834 Bacteria 5698
99 Ga0068858_100011189 3300005842 Bacteria 8479
100 Ga0068858_100042993 3300005842 Bacteria 4190
101 Ga0068858_100093439 3300005842 Bacteria 2800
102 Ga0068860_100000026 3300005843 Bacteria 270483
103 Ga0068860_100000502 3300005843 Bacteria 48523
104 Ga0068860_100013810 3300005843 Bacteria 7916
105 Ga0068860_100024681 3300005843 Bacteria 5806
106 Ga0068860_100048953 3300005843 Bacteria 4028
107 Ga0068862_100308993 3300005844 Bacteria 1457
108 Ga0075366_10002429 3300006195 Bacteria 9555
109 Ga0075366_10003758 3300006195 Bacteria 8065
110 Ga0075366_10027408 3300006195 Bacteria 3342
111 Ga0075366_10039847 3300006195 Bacteria 2777
112 Ga0097621_100000288 3300006237 Bacteria 33839
113 Ga0097621_100002100 3300006237 Bacteria 13657
114 Ga0097621_100023762 3300006237 Bacteria 4776
115 Ga0097621_100055442 3300006237 Bacteria 3237
116 Ga0068871_100000592 3300006358 Bacteria 24903
117 Ga0068871_100001822 3300006358 Bacteria 14384
118 Ga0068871_100004694 3300006358 Bacteria 9551
119 Ga0068871_100139414 3300006358 Unclassified 2061
120 Ga0068871_100213212 3300006358 Bacteria 1671
121 Ga0068865_100000029 3300006881 Bacteria 91199
122 Ga0068865_100005377 3300006881 Bacteria 7759
123 Ga0068865_100259050 3300006881 Bacteria 1376
124 Ga0097620_100000006 3300006931 Bacteria 421509
125 Ga0097620_100135636 3300006931 Bacteria 2534
126 Ga0105240_10000258 3300009093 Bacteria 105011
127 Ga0105240_10000715 3300009093 Bacteria 60725
128 Ga0105240_10000940 3300009093 Bacteria 51741
129 Ga0105240_10000957 3300009093 Bacteria 51562
130 Ga0105240_10006972 3300009093 Bacteria 16503
131 Ga0105240_10011065 3300009093 Bacteria 12617
132 Ga0105240_10011076 3300009093 Bacteria 12609
133 Ga0105240_10028305 3300009093 Bacteria 7321
134 Ga0105240_10057870 3300009093 Bacteria 4840
135 Ga0105240_10104586 3300009093 Unclassified 3438
136 Ga0105240_10312757 3300009093 Bacteria 1793
137 Ga0105247_10005682 3300009101 Bacteria 7815
138 Ga0105247_10008494 3300009101 Bacteria 6254
139 Ga0114129_10002497 3300009147 Bacteria 25516
140 Ga0105241_10000371 3300009174 Bacteria 34199
141 Ga0105241_10000512 3300009174 Bacteria 29214
142 Ga0105241_10000721 3300009174 Bacteria 25017
143 Ga0105241_10003747 3300009174 Bacteria 11275
144 Ga0105241_10012095 3300009174 Bacteria 6338
145 Ga0105241_10042424 3300009174 Bacteria 3442
146 Ga0105241_10277850 3300009174 Unclassified 1429
147 Ga0105242_10017524 3300009176 Bacteria 5583
148 Ga0105242_10051445 3300009176 Bacteria 3357
149 Ga0105242_10095944 3300009176 Bacteria 2504
150 Ga0105248_10292165 3300009177 Bacteria 1835
151 Ga0105237_10000654 3300009545 Bacteria 48395
152 Ga0105237_10000893 3300009545 Bacteria 40252
153 Ga0105237_10001091 3300009545 Bacteria 36317
154 Ga0105237_10001752 3300009545 Bacteria 28057
155 Ga0105237_10003282 3300009545 Bacteria 19314
156 Ga0105237_10003858 3300009545 Bacteria 17624
157 Ga0105237_10004644 3300009545 Bacteria 15830
158 Ga0105237_10005946 3300009545 Bacteria 13683
159 Ga0105237_10028126 3300009545 Bacteria 5729
160 Ga0105237_10039108 3300009545 Bacteria 4789
161 Ga0105237_10046468 3300009545 Bacteria 4366
162 Ga0105237_10073830 3300009545 Bacteria 3403
163 Ga0105237_10099956 3300009545 Unclassified 2892
164 Ga0105237_10212053 3300009545 Bacteria 1936
165 Ga0105238_10002007 3300009551 Bacteria 20529
166 Ga0105238_10148311 3300009551 Unclassified 2322
167 Ga0105238_10279368 3300009551 Bacteria 1651
168 Ga0105238_10298794 3300009551 Bacteria 1593
169 Ga0105238_10380090 3300009551 Bacteria 1404
170 Ga0105249_10004744 3300009553 Bacteria 11735
171 Ga0105249_10011147 3300009553 Bacteria 7898
172 Ga0105239_10000001 3300010375 Bacteria 617353
173 Ga0105239_10000178 3300010375 Bacteria 92196
174 Ga0105239_10000353 3300010375 Bacteria 67099
175 Ga0105239_10001735 3300010375 Bacteria 28734
176 Ga0105239_10002319 3300010375 Bacteria 24303
177 Ga0105239_10002402 3300010375 Bacteria 23874
178 Ga0105239_10002741 3300010375 Bacteria 22129
179 Ga0105239_10006124 3300010375 Bacteria 13997
180 Ga0105239_10025184 3300010375 Bacteria 6554
181 Ga0105239_10037467 3300010375 Bacteria 5315
182 Ga0105239_10062331 3300010375 Bacteria 4093
183 Ga0105239_10137863 3300010375 Bacteria 2716
184 Ga0105239_10360429 3300010375 Bacteria 1642
185 Ga0105246_10017826 3300011119 Bacteria 4516
186 Ga0105246_10037122 3300011119 Bacteria 3269
187 Ga0157371_10000355 3300013102 Bacteria 58322
188 Ga0157371_10017390 3300013102 Bacteria 5343
189 Ga0157370_10000426 3300013104 Bacteria 52773
190 Ga0157370_10004451 3300013104 Bacteria 16062
191 Ga0157370_10081898 3300013104 Bacteria 3037
192 Ga0157370_10152390 3300013104 Bacteria 2151
193 Ga0157369_10003209 3300013105 Bacteria 19502
194 Ga0157369_10051860 3300013105 Bacteria 4439
195 Ga0157369_10055358 3300013105 Bacteria 4282
196 Ga0157369_10120014 3300013105 Bacteria 2790
197 Ga0157374_10000002 3300013296 Bacteria 1054226
198 Ga0157374_10000263 3300013296 Bacteria 48612
199 Ga0157374_10003890 3300013296 Bacteria 12537
200 Ga0157374_10004929 3300013296 Bacteria 11199
201 Ga0157374_10024985 3300013296 Bacteria 5360
202 Ga0157374_10091366 3300013296 Bacteria 2903
203 Ga0157374_10348893 3300013296 Bacteria 1470
204 Ga0157378_10047245 3300013297 Bacteria 3826
205 Ga0157378_10059514 3300013297 Unclassified 3408
206 Ga0157378_10077190 3300013297 Bacteria 3003
207 Ga0157378_10184952 3300013297 Bacteria 1962
208 Ga0163162_10000257 3300013306 Bacteria 48216
209 Ga0163162_10000412 3300013306 Bacteria 39272
210 Ga0163162_10000519 3300013306 Bacteria 35771
211 Ga0163162_10003456 3300013306 Bacteria 15088
212 Ga0163162_10010072 3300013306 Bacteria 9189
213 Ga0163162_10371027 3300013306 Bacteria 1564
214 Ga0163162_10421383 3300013306 Bacteria 1467
215 Ga0163162_10429934 3300013306 Unclassified 1452
216 Ga0157372_10000015 3300013307 Bacteria 225365
217 Ga0157372_10003350 3300013307 Bacteria 17299
218 Ga0157372_10007153 3300013307 Bacteria 11879
219 Ga0157372_10023444 3300013307 Bacteria 6691
220 Ga0157372_10054961 3300013307 Bacteria 4445
221 Ga0157372_10062071 3300013307 Bacteria 4186
222 Ga0157372_10072846 3300013307 Bacteria 3871
223 Ga0157372_10088933 3300013307 Unclassified 3508
224 Ga0157372_10181005 3300013307 Bacteria 2440
225 Ga0157372_10215857 3300013307 Bacteria 2223
226 Ga0157375_10001759 3300013308 Bacteria 18571
227 Ga0157375_10002374 3300013308 Bacteria 16293
228 Ga0157375_10015483 3300013308 Bacteria 6827
229 Ga0157375_10050114 3300013308 Bacteria 4095
230 Ga0157375_10498248 3300013308 Bacteria 1382
231 Ga0163163_10000316 3300014325 Bacteria 47024
232 Ga0157377_10003388 3300014745 Bacteria 7207
233 Ga0157379_10002129 3300014968 Bacteria 16411
234 Ga0157379_10051709 3300014968 Bacteria 3669
235 Ga0157376_10000661 3300014969 Bacteria 22276
236 Ga0157376_10007205 3300014969 Bacteria 7910
237 Ga0157376_10009061 3300014969 Bacteria 7209
238 Ga0157376_10012788 3300014969 Bacteria 6242
239 Ga0157376_10047500 3300014969 Bacteria 3544
240 Ga0163161_10040694 3300017792 Bacteria 3338
241 Ga0213872_10026573 3300021361 Bacteria 2658
242 Ga0207427_100025 3300025231 Bacteria 433726
243 Ga0209437_100010 3300025233 Bacteria 838447
244 Ga0209437_100085 3300025233 Bacteria 254790
245 Ga0209258_100036 3300025242 Bacteria 428859
246 Ga0209026_1005457 3300025250 Bacteria 3422
247 Ga0209148_1000139 3300025254 Bacteria 167011
248 Ga0209233_1000017 3300025261 Bacteria 898076
249 Ga0209233_1000738 3300025261 Bacteria 14916
250 Ga0209233_1020727 3300025261 Unclassified 1717
251 Ga0209130_1012378 3300025284 Bacteria 2235
252 Ga0207426_1006323 3300025302 Bacteria 5175
253 Ga0209257_1000008 3300025304 Bacteria 1294570
254 Ga0207656_10000868 3300025321 Bacteria 9865
255 Ga0207710_10007293 3300025900 Bacteria 4686
256 Ga0207710_10083607 3300025900 Bacteria 1484
257 Ga0207680_10000072 3300025903 Bacteria 44683
258 Ga0207680_10000623 3300025903 Bacteria 16679
259 Ga0207647_10000100 3300025904 Bacteria 66261
260 Ga0207647_10000154 3300025904 Bacteria 54378
261 Ga0207645_10006805 3300025907 Bacteria 8160
262 Ga0207645_10007646 3300025907 Bacteria 7615
263 Ga0207643_10166624 3300025908 Bacteria 1328
264 Ga0207705_10049046 3300025909 Bacteria 3039
265 Ga0207654_10001232 3300025911 Bacteria 13668
266 Ga0207654_10001247 3300025911 Bacteria 13552
267 Ga0207654_10002329 3300025911 Bacteria 9746
268 Ga0207654_10063469 3300025911 Unclassified 2168
269 Ga0207654_10146562 3300025911 Bacteria 1511
270 Ga0207707_10000111 3300025912 Bacteria 82165
271 Ga0207707_10021157 3300025912 Bacteria 5685
272 Ga0207695_10000048 3300025913 Bacteria 421800
273 Ga0207695_10000067 3300025913 Bacteria 330915
274 Ga0207695_10000327 3300025913 Bacteria 113436
275 Ga0207695_10000947 3300025913 Bacteria 51628
276 Ga0207695_10001600 3300025913 Bacteria 36751
277 Ga0207695_10010253 3300025913 Bacteria 11486
278 Ga0207695_10026745 3300025913 Bacteria 6435
279 Ga0207695_10115082 3300025913 Bacteria 2664
280 Ga0207671_10000425 3300025914 Bacteria 58359
281 Ga0207671_10001370 3300025914 Bacteria 28347
282 Ga0207671_10001643 3300025914 Bacteria 25455
283 Ga0207671_10001754 3300025914 Bacteria 24385
284 Ga0207671_10002447 3300025914 Bacteria 19865
285 Ga0207671_10002948 3300025914 Bacteria 17526
286 Ga0207671_10008646 3300025914 Bacteria 8600
287 Ga0207671_10016523 3300025914 Bacteria 5731
288 Ga0207671_10044235 3300025914 Bacteria 3293
289 Ga0207671_10057833 3300025914 Unclassified 2874
290 Ga0207671_10169936 3300025914 Bacteria 1692
291 Ga0207660_10001342 3300025917 Bacteria 16472
292 Ga0207662_10065533 3300025918 Bacteria 2187
293 Ga0207657_10049969 3300025919 Bacteria 3641
294 Ga0207652_10001206 3300025921 Bacteria 23204
295 Ga0207694_10092439 3300025924 Unclassified 2388
296 Ga0207694_10115786 3300025924 Bacteria 2136
297 Ga0207650_10033701 3300025925 Bacteria 3710
298 Ga0207644_10088813 3300025931 Bacteria 2299
299 Ga0207644_10099009 3300025931 Bacteria 2187
300 Ga0207644_10141963 3300025931 Bacteria 1850
301 Ga0207690_10015383 3300025932 Bacteria 4636
302 Ga0207690_10037139 3300025932 Bacteria 3161
303 Ga0207690_10065927 3300025932 Bacteria 2478
304 Ga0207706_10000036 3300025933 Bacteria 134302
305 Ga0207706_10005522 3300025933 Bacteria 11791
306 Ga0207686_10043327 3300025934 Bacteria 2757
307 Ga0207686_10050937 3300025934 Bacteria 2577
308 Ga0207669_10145705 3300025937 Unclassified 1651
309 Ga0207704_10000144 3300025938 Bacteria 38148
310 Ga0207704_10002571 3300025938 Bacteria 8184
311 Ga0207691_10000115 3300025940 Bacteria 72014
312 Ga0207691_10068095 3300025940 Unclassified 3217
313 Ga0207691_10079943 3300025940 Bacteria 2942
314 Ga0207689_10000383 3300025942 Bacteria 41569
315 Ga0207667_10000340 3300025949 Bacteria 63904
316 Ga0207667_10005119 3300025949 Bacteria 16010
317 Ga0207667_10009663 3300025949 Bacteria 11344
318 Ga0207667_10020166 3300025949 Bacteria 7421
319 Ga0207667_10085392 3300025949 Bacteria 3268
320 Ga0207651_10029674 3300025960 Bacteria 3469
321 Ga0207651_10070991 3300025960 Bacteria 2466
322 Ga0207712_10002930 3300025961 Bacteria 10899
323 Ga0207668_10014419 3300025972 Bacteria 4891
324 Ga0207640_10114525 3300025981 Bacteria 1919
325 Ga0207658_10004378 3300025986 Bacteria 9819
326 Ga0207658_10007406 3300025986 Bacteria 7485
327 Ga0207677_10052589 3300026023 Unclassified 2768
328 Ga0207677_10142534 3300026023 Bacteria 1837
329 Ga0207703_10006374 3300026035 Bacteria 9430
330 Ga0207703_10009492 3300026035 Bacteria 7635
331 Ga0207639_10001899 3300026041 Bacteria 14030
332 Ga0207639_10003743 3300026041 Bacteria 10238
333 Ga0207639_10004875 3300026041 Bacteria 9032
334 Ga0207639_10021872 3300026041 Bacteria 4599
335 Ga0207639_10033589 3300026041 Bacteria 3785
336 Ga0207639_10067684 3300026041 Unclassified 2780
337 Ga0207702_10000047 3300026078 Bacteria 143192
338 Ga0207702_10004456 3300026078 Bacteria 12445
339 Ga0207702_10010625 3300026078 Bacteria 7694
340 Ga0207641_10000280 3300026088 Bacteria 64281
341 Ga0207641_10008582 3300026088 Bacteria 8437
342 Ga0207648_10009342 3300026089 Bacteria 9396
343 Ga0207648_10009985 3300026089 Bacteria 9033
344 Ga0207676_10002210 3300026095 Bacteria 14039
345 Ga0207676_10069911 3300026095 Bacteria 2813
346 Ga0207674_10032469 3300026116 Bacteria 5476
347 Ga0207674_10076253 3300026116 Unclassified 3361
348 Ga0207674_10085127 3300026116 Bacteria 3158
349 Ga0207675_100047510 3300026118 Bacteria 4007
350 Ga0207698_10004934 3300026142 Bacteria 8178
351 Ga0207698_10132993 3300026142 Bacteria 2129
352 Ga0207698_10170600 3300026142 Bacteria 1915
353 Ga0207698_10209795 3300026142 Bacteria 1751
354 Ga0207698_10308553 3300026142 Bacteria 1476
355 Ga0268266_10000034 3300028379 Bacteria 354251
356 Ga0268266_10000094 3300028379 Bacteria 190917
357 Ga0268264_10000117 3300028381 Bacteria 195037
358 Ga0268264_10010047 3300028381 Bacteria 7834
359 Ga0268264_10010967 3300028381 Bacteria 7486
360 Ga0268264_10036390 3300028381 Bacteria 4055
361 Ga0268264_10054792 3300028381 Bacteria 3331
362 Ga0307515_10000021 3300028794 Bacteria 406008
363 Ga0307515_10002415 3300028794 Bacteria 40755
364 Ga0265338_10079717 3300028800 Bacteria 2754
365 Ga0307511_10000153 3300030521 Bacteria 65598
366 Ga0307513_10061898 3300031456 Bacteria 3958
367 Ga0307513_10172580 3300031456 Bacteria 2038
368 Ga0307509_10027231 3300031507 Bacteria 6363
369 Ga0307509_10067068 3300031507 Bacteria 3761
370 Ga0307414_10009719 3300032004 Bacteria 5541
371 Ga0307507_10000217 3300033179 Bacteria 109884
372 Ga0307510_10000191 3300033180 Bacteria 53108
373 Ga0307510_10005596 3300033180 Bacteria 14978
374 Ga0373935_0127903 3300035692 Bacteria 1704
375 Ga0373937_0309320 3300036401 Unclassified 1494
376 Ga0395899_0000001 3300037312 Bacteria 1750322
377 Ga0395899_0000504 3300037312 Bacteria 43374
378 Ga0395899_0000615 3300037312 Bacteria 37072
379 Ga0395900_0000153 3300037418 Bacteria 115432
380 Ga0395900_0007895 3300037418 Bacteria 10961
381 Ga0395898_0009794 3300037466 Bacteria 10044
382 Ga0395905_0000188 3300037471 Bacteria 98070
383 Ga0395905_0001681 3300037471 Bacteria 26088
384 Ga0395901_0000357 3300038443 Bacteria 55376
385 Ga0395901_0007718 3300038443 Bacteria 10852
386 Ga0395901_0268130 3300038443 Bacteria 1776
387 Ga0436365_0813807 3300039437 Bacteria 15125
388 Ga0436365_1513074 3300039437 Bacteria 2469
389 Ga0436361_0172871 3300039447 Bacteria 8439
390 Ga0439457_000642 3300042014 Bacteria 10325
391 Ga0466969_0000191 3300044656 Bacteria 32966
392 Ga0466972_0000011 3300044658 Bacteria 249697
393 Ga0466972_0004472 3300044658 Bacteria 6991
394 Ga0466966_0000276 3300044684 Bacteria 33634
395 Ga0466971_0016668 3300044719 Bacteria 3246
396 Ga0466968_0056598 3300044735 Bacteria 1685
397 Ga0466970_0108986 3300044765 Bacteria 1512
398 Ga0466957_0000707 3300044842 Bacteria 17079
399 Ga0466959_0000010 3300045049 Bacteria 176306
400 Ga0466959_0006639 3300045049 Bacteria 8038
401 Ga0466959_0043909 3300045049 Bacteria 3294
402 Ga0495650_0000014 3300046471 Bacteria 581606
403 Ga0495585_0000158 3300046492 Bacteria 72351
404 Ga0495606_0000241 3300046507 Bacteria 96663
405 Ga0495606_0025135 3300046507 Bacteria 4273
406 Ga0495610_0001190 3300046512 Bacteria 23538
407 Ga0495616_0018331 3300046513 Bacteria 3844
408 Ga0495616_0019098 3300046513 Bacteria 3746
409 Ga0495631_0082561 3300046518 Bacteria 1385
410 Ga0495644_0009915 3300046523 Bacteria 3669
411 Ga0495648_0001560 3300046524 Bacteria 22401
412 Ga0495648_0060877 3300046524 Unclassified 2244
413 Ga0495609_0030662 3300046538 Bacteria 2447
414 Ga0495633_0000044 3300046558 Bacteria 171185
415 Ga0495668_0004298 3300046616 Bacteria 10210
416 Ga0495611_0001833 3300046648 Bacteria 10167
417 Ga0495625_0000003 3300046660 Bacteria 686847
418 Ga0495625_0012565 3300046660 Bacteria 6855
419 Ga0495625_0022413 3300046660 Bacteria 4843
420 Ga0495625_0131847 3300046660 Unclassified 1692
421 Ga0495661_0003223 3300046665 Bacteria 12173
422 Ga0495661_0035910 3300046665 Bacteria 3107
423 Ga0495649_0000002 3300046694 Bacteria 1093458
424 Ga0495660_0024895 3300046810 Bacteria 3404
425 Ga0495683_0052379 3300047323 Bacteria 2038
426 Ga0495687_000079 3300047443 Bacteria 147704
427 Ga0495687_001250 3300047443 Bacteria 24174
428 Ga0495687_011185 3300047443 Bacteria 4844
429 Ga0495686_0000041 3300047472 Bacteria 297599
430 Ga0495686_0001054 3300047472 Bacteria 32954
431 Ga0495686_0009585 3300047472 Bacteria 6961
432 Ga0495686_0052724 3300047472 Bacteria 2550
433 Ga0495686_0105971 3300047472 Unclassified 1690
434 Ga0496109_0410995 3300048912 Bacteria 1279
435 Ga0496126_0007154 3300048929 Bacteria 12286
436 Ga0501034_0186371 3300049571 Unclassified 2038
437 Ga0501034_0465797 3300049571 Unclassified 1180
438 Ga0501043_0258250 3300049579 Bacteria 1341
439 Ga0501047_0044487 3300049581 Bacteria 4290
440 Ga0501047_0278798 3300049581 Bacteria 1517
441 Ga0501048_0210710 3300049582 Bacteria 1378
442 Ga0501067_0020762 3300049583 Unclassified 3633
443 Ga0501070_0057031 3300049586 Bacteria 3237
444 Ga0501073_0048307 3300049589 Bacteria 2987
445 Ga0501225_0002361 3300049705 Bacteria 5817
446 Ga0501080_0065398 3300049742 Bacteria 3382
447 Ga0501080_0238982 3300049742 Unclassified 1658
448 Ga0501083_0006552 3300049744 Bacteria 8261
449 Ga0501284_00003 3300050005 Bacteria 212116
450 nmdc:mga0k408_17163_c1 3300050493 Bacteria 4029
451 nmdc:mga0k408_2100_c1 3300050493 Bacteria 10668
452 nmdc:mga0k408_5162_c1 3300050493 Bacteria 6923
453 nmdc:mga05p37_986_c1 3300050507 Bacteria 18400
454 Ga0500635_0005650 3300053080 Bacteria 3296
455 Ga0500578_0000190 3300053086 Bacteria 74445
456 Ga0500644_0000422 3300053088 Bacteria 19880
457 Ga0500583_0000004 3300053092 Bacteria 174723
458 Ga0500583_0006958 3300053092 Bacteria 3938
459 Ga0500569_001496 3300053109 Bacteria 4424
460 Ga0500608_000746 3300053122 Bacteria 11891
461 Ga0500618_000001 3300053125 Bacteria 538477
462 Ga0500618_010521 3300053125 Bacteria 2482
463 Ga0500652_065244 3300053131 Bacteria 1504
464 Ga0500658_0005859 3300053134 Bacteria 4577
465 Ga0500559_0013691 3300053136 Bacteria 3432
466 Ga0500568_0015246 3300053139 Bacteria 3445
467 Ga0500577_0001956 3300053142 Bacteria 5273
468 Ga0500604_0008861 3300053151 Bacteria 2673
469 Ga0500616_0080118 3300053153 Unclassified 1643
470 Ga0500622_0000305 3300053156 Bacteria 50294
471 Ga0500622_0001589 3300053156 Bacteria 17882
472 Ga0500622_0019315 3300053156 Bacteria 3620
473 Ga0500624_000333 3300053157 Bacteria 15857
474 Ga0500636_0009602 3300053177 Bacteria 5630
475 Ga0466962_0009342 3300061719 Bacteria 4697
476 Ga0466962_0100796 3300061719 Bacteria 1387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10115082 Ga0207695_101150823 320
2 3300003323 rootH1_10036737 rootH1_100367373 331
3 3300048912 Ga0496109_0410995 Ga0496109_0410995_230_1234 331
4 3300044658 Ga0466972_0004472 Ga0466972_0004472_536_1564 340
5 3300026116 Ga0207674_10085127 Ga0207674_100851272 341
6 3300037312 Ga0395899_0000001 Ga0395899_0000001_342785_343852 346
7 3300005341 Ga0070691_10066707 Ga0070691_100667071 353
8 3300002737 JGI25162J39368_1000354 JGI25162J39368_100035431 355
9 3300003214 JGI25165J46597_1000929 JGI25165J46597_100092913 355
10 3300003323 rootH1_10005872 rootH1_1000587243 355
11 3300009093 Ga0105240_10000258 Ga0105240_1000025845 355
12 3300009174 Ga0105241_10000721 Ga0105241_1000072124 355
13 3300009551 Ga0105238_10002007 Ga0105238_100020077 355
14 3300010375 Ga0105239_10137863 Ga0105239_101378632 355
15 3300013307 Ga0157372_10088933 Ga0157372_100889332 355
16 3300025231 Ga0207427_100025 Ga0207427_100025266 355
17 3300025233 Ga0209437_100010 Ga0209437_100010528 355
18 3300025261 Ga0209233_1000017 Ga0209233_1000017541 355
19 3300003320 rootH2_10100043 rootH2_101000438 356
20 3300005614 Ga0068856_100014620 Ga0068856_1000146206 356
21 3300026078 Ga0207702_10010625 Ga0207702_100106255 356
22 3300005341 Ga0070691_10015010 Ga0070691_100150102 357
23 3300009093 Ga0105240_10000940 Ga0105240_1000094014 358
24 3300014969 Ga0157376_10007205 Ga0157376_1000720510 358
25 3300025913 Ga0207695_10000067 Ga0207695_1000006713 358
26 3300025913 Ga0207695_10000947 Ga0207695_1000094713 358
27 3300044735 Ga0466968_0056598 Ga0466968_0056598_331_1485 358
28 3300044765 Ga0466970_0108986 Ga0466970_0108986_137_1291 358
29 3300005844 Ga0068862_100308993 Ga0068862_1003089931 361
30 3300009545 Ga0105237_10046468 Ga0105237_100464683 362
31 3300013296 Ga0157374_10000002 Ga0157374_10000002868 362
32 3300009093 Ga0105240_10000715 Ga0105240_1000071552 364
33 3300047472 Ga0495686_0009585 Ga0495686_0009585_5132_6250 364
34 3300053109 Ga0500569_001496 Ga0500569_001496_1692_2870 364
35 3300053134 Ga0500658_0005859 Ga0500658_0005859_1730_2908 364
36 3300053142 Ga0500577_0001956 Ga0500577_0001956_2105_3283 364
37 3300005535 Ga0070684_100006352 Ga0070684_1000063522 365
38 3300005563 Ga0068855_100001195 Ga0068855_1000011955 365
39 3300009545 Ga0105237_10004644 Ga0105237_1000464417 365
40 3300025913 Ga0207695_10000327 Ga0207695_1000032786 365
41 3300025949 Ga0207667_10000340 Ga0207667_1000034047 365
42 3300031507 Ga0307509_10067068 Ga0307509_100670682 365
43 3300053131 Ga0500652_065244 Ga0500652_065244_26_1180 365
44 3300003761 Ga0055535_1003105 Ga0055535_10031053 366
45 3300013104 Ga0157370_10081898 Ga0157370_100818982 366
46 3300014969 Ga0157376_10012788 Ga0157376_100127884 366
47 3300025242 Ga0209258_100036 Ga0209258_100036251 366
48 3300025254 Ga0209148_1000139 Ga0209148_100013946 366
49 3300028800 Ga0265338_10079717 Ga0265338_100797172 367
50 3300003320 rootH2_10050975 rootH2_100509752 368
51 3300003323 rootH1_10331641 rootH1_103316411 368
52 3300005335 Ga0070666_10198193 Ga0070666_101981931 368
53 3300005338 Ga0068868_100037111 Ga0068868_1000371111 368
54 3300005614 Ga0068856_100022710 Ga0068856_1000227104 368
55 3300005617 Ga0068859_100135640 Ga0068859_1001356404 368
56 3300005843 Ga0068860_100048953 Ga0068860_1000489532 368
57 3300006931 Ga0097620_100135636 Ga0097620_1001356364 368
58 3300009093 Ga0105240_10028305 Ga0105240_100283052 368
59 3300009093 Ga0105240_10312757 Ga0105240_103127572 368
60 3300009545 Ga0105237_10000893 Ga0105237_1000089334 368
61 3300009545 Ga0105237_10028126 Ga0105237_100281262 368
62 3300009545 Ga0105237_10073830 Ga0105237_100738302 368
63 3300009545 Ga0105237_10099956 Ga0105237_100999562 368
64 3300009551 Ga0105238_10148311 Ga0105238_101483112 368
65 3300009551 Ga0105238_10279368 Ga0105238_102793681 368
66 3300009551 Ga0105238_10380090 Ga0105238_103800902 368
67 3300010375 Ga0105239_10000353 Ga0105239_1000035332 368
68 3300010375 Ga0105239_10002402 Ga0105239_1000240210 368
69 3300013104 Ga0157370_10004451 Ga0157370_100044515 368
70 3300013306 Ga0163162_10003456 Ga0163162_100034564 368
71 3300013307 Ga0157372_10003350 Ga0157372_100033505 368
72 3300025914 Ga0207671_10001754 Ga0207671_1000175413 368
73 3300025914 Ga0207671_10016523 Ga0207671_100165232 368
74 3300025914 Ga0207671_10057833 Ga0207671_100578332 368
75 3300025924 Ga0207694_10092439 Ga0207694_100924392 368
76 3300026023 Ga0207677_10052589 Ga0207677_100525891 368
77 3300028381 Ga0268264_10036390 Ga0268264_100363903 368
78 3300035692 Ga0373935_0127903 Ga0373935_0127903_522_1667 368
79 3300046524 Ga0495648_0001560 Ga0495648_0001560_1761_2921 368
80 3300046648 Ga0495611_0001833 Ga0495611_0001833_8495_9637 368
81 3300047443 Ga0495687_000079 Ga0495687_000079_10548_11708 368
82 3300049742 Ga0501080_0238982 Ga0501080_0238982_400_1557 368
83 3300053139 Ga0500568_0015246 Ga0500568_0015246_1026_2180 368
84 3300053153 Ga0500616_0080118 Ga0500616_0080118_491_1600 368
85 3300053156 Ga0500622_0019315 Ga0500622_0019315_1310_2470 368
86 3300025913 Ga0207695_10001600 Ga0207695_1000160024 369
87 3300025914 Ga0207671_10008646 Ga0207671_100086465 369
88 3300036401 Ga0373937_0309320 Ga0373937_0309320_223_1365 369
89 3300037418 Ga0395900_0007895 Ga0395900_0007895_3063_4214 369
90 3300037471 Ga0395905_0001681 Ga0395905_0001681_15464_16615 369
91 3300038443 Ga0395901_0007718 Ga0395901_0007718_7040_8191 369
92 3300053136 Ga0500559_0013691 Ga0500559_0013691_959_2086 369
93 3300053177 Ga0500636_0009602 Ga0500636_0009602_754_1881 369
94 3300006195 Ga0075366_10002429 Ga0075366_100024296 370
95 3300006237 Ga0097621_100055442 Ga0097621_1000554423 370
96 3300006358 Ga0068871_100139414 Ga0068871_1001394142 370
97 3300013296 Ga0157374_10024985 Ga0157374_100249857 370
98 3300046660 Ga0495625_0012565 Ga0495625_0012565_4204_5367 370
99 3300048929 Ga0496126_0007154 Ga0496126_0007154_113_1285 370
100 3300050493 nmdc:mga0k408_2100_c1 nmdc:mga0k408_2100_c1_6035_7201 370
101 3300053156 Ga0500622_0001589 Ga0500622_0001589_6187_7350 370
102 3300003794 Ga0055531_10000036 Ga0055531_1000003699 372
103 3300005539 Ga0068853_100087122 Ga0068853_1000871222 372
104 3300009093 Ga0105240_10000957 Ga0105240_1000095713 372
105 3300009093 Ga0105240_10057870 Ga0105240_100578702 372
106 3300009174 Ga0105241_10277850 Ga0105241_102778501 372
107 3300010375 Ga0105239_10002319 Ga0105239_1000231913 372
108 3300010375 Ga0105239_10025184 Ga0105239_100251842 372
109 3300013307 Ga0157372_10181005 Ga0157372_101810053 372
110 3300025304 Ga0209257_1000008 Ga0209257_100000834 372
111 3300026041 Ga0207639_10003743 Ga0207639_100037432 372
112 iso_pu_bacteria 2896085136 2896089201 372
113 3300030521 Ga0307511_10000153 Ga0307511_100001533 373
114 3300053088 Ga0500644_0000422 Ga0500644_0000422_2848_3975 374
115 3300005330 Ga0070690_100102997 Ga0070690_1001029972 375
116 3300005337 Ga0070682_100024238 Ga0070682_1000242382 375
117 3300005338 Ga0068868_100095922 Ga0068868_1000959222 375
118 3300005343 Ga0070687_100008722 Ga0070687_1000087223 375
119 3300005355 Ga0070671_100004973 Ga0070671_1000049735 375
120 3300005367 Ga0070667_100274172 Ga0070667_1002741721 375
121 3300005438 Ga0070701_10156846 Ga0070701_101568461 375
122 3300005539 Ga0068853_100032363 Ga0068853_1000323633 375
123 3300005544 Ga0070686_100046505 Ga0070686_1000465052 375
124 3300006358 Ga0068871_100213212 Ga0068871_1002132121 375
125 3300013297 Ga0157378_10077190 Ga0157378_100771902 375
126 3300013306 Ga0163162_10421383 Ga0163162_104213832 375
127 3300025908 Ga0207643_10166624 Ga0207643_101666241 375
128 3300025918 Ga0207662_10065533 Ga0207662_100655331 375
129 3300025931 Ga0207644_10141963 Ga0207644_101419631 375
130 3300025940 Ga0207691_10068095 Ga0207691_100680953 375
131 3300026023 Ga0207677_10142534 Ga0207677_101425342 375
132 3300026041 Ga0207639_10067684 Ga0207639_100676842 375
133 3300047472 Ga0495686_0052724 Ga0495686_0052724_28_1155 375
134 iso_pu_bacteria 2738541278 2738727470 375
135 3300005614 Ga0068856_100000005 Ga0068856_100000005131 376
136 3300026078 Ga0207702_10000047 Ga0207702_10000047134 376
137 iso_pu_bacteria 2896109856 2896111175 376
138 3300013105 Ga0157369_10120014 Ga0157369_101200141 377
139 3300026142 Ga0207698_10170600 Ga0207698_101706003 377
140 iso_pu_bacteria 2977232053 2977236439 377
141 3300046492 Ga0495585_0000158 Ga0495585_0000158_33052_34212 378
142 3300005336 Ga0070680_100000075 Ga0070680_10000007520 379
143 3300005337 Ga0070682_100001754 Ga0070682_1000017541 379
144 3300005341 Ga0070691_10005755 Ga0070691_100057552 379
145 3300005367 Ga0070667_100061285 Ga0070667_1000612853 379
146 3300005530 Ga0070679_100000892 Ga0070679_1000008921 379
147 3300005539 Ga0068853_100007917 Ga0068853_1000079173 379
148 3300005547 Ga0070693_100017030 Ga0070693_1000170302 379
149 3300005563 Ga0068855_100026773 Ga0068855_1000267736 379
150 3300009174 Ga0105241_10000512 Ga0105241_1000051220 379
151 3300013104 Ga0157370_10000426 Ga0157370_1000042620 379
152 3300013296 Ga0157374_10091366 Ga0157374_100913663 379
153 3300013306 Ga0163162_10371027 Ga0163162_103710272 379
154 3300013306 Ga0163162_10429934 Ga0163162_104299342 379
155 3300013307 Ga0157372_10023444 Ga0157372_100234444 379
156 3300025911 Ga0207654_10002329 Ga0207654_100023295 379
157 3300025912 Ga0207707_10000111 Ga0207707_1000011120 379
158 3300025917 Ga0207660_10001342 Ga0207660_1000134212 379
159 3300025921 Ga0207652_10001206 Ga0207652_1000120616 379
160 3300025932 Ga0207690_10065927 Ga0207690_100659272 379
161 3300025937 Ga0207669_10145705 Ga0207669_101457052 379
162 3300026041 Ga0207639_10004875 Ga0207639_100048756 379
163 3300042014 Ga0439457_000642 Ga0439457_000642_3101_4246 379
164 3300047472 Ga0495686_0000041 Ga0495686_0000041_63601_64800 379
165 3300049571 Ga0501034_0186371 Ga0501034_0186371_203_1366 379
166 3300049571 Ga0501034_0465797 Ga0501034_0465797_17_1159 379
167 3300049579 Ga0501043_0258250 Ga0501043_0258250_103_1245 379
168 3300049583 Ga0501067_0020762 Ga0501067_0020762_715_1857 379
169 3300049586 Ga0501070_0057031 Ga0501070_0057031_1328_2470 379
170 3300049589 Ga0501073_0048307 Ga0501073_0048307_986_2128 379
171 3300049705 Ga0501225_0002361 Ga0501225_0002361_24_1172 379
172 3300049742 Ga0501080_0065398 Ga0501080_0065398_1575_2717 379
173 3300049744 Ga0501083_0006552 Ga0501083_0006552_5822_6964 379
174 3300053086 Ga0500578_0000190 Ga0500578_0000190_18982_20127 379
175 iso_pu_bacteria 2929177148 2929179171 379
176 iso_pu_bacteria 2945977869 2945981574 379
177 iso_pu_bacteria 2946013367 2946019021 379
178 3300003322 rootL2_10193083 rootL2_101930831 380
179 3300003322 rootL2_10297352 rootL2_102973521 380
180 3300005289 Ga0065704_10103795 Ga0065704_101037952 380
181 3300032004 Ga0307414_10009719 Ga0307414_100097193 380
182 3300033180 Ga0307510_10005596 Ga0307510_1000559612 380
183 3300044656 Ga0466969_0000191 Ga0466969_0000191_13879_15021 380
184 3300044684 Ga0466966_0000276 Ga0466966_0000276_27824_28966 380
185 3300045049 Ga0466959_0000010 Ga0466959_0000010_76234_77376 380
186 3300046507 Ga0495606_0025135 Ga0495606_0025135_1275_2465 380
187 3300046518 Ga0495631_0082561 Ga0495631_0082561_68_1219 380
188 3300047323 Ga0495683_0052379 Ga0495683_0052379_394_1542 380
189 3300053122 Ga0500608_000746 Ga0500608_000746_8011_9159 380
190 iso_pu_bacteria 2818991460 2819681348 380
191 3300002077 JGI24744J21845_10010207 JGI24744J21845_100102073 381
192 3300003320 rootH2_10003693 rootH2_100036939 381
193 3300003322 rootL2_10188825 rootL2_101888251 381
194 3300003323 rootH1_10060255 rootH1_100602554 381
195 3300003323 rootH1_10075928 rootH1_100759286 381
196 3300005327 Ga0070658_10000903 Ga0070658_100009034 381
197 3300005328 Ga0070676_10005739 Ga0070676_100057393 381
198 3300005328 Ga0070676_10016009 Ga0070676_100160093 381
199 3300005338 Ga0068868_100002331 Ga0068868_1000023313 381
200 3300005347 Ga0070668_100000022 Ga0070668_10000002278 381
201 3300005364 Ga0070673_100000534 Ga0070673_1000005342 381
202 3300005364 Ga0070673_100026588 Ga0070673_1000265883 381
203 3300005366 Ga0070659_100022323 Ga0070659_1000223233 381
204 3300005367 Ga0070667_100001525 Ga0070667_10000152510 381
205 3300005457 Ga0070662_100000027 Ga0070662_10000002787 381
206 3300005459 Ga0068867_100003924 Ga0068867_1000039246 381
207 3300005459 Ga0068867_100017526 Ga0068867_1000175264 381
208 3300005539 Ga0068853_100002065 Ga0068853_1000020656 381
209 3300005539 Ga0068853_100003146 Ga0068853_1000031468 381
210 3300005539 Ga0068853_100082720 Ga0068853_1000827204 381
211 3300005543 Ga0070672_100000021 Ga0070672_10000002117 381
212 3300005548 Ga0070665_100000010 Ga0070665_10000001020 381
213 3300005548 Ga0070665_100011401 Ga0070665_1000114017 381
214 3300005563 Ga0068855_100012666 Ga0068855_10001266610 381
215 3300005563 Ga0068855_100041406 Ga0068855_1000414063 381
216 3300005563 Ga0068855_100055349 Ga0068855_1000553493 381
217 3300005614 Ga0068856_100020378 Ga0068856_1000203781 381
218 3300005614 Ga0068856_100084181 Ga0068856_1000841814 381
219 3300005614 Ga0068856_100106613 Ga0068856_1001066132 381
220 3300005616 Ga0068852_100005321 Ga0068852_10000532114 381
221 3300005618 Ga0068864_100001140 Ga0068864_1000011401 381
222 3300005834 Ga0068851_10001028 Ga0068851_100010289 381
223 3300005842 Ga0068858_100042993 Ga0068858_1000429933 381
224 3300005842 Ga0068858_100093439 Ga0068858_1000934392 381
225 3300005843 Ga0068860_100013810 Ga0068860_1000138105 381
226 3300006195 Ga0075366_10027408 Ga0075366_100274082 381
227 3300006237 Ga0097621_100000288 Ga0097621_10000028822 381
228 3300006237 Ga0097621_100023762 Ga0097621_1000237622 381
229 3300006358 Ga0068871_100000592 Ga0068871_10000059224 381
230 3300006358 Ga0068871_100004694 Ga0068871_1000046946 381
231 3300006881 Ga0068865_100000029 Ga0068865_10000002973 381
232 3300006881 Ga0068865_100005377 Ga0068865_1000053775 381
233 3300009093 Ga0105240_10006972 Ga0105240_100069729 381
234 3300009093 Ga0105240_10011076 Ga0105240_100110764 381
235 3300009093 Ga0105240_10104586 Ga0105240_101045862 381
236 3300009101 Ga0105247_10005682 Ga0105247_100056822 381
237 3300009174 Ga0105241_10003747 Ga0105241_100037479 381
238 3300009174 Ga0105241_10042424 Ga0105241_100424242 381
239 3300009176 Ga0105242_10017524 Ga0105242_100175247 381
240 3300009176 Ga0105242_10051445 Ga0105242_100514452 381
241 3300009177 Ga0105248_10292165 Ga0105248_102921652 381
242 3300009545 Ga0105237_10003282 Ga0105237_1000328212 381
243 3300009553 Ga0105249_10011147 Ga0105249_100111475 381
244 3300010375 Ga0105239_10001735 Ga0105239_1000173526 381
245 3300010375 Ga0105239_10037467 Ga0105239_100374672 381
246 3300010375 Ga0105239_10062331 Ga0105239_100623314 381
247 3300011119 Ga0105246_10037122 Ga0105246_100371224 381
248 3300013102 Ga0157371_10017390 Ga0157371_100173902 381
249 3300013105 Ga0157369_10003209 Ga0157369_1000320910 381
250 3300013105 Ga0157369_10055358 Ga0157369_100553582 381
251 3300013296 Ga0157374_10000263 Ga0157374_1000026324 381
252 3300013296 Ga0157374_10003890 Ga0157374_100038907 381
253 3300013296 Ga0157374_10004929 Ga0157374_100049292 381
254 3300013297 Ga0157378_10047245 Ga0157378_100472453 381
255 3300013297 Ga0157378_10184952 Ga0157378_101849521 381
256 3300013306 Ga0163162_10000257 Ga0163162_1000025719 381
257 3300013306 Ga0163162_10000412 Ga0163162_1000041247 381
258 3300013307 Ga0157372_10000015 Ga0157372_10000015157 381
259 3300013307 Ga0157372_10054961 Ga0157372_100549618 381
260 3300013307 Ga0157372_10072846 Ga0157372_100728463 381
261 3300013307 Ga0157372_10215857 Ga0157372_102158573 381
262 3300013308 Ga0157375_10001759 Ga0157375_100017597 381
263 3300013308 Ga0157375_10002374 Ga0157375_100023742 381
264 3300013308 Ga0157375_10050114 Ga0157375_100501142 381
265 3300013308 Ga0157375_10498248 Ga0157375_104982481 381
266 3300014325 Ga0163163_10000316 Ga0163163_100003168 381
267 3300014745 Ga0157377_10003388 Ga0157377_100033888 381
268 3300014968 Ga0157379_10002129 Ga0157379_1000212912 381
269 3300014969 Ga0157376_10000661 Ga0157376_1000066117 381
270 3300014969 Ga0157376_10047500 Ga0157376_100475005 381
271 3300017792 Ga0163161_10040694 Ga0163161_100406943 381
272 3300021361 Ga0213872_10026573 Ga0213872_100265731 381
273 3300025284 Ga0209130_1012378 Ga0209130_10123782 381
274 3300025302 Ga0207426_1006323 Ga0207426_10063233 381
275 3300025321 Ga0207656_10000868 Ga0207656_100008688 381
276 3300025900 Ga0207710_10083607 Ga0207710_100836071 381
277 3300025903 Ga0207680_10000623 Ga0207680_100006233 381
278 3300025904 Ga0207647_10000100 Ga0207647_1000010071 381
279 3300025907 Ga0207645_10006805 Ga0207645_100068055 381
280 3300025907 Ga0207645_10007646 Ga0207645_100076466 381
281 3300025909 Ga0207705_10049046 Ga0207705_100490463 381
282 3300025911 Ga0207654_10001232 Ga0207654_100012329 381
283 3300025911 Ga0207654_10063469 Ga0207654_100634692 381
284 3300025911 Ga0207654_10146562 Ga0207654_101465622 381
285 3300025913 Ga0207695_10010253 Ga0207695_1001025312 381
286 3300025914 Ga0207671_10044235 Ga0207671_100442354 381
287 3300025919 Ga0207657_10049969 Ga0207657_100499692 381
288 3300025932 Ga0207690_10015383 Ga0207690_100153838 381
289 3300025933 Ga0207706_10000036 Ga0207706_100000369 381
290 3300025933 Ga0207706_10005522 Ga0207706_100055225 381
291 3300025934 Ga0207686_10050937 Ga0207686_100509373 381
292 3300025938 Ga0207704_10000144 Ga0207704_100001445 381
293 3300025938 Ga0207704_10002571 Ga0207704_100025713 381
294 3300025940 Ga0207691_10000115 Ga0207691_1000011519 381
295 3300025949 Ga0207667_10009663 Ga0207667_100096639 381
296 3300025949 Ga0207667_10020166 Ga0207667_100201664 381
297 3300025949 Ga0207667_10085392 Ga0207667_100853923 381
298 3300025960 Ga0207651_10029674 Ga0207651_100296743 381
299 3300025960 Ga0207651_10070991 Ga0207651_100709911 381
300 3300025961 Ga0207712_10002930 Ga0207712_100029308 381
301 3300025972 Ga0207668_10014419 Ga0207668_100144194 381
302 3300025986 Ga0207658_10007406 Ga0207658_100074063 381
303 3300026035 Ga0207703_10006374 Ga0207703_100063744 381
304 3300026041 Ga0207639_10001899 Ga0207639_100018996 381
305 3300026041 Ga0207639_10021872 Ga0207639_100218724 381
306 3300026041 Ga0207639_10033589 Ga0207639_100335895 381
307 3300026078 Ga0207702_10004456 Ga0207702_100044564 381
308 3300026088 Ga0207641_10008582 Ga0207641_100085826 381
309 3300026089 Ga0207648_10009342 Ga0207648_100093427 381
310 3300026089 Ga0207648_10009985 Ga0207648_1000998510 381
311 3300026095 Ga0207676_10002210 Ga0207676_1000221012 381
312 3300026118 Ga0207675_100047510 Ga0207675_1000475104 381
313 3300026142 Ga0207698_10132993 Ga0207698_101329931 381
314 3300028379 Ga0268266_10000094 Ga0268266_1000009420 381
315 3300028381 Ga0268264_10054792 Ga0268264_100547922 381
316 3300031456 Ga0307513_10061898 Ga0307513_100618983 381
317 3300031507 Ga0307509_10027231 Ga0307509_100272315 381
318 3300033180 Ga0307510_10000191 Ga0307510_1000019130 381
319 3300037312 Ga0395899_0000504 Ga0395899_0000504_18686_19837 381
320 3300037312 Ga0395899_0000615 Ga0395899_0000615_14020_15165 381
321 3300037418 Ga0395900_0000153 Ga0395900_0000153_81679_82830 381
322 3300037466 Ga0395898_0009794 Ga0395898_0009794_1143_2294 381
323 3300037471 Ga0395905_0000188 Ga0395905_0000188_2406_3557 381
324 3300038443 Ga0395901_0000357 Ga0395901_0000357_23514_24665 381
325 3300039437 Ga0436365_0813807 Ga0436365_0813807_147_1304 381
326 3300039437 Ga0436365_1513074 Ga0436365_1513074_1029_2186 381
327 3300039447 Ga0436361_0172871 Ga0436361_0172871_5914_7065 381
328 3300044658 Ga0466972_0000011 Ga0466972_0000011_188032_189189 381
329 3300044842 Ga0466957_0000707 Ga0466957_0000707_13829_14977 381
330 3300045049 Ga0466959_0043909 Ga0466959_0043909_1453_2598 381
331 3300046616 Ga0495668_0004298 Ga0495668_0004298_5229_6383 381
332 3300047443 Ga0495687_011185 Ga0495687_011185_402_1553 381
333 3300049581 Ga0501047_0044487 Ga0501047_0044487_2202_3359 381
334 3300049582 Ga0501048_0210710 Ga0501048_0210710_183_1340 381
335 3300050005 Ga0501284_00003 Ga0501284_00003_52580_53731 381
336 3300053092 Ga0500583_0000004 Ga0500583_0000004_2149_3306 381
337 3300053092 Ga0500583_0006958 Ga0500583_0006958_1402_2562 381
338 3300053151 Ga0500604_0008861 Ga0500604_0008861_1325_2479 381
339 3300053156 Ga0500622_0000305 Ga0500622_0000305_16866_18026 381
340 3300061719 Ga0466962_0100796 Ga0466962_0100796_122_1270 381
341 3300003320 rootH2_10022771 rootH2_100227711 382
342 3300003320 rootH2_10035051 rootH2_1003505115 382
343 3300005327 Ga0070658_10129049 Ga0070658_101290492 382
344 3300005530 Ga0070679_100232791 Ga0070679_1002327911 382
345 3300005548 Ga0070665_100000016 Ga0070665_100000016306 382
346 3300005563 Ga0068855_100461248 Ga0068855_1004612481 382
347 3300005577 Ga0068857_100033587 Ga0068857_1000335873 382
348 3300005577 Ga0068857_100083069 Ga0068857_1000830693 382
349 3300005843 Ga0068860_100000026 Ga0068860_10000002679 382
350 3300009093 Ga0105240_10011065 Ga0105240_1001106511 382
351 3300009174 Ga0105241_10012095 Ga0105241_1001209511 382
352 3300009545 Ga0105237_10000654 Ga0105237_1000065432 382
353 3300009545 Ga0105237_10001091 Ga0105237_1000109137 382
354 3300009545 Ga0105237_10039108 Ga0105237_100391083 382
355 3300009551 Ga0105238_10298794 Ga0105238_102987942 382
356 3300010375 Ga0105239_10000001 Ga0105239_10000001120 382
357 3300010375 Ga0105239_10006124 Ga0105239_1000612411 382
358 3300013102 Ga0157371_10000355 Ga0157371_1000035547 382
359 3300013104 Ga0157370_10152390 Ga0157370_101523901 382
360 3300013105 Ga0157369_10051860 Ga0157369_100518602 382
361 3300013307 Ga0157372_10007153 Ga0157372_1000715311 382
362 3300025250 Ga0209026_1005457 Ga0209026_10054572 382
363 3300025261 Ga0209233_1000738 Ga0209233_100073810 382
364 3300025904 Ga0207647_10000154 Ga0207647_100001543 382
365 3300025913 Ga0207695_10000048 Ga0207695_10000048272 382
366 3300025913 Ga0207695_10026745 Ga0207695_100267454 382
367 3300025914 Ga0207671_10000425 Ga0207671_1000042523 382
368 3300025914 Ga0207671_10001643 Ga0207671_1000164315 382
369 3300025914 Ga0207671_10002948 Ga0207671_100029484 382
370 3300025914 Ga0207671_10169936 Ga0207671_101699362 382
371 3300025924 Ga0207694_10115786 Ga0207694_101157862 382
372 3300025932 Ga0207690_10037139 Ga0207690_100371394 382
373 3300025949 Ga0207667_10005119 Ga0207667_1000511910 382
374 3300026116 Ga0207674_10032469 Ga0207674_100324695 382
375 3300026116 Ga0207674_10076253 Ga0207674_100762534 382
376 3300026142 Ga0207698_10209795 Ga0207698_102097952 382
377 3300028379 Ga0268266_10000034 Ga0268266_10000034175 382
378 3300028381 Ga0268264_10000117 Ga0268264_1000011755 382
379 3300038443 Ga0395901_0268130 Ga0395901_0268130_390_1553 382
380 3300044719 Ga0466971_0016668 Ga0466971_0016668_931_2157 382
381 3300045049 Ga0466959_0006639 Ga0466959_0006639_2911_4074 382
382 3300046523 Ga0495644_0009915 Ga0495644_0009915_1185_2342 382
383 3300053080 Ga0500635_0005650 Ga0500635_0005650_635_1798 382
384 3300061719 Ga0466962_0009342 Ga0466962_0009342_2113_3339 382
385 iso_pu_bacteria 2599185184 2599477230 382
386 iso_pu_bacteria 2919437846 2919441186 382
387 iso_pu_bacteria 2928078545 2928079146 382
388 iso_pu_bacteria 2928147474 2928148483 382
389 iso_pu_bacteria 2932082852 2932085780 382
390 3300009147 Ga0114129_10002497 Ga0114129_1000249713 383
391 3300049581 Ga0501047_0278798 Ga0501047_0278798_120_1280 383
392 3300050507 nmdc:mga05p37_986_c1 nmdc:mga05p37_986_c1_5461_6630 383
393 3300003323 rootH1_10082212 rootH1_100822124 384
394 3300025261 Ga0209233_1020727 Ga0209233_10207272 384
395 3300025931 Ga0207644_10099009 Ga0207644_100990092 384
396 3300025940 Ga0207691_10079943 Ga0207691_100799432 384
397 3300026095 Ga0207676_10069911 Ga0207676_100699112 384
398 3300031456 Ga0307513_10172580 Ga0307513_101725801 384
399 3300001989 JGI24739J22299_10032399 JGI24739J22299_100323991 386
400 3300001990 JGI24737J22298_10000159 JGI24737J22298_100001598 386
401 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001398 386
402 3300002737 JGI25162J39368_1000020 JGI25162J39368_100002063 386
403 3300003322 rootL2_10169438 rootL2_101694383 386
404 3300005327 Ga0070658_10015448 Ga0070658_100154484 386
405 3300005335 Ga0070666_10000208 Ga0070666_1000020810 386
406 3300005336 Ga0070680_100004596 Ga0070680_1000045963 386
407 3300005347 Ga0070668_100168969 Ga0070668_1001689692 386
408 3300005355 Ga0070671_100080816 Ga0070671_1000808163 386
409 3300005458 Ga0070681_10067606 Ga0070681_100676063 386
410 3300005563 Ga0068855_100172511 Ga0068855_1001725111 386
411 3300005578 Ga0068854_100121273 Ga0068854_1001212732 386
412 3300005616 Ga0068852_100012613 Ga0068852_1000126132 386
413 3300005617 Ga0068859_100000006 Ga0068859_100000006192 386
414 3300005618 Ga0068864_100000402 Ga0068864_1000004026 386
415 3300005834 Ga0068851_10005604 Ga0068851_100056042 386
416 3300005842 Ga0068858_100011189 Ga0068858_1000111899 386
417 3300005843 Ga0068860_100000502 Ga0068860_10000050246 386
418 3300005843 Ga0068860_100024681 Ga0068860_1000246812 386
419 3300006195 Ga0075366_10003758 Ga0075366_100037583 386
420 3300006195 Ga0075366_10039847 Ga0075366_100398472 386
421 3300006237 Ga0097621_100002100 Ga0097621_1000021008 386
422 3300006358 Ga0068871_100001822 Ga0068871_10000182213 386
423 3300006881 Ga0068865_100259050 Ga0068865_1002590501 386
424 3300006931 Ga0097620_100000006 Ga0097620_100000006192 386
425 3300009101 Ga0105247_10008494 Ga0105247_100084942 386
426 3300009174 Ga0105241_10000371 Ga0105241_1000037127 386
427 3300009176 Ga0105242_10095944 Ga0105242_100959442 386
428 3300009545 Ga0105237_10001752 Ga0105237_1000175224 386
429 3300009545 Ga0105237_10003858 Ga0105237_100038586 386
430 3300009545 Ga0105237_10005946 Ga0105237_100059468 386
431 3300009545 Ga0105237_10212053 Ga0105237_102120531 386
432 3300009553 Ga0105249_10004744 Ga0105249_100047448 386
433 3300010375 Ga0105239_10000178 Ga0105239_1000017835 386
434 3300010375 Ga0105239_10002741 Ga0105239_100027416 386
435 3300010375 Ga0105239_10360429 Ga0105239_103604292 386
436 3300011119 Ga0105246_10017826 Ga0105246_100178263 386
437 3300013296 Ga0157374_10348893 Ga0157374_103488931 386
438 3300013297 Ga0157378_10059514 Ga0157378_100595143 386
439 3300013306 Ga0163162_10000519 Ga0163162_1000051920 386
440 3300013306 Ga0163162_10010072 Ga0163162_100100726 386
441 3300013307 Ga0157372_10062071 Ga0157372_100620713 386
442 3300013308 Ga0157375_10015483 Ga0157375_100154836 386
443 3300014968 Ga0157379_10051709 Ga0157379_100517093 386
444 3300014969 Ga0157376_10009061 Ga0157376_100090614 386
445 3300025233 Ga0209437_100085 Ga0209437_100085148 386
446 3300025900 Ga0207710_10007293 Ga0207710_100072932 386
447 3300025903 Ga0207680_10000072 Ga0207680_1000007247 386
448 3300025911 Ga0207654_10001247 Ga0207654_100012477 386
449 3300025912 Ga0207707_10021157 Ga0207707_100211573 386
450 3300025914 Ga0207671_10001370 Ga0207671_1000137024 386
451 3300025914 Ga0207671_10002447 Ga0207671_1000244711 386
452 3300025925 Ga0207650_10033701 Ga0207650_100337013 386
453 3300025931 Ga0207644_10088813 Ga0207644_100888132 386
454 3300025934 Ga0207686_10043327 Ga0207686_100433273 386
455 3300025942 Ga0207689_10000383 Ga0207689_1000038316 386
456 3300025981 Ga0207640_10114525 Ga0207640_101145252 386
457 3300025986 Ga0207658_10004378 Ga0207658_100043788 386
458 3300026035 Ga0207703_10009492 Ga0207703_100094922 386
459 3300026088 Ga0207641_10000280 Ga0207641_1000028067 386
460 3300026142 Ga0207698_10004934 Ga0207698_100049346 386
461 3300026142 Ga0207698_10308553 Ga0207698_103085531 386
462 3300028381 Ga0268264_10010047 Ga0268264_100100473 386
463 3300028381 Ga0268264_10010967 Ga0268264_100109672 386
464 3300028794 Ga0307515_10000021 Ga0307515_1000002199 386
465 3300028794 Ga0307515_10002415 Ga0307515_1000241518 386
466 3300033179 Ga0307507_10000217 Ga0307507_1000021729 386
467 3300046471 Ga0495650_0000014 Ga0495650_0000014_73037_74197 386
468 3300046507 Ga0495606_0000241 Ga0495606_0000241_8097_9257 386
469 3300046512 Ga0495610_0001190 Ga0495610_0001190_21760_22920 386
470 3300046513 Ga0495616_0018331 Ga0495616_0018331_1528_2688 386
471 3300046513 Ga0495616_0019098 Ga0495616_0019098_1458_2633 386
472 3300046524 Ga0495648_0060877 Ga0495648_0060877_282_1457 386
473 3300046538 Ga0495609_0030662 Ga0495609_0030662_291_1451 386
474 3300046558 Ga0495633_0000044 Ga0495633_0000044_167444_168616 386
475 3300046660 Ga0495625_0000003 Ga0495625_0000003_162241_163401 386
476 3300046660 Ga0495625_0022413 Ga0495625_0022413_2403_3575 386
477 3300046660 Ga0495625_0131847 Ga0495625_0131847_275_1450 386
478 3300046665 Ga0495661_0003223 Ga0495661_0003223_10948_12108 386
479 3300046665 Ga0495661_0035910 Ga0495661_0035910_451_1611 386
480 3300046694 Ga0495649_0000002 Ga0495649_0000002_843587_844747 386
481 3300046810 Ga0495660_0024895 Ga0495660_0024895_1305_2468 386
482 3300047443 Ga0495687_001250 Ga0495687_001250_18084_19244 386
483 3300047472 Ga0495686_0001054 Ga0495686_0001054_6227_7402 386
484 3300047472 Ga0495686_0105971 Ga0495686_0105971_260_1435 386
485 3300050493 nmdc:mga0k408_17163_c1 nmdc:mga0k408_17163_c1_1297_2469 386
486 3300050493 nmdc:mga0k408_5162_c1 nmdc:mga0k408_5162_c1_1642_2802 386
487 3300053125 Ga0500618_000001 Ga0500618_000001_141918_143090 386
488 3300053125 Ga0500618_010521 Ga0500618_010521_1267_2427 386
489 3300053157 Ga0500624_000333 Ga0500624_000333_10640_11815 386
490 iso_pu_bacteria 2884791551 2884795329 386

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

220

409

0.87

PF07690

MFS_1

Major Facilitator Superfamily

26

244

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.839 9 373
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.816 10 373
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.8115 11 375
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.8107 12 380
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.805 14 380
ID Description Score Start End Superfamily
af_P75810_211_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9569 204 375 1.20.1250.20
af_P75810_10_191_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9548 10 187 1.20.1250.20
af_P75810_10_191_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9296 10 187 1.20.1250.20
af_P76197_209_395_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9231 207 376 1.20.1250.20
af_P17583_194_375_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9132 203 376 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A442U6Y3-F1-model_v4 MFS transporter 0.9377 13 375 GO:0016020
GO:0022857
AF-A0A858RHC3-F1-model_v4 MFS transporter 0.9358 6 380 GO:0016020
GO:0022857
AF-A0A370K127-F1-model_v4 MFS transporter 0.9349 11 375 GO:0016020
GO:0022857
AF-A0A840WRH5-F1-model_v4 MFS family permease 0.9341 11 376 GO:0016020
GO:0022857
AF-A0A0P0D7S1-F1-model_v4 MFS transporter 0.9321 9 376 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
87.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map