F453877

General Info

Members Datasets Scaffolds Average Seq Length
489 282 978 305

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221692|2644517314
Length 360
Sequence RDEAAPAAVPGGFSMTDRLEATPAPVEPAAVLPDDLEPAQPVVLADDAELPVGAEPADITTDTGPTARIIAVVVTHKRRELLAESLKVLASQSRPVDHLIVVDNANEDAVAELVAQQPIEATYLGSRHNLGGAGGFALGMLHALTQGADWVWLADDDGRPDGPEVLAKLIDCARRHNLVEVSPVVCDIDEPDRLAFPLRRGVVWRRLRSELGDEDFLPGIASLFNGALISAKAVDLIGVPDLRLFVRGDEVEVHRRLVRSGLPFGTCLQTAYLHPNGAEEFKPILGGRMHTQYPDDPVKRYFTYRNRGYLMSQPGMRKLLPQEWIRFSWFFLVTRRDPAGLKEWFRLRSLGRNEHFGKPD

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
134 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 2643221692 Nocardia sp. Root136 Isolate Unclassified
231 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
232 2547132424 Nocardia nova SH22a Isolate Unclassified
233 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
234 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
235 2582580736 Prauserella sp. Am3 Isolate Unclassified
236 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
237 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
238 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
239 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
240 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
241 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
242 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
243 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
244 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
245 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
246 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
247 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
248 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
249 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
250 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
251 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
252 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
253 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
254 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
255 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
256 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
257 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
258 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
259 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
260 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
261 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
262 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
263 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
264 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
265 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
266 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
267 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
268 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
269 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
270 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
271 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
272 2922554459 Rhodococcus sp. 66b Isolate Unclassified
273 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
274 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
275 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
276 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
277 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
278 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
279 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
280 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
281 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
282 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.16
Metatranscriptomes 0
Isolates 10.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 13.09
Nodule 0.2
Rhizoplane 10.43
Rhizosphere 58.08
Stem 0
Stem Tuber 0.2
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1005464 3300002073 Bacteria 1387
2 JGI24742J22300_10002583 3300002244 Bacteria 2896
3 Ga0055540_1000127 3300003792 Bacteria 77764
4 Ga0055540_1000638 3300003792 Bacteria 24867
5 Ga0055540_1004693 3300003792 Bacteria 6056
6 Ga0070676_10146116 3300005328 Bacteria 1509
7 Ga0070683_100131080 3300005329 Bacteria 2372
8 Ga0070683_100404471 3300005329 Bacteria 1302
9 Ga0070683_100432280 3300005329 Bacteria 1256
10 Ga0070670_100072505 3300005331 Bacteria 2957
11 Ga0068869_100018890 3300005334 Bacteria 4700
12 Ga0070666_10108311 3300005335 Bacteria 1920
13 Ga0070682_100006294 3300005337 Bacteria 6659
14 Ga0070682_100114359 3300005337 Bacteria 1803
15 Ga0068868_100220550 3300005338 Bacteria 1587
16 Ga0068868_100229031 3300005338 Bacteria 1558
17 Ga0068868_100391342 3300005338 Bacteria 1198
18 Ga0070660_100305608 3300005339 Bacteria 1304
19 Ga0070689_100098088 3300005340 Bacteria 2317
20 Ga0070687_100012990 3300005343 Bacteria 3696
21 Ga0070661_100311803 3300005344 Bacteria 1227
22 Ga0070668_100005619 3300005347 Bacteria 9295
23 Ga0070668_100140839 3300005347 Bacteria 1943
24 Ga0070669_100010575 3300005353 Bacteria 6552
25 Ga0070669_100153024 3300005353 Bacteria 1787
26 Ga0070671_100308760 3300005355 Bacteria 1347
27 Ga0070674_100051270 3300005356 Bacteria 2843
28 Ga0070659_100026431 3300005366 Bacteria 4467
29 Ga0070667_100000364 3300005367 Bacteria 49361
30 Ga0070667_100104707 3300005367 Bacteria 2448
31 Ga0070667_100170421 3300005367 Bacteria 1921
32 Ga0070667_100184425 3300005367 Bacteria 1846
33 Ga0070667_100225445 3300005367 Bacteria 1669
34 Ga0070709_10083953 3300005434 Bacteria 2085
35 Ga0070714_100041829 3300005435 Bacteria 3869
36 Ga0070714_100148170 3300005435 Bacteria 2112
37 Ga0070714_100322966 3300005435 Bacteria 1444
38 Ga0070710_10038237 3300005437 Bacteria 2634
39 Ga0070700_100189349 3300005441 Bacteria 1437
40 Ga0070663_100003658 3300005455 Bacteria 8906
41 Ga0070663_100037154 3300005455 Bacteria 3389
42 Ga0070663_100249099 3300005455 Bacteria 1405
43 Ga0070678_100121891 3300005456 Bacteria 2057
44 Ga0068867_100325029 3300005459 Bacteria 1276
45 Ga0070685_10008844 3300005466 Bacteria 5191
46 Ga0068853_100018651 3300005539 Bacteria 5744
47 Ga0070686_100051087 3300005544 Bacteria 2630
48 Ga0070665_100060873 3300005548 Bacteria 3785
49 Ga0070665_100321213 3300005548 Bacteria 1552
50 Ga0070664_100164241 3300005564 Bacteria 1966
51 Ga0070664_100203262 3300005564 Bacteria 1768
52 Ga0068857_100063822 3300005577 Bacteria 3274
53 Ga0068854_100015435 3300005578 Bacteria 5059
54 Ga0068854_100247884 3300005578 Bacteria 1421
55 Ga0068852_100070058 3300005616 Bacteria 3075
56 Ga0068852_100521597 3300005616 Bacteria 1185
57 Ga0068859_100023413 3300005617 Bacteria 6197
58 Ga0068864_100070380 3300005618 Bacteria 3044
59 Ga0068866_10183431 3300005718 Bacteria 1238
60 Ga0068861_100058263 3300005719 Bacteria 2953
61 Ga0068863_100001544 3300005841 Bacteria 22729
62 Ga0068863_100027470 3300005841 Bacteria 5428
63 Ga0068858_100156673 3300005842 Bacteria 2143
64 Ga0068858_100268462 3300005842 Bacteria 1623
65 Ga0068860_100000480 3300005843 Bacteria 49553
66 Ga0068860_100086371 3300005843 Bacteria 2985
67 Ga0068860_100477764 3300005843 Bacteria 1242
68 Ga0068862_100003092 3300005844 Bacteria 14511
69 Ga0075365_10006226 3300006038 Bacteria 6542
70 Ga0075365_10011534 3300006038 Bacteria 5199
71 Ga0075365_10024436 3300006038 Bacteria 3812
72 Ga0075365_10062177 3300006038 Bacteria 2496
73 Ga0075365_10083344 3300006038 Bacteria 2169
74 Ga0075365_10093252 3300006038 Bacteria 2054
75 Ga0075365_10264812 3300006038 Bacteria 1209
76 Ga0075363_100008942 3300006048 Bacteria 4689
77 Ga0075363_100027186 3300006048 Bacteria 2932
78 Ga0075363_100029747 3300006048 Bacteria 2822
79 Ga0075363_100055855 3300006048 Bacteria 2116
80 Ga0075364_10026686 3300006051 Bacteria 3686
81 Ga0075364_10055171 3300006051 Bacteria 2599
82 Ga0075364_10083584 3300006051 Bacteria 2113
83 Ga0075364_10084502 3300006051 Bacteria 2102
84 Ga0075364_10149918 3300006051 Bacteria 1571
85 Ga0075362_10034695 3300006177 Bacteria 2200
86 Ga0075367_10018764 3300006178 Bacteria 3822
87 Ga0075369_10002483 3300006186 Bacteria 6586
88 Ga0075369_10004574 3300006186 Bacteria 5128
89 Ga0075366_10046351 3300006195 Bacteria 2576
90 Ga0075370_10015997 3300006353 Bacteria 4030
91 Ga0075370_10065506 3300006353 Bacteria 2072
92 Ga0075370_10072210 3300006353 Bacteria 1975
93 Ga0075370_10099684 3300006353 Bacteria 1680
94 Ga0075428_100221909 3300006844 Bacteria 2041
95 Ga0075428_100663412 3300006844 Bacteria 1112
96 Ga0097620_100023416 3300006931 Bacteria 6197
97 Ga0099795_10003398 3300007788 Bacteria 3934
98 Ga0105250_10086292 3300009092 Bacteria 1274
99 Ga0111539_10300497 3300009094 Bacteria 1868
100 Ga0105247_10000089 3300009101 Bacteria 98925
101 Ga0105247_10038607 3300009101 Bacteria 2916
102 Ga0105247_10172792 3300009101 Bacteria 1438
103 Ga0105243_10332524 3300009148 Bacteria 1388
104 Ga0105242_10032662 3300009176 Bacteria 4163
105 Ga0105248_10001655 3300009177 Bacteria 24793
106 Ga0105237_10011932 3300009545 Bacteria 9184
107 Ga0105237_10072477 3300009545 Bacteria 3438
108 Ga0105238_10205436 3300009551 Bacteria 1946
109 Ga0105238_10588498 3300009551 Bacteria 1120
110 Ga0105249_10004181 3300009553 Bacteria 12462
111 Ga0105249_10135779 3300009553 Bacteria 2353
112 Ga0105239_10003567 3300010375 Bacteria 19027
113 Ga0105239_10049723 3300010375 Bacteria 4597
114 Ga0105239_10055107 3300010375 Bacteria 4361
115 Ga0157370_10250893 3300013104 Bacteria 1637
116 Ga0163162_10437033 3300013306 Bacteria 1441
117 Ga0157372_10189279 3300013307 Bacteria 2383
118 Ga0157375_10215000 3300013308 Bacteria 2080
119 Ga0163163_10077182 3300014325 Bacteria 3327
120 Ga0157380_10058071 3300014326 Bacteria 3084
121 Ga0157379_10030774 3300014968 Bacteria 4780
122 Ga0157379_10064720 3300014968 Bacteria 3267
123 Ga0163161_10155029 3300017792 Bacteria 1743
124 Ga0213876_10005150 3300021384 Bacteria 7208
125 Ga0213876_10062902 3300021384 Bacteria 1959
126 Ga0213875_10002397 3300021388 Bacteria 11279
127 Ga0213875_10015473 3300021388 Bacteria 3712
128 Ga0213875_10127739 3300021388 Bacteria 1188
129 Ga0209051_1000014 3300025303 Bacteria 552732
130 Ga0209051_1000649 3300025303 Bacteria 39520
131 Ga0209051_1012804 3300025303 Bacteria 4036
132 Ga0209051_1012898 3300025303 Bacteria 4012
133 Ga0207642_10128858 3300025899 Bacteria 1317
134 Ga0207710_10000117 3300025900 Bacteria 98934
135 Ga0207699_10021941 3300025906 Bacteria 3451
136 Ga0207645_10027663 3300025907 Bacteria 3660
137 Ga0207654_10206581 3300025911 Bacteria 1296
138 Ga0207707_10502738 3300025912 Bacteria 1034
139 Ga0207671_10017648 3300025914 Bacteria 5497
140 Ga0207662_10003732 3300025918 Bacteria 7898
141 Ga0207657_10033309 3300025919 Bacteria 4646
142 Ga0207652_10379846 3300025921 Bacteria 1275
143 Ga0207681_10000981 3300025923 Bacteria 18645
144 Ga0207687_10051560 3300025927 Bacteria 2869
145 Ga0207664_10064267 3300025929 Bacteria 2934
146 Ga0207664_10160041 3300025929 Bacteria 1920
147 Ga0207664_10213658 3300025929 Bacteria 1670
148 Ga0207664_10218268 3300025929 Bacteria 1653
149 Ga0207664_10264034 3300025929 Bacteria 1506
150 Ga0207644_10010354 3300025931 Bacteria 6146
151 Ga0207690_10310706 3300025932 Bacteria 1236
152 Ga0207686_10078452 3300025934 Bacteria 2147
153 Ga0207709_10014345 3300025935 Bacteria 4374
154 Ga0207704_10250957 3300025938 Bacteria 1328
155 Ga0207691_10103703 3300025940 Bacteria 2536
156 Ga0207711_10000738 3300025941 Bacteria 32123
157 Ga0207689_10321100 3300025942 Bacteria 1285
158 Ga0207679_10423414 3300025945 Bacteria 1175
159 Ga0207712_10002271 3300025961 Bacteria 12472
160 Ga0207668_10141406 3300025972 Bacteria 1851
161 Ga0207668_10397565 3300025972 Bacteria 1164
162 Ga0207658_10000680 3300025986 Bacteria 29606
163 Ga0207658_10068275 3300025986 Bacteria 2681
164 Ga0207658_10201176 3300025986 Bacteria 1663
165 Ga0207658_10336222 3300025986 Bacteria 1311
166 Ga0207677_10197270 3300026023 Bacteria 1597
167 Ga0207677_10263034 3300026023 Bacteria 1407
168 Ga0207677_10502088 3300026023 Bacteria 1049
169 Ga0207703_10087618 3300026035 Bacteria 2611
170 Ga0207703_10178825 3300026035 Bacteria 1871
171 Ga0207639_10021723 3300026041 Bacteria 4613
172 Ga0207678_10000033 3300026067 Bacteria 105464
173 Ga0207678_10056196 3300026067 Bacteria 3388
174 Ga0207678_10217033 3300026067 Bacteria 1637
175 Ga0207678_10370509 3300026067 Bacteria 1237
176 Ga0207708_10040920 3300026075 Bacteria 3534
177 Ga0207702_10364167 3300026078 Bacteria 1386
178 Ga0207641_10001265 3300026088 Bacteria 25170
179 Ga0207641_10150602 3300026088 Bacteria 2107
180 Ga0207648_10117659 3300026089 Bacteria 2335
181 Ga0207676_10078327 3300026095 Bacteria 2677
182 Ga0207676_10259369 3300026095 Bacteria 1568
183 Ga0207674_10115800 3300026116 Bacteria 2652
184 Ga0207675_100088777 3300026118 Bacteria 2904
185 Ga0207683_10073901 3300026121 Bacteria 3016
186 Ga0209813_10004918 3300027866 Bacteria 3218
187 Ga0268266_10073226 3300028379 Bacteria 2972
188 Ga0268266_10108102 3300028379 Bacteria 2461
189 Ga0268266_10125070 3300028379 Bacteria 2293
190 Ga0268265_10002308 3300028380 Bacteria 14529
191 Ga0268264_10000503 3300028381 Bacteria 50726
192 Ga0268264_10491720 3300028381 Bacteria 1195
193 Ga0307515_10042606 3300028794 Bacteria 7093
194 Ga0265327_10000001 3300031251 Bacteria 894475
195 Ga0265327_10000113 3300031251 Bacteria 175267
196 Ga0265327_10001712 3300031251 Bacteria 26120
197 Ga0265327_10081875 3300031251 Bacteria 1593
198 Ga0307513_10150460 3300031456 Bacteria 2237
199 Ga0307410_10092837 3300031852 Bacteria 2147
200 Ga0307406_10070997 3300031901 Bacteria 2281
201 Ga0307406_10124536 3300031901 Bacteria 1798
202 Ga0307409_100000751 3300031995 Bacteria 14618
203 Ga0307416_100112242 3300032002 Bacteria 2405
204 Ga0307507_10042509 3300033179 Bacteria 4526
205 Ga0373956_0002622 3300035119 Bacteria 7291
206 Ga0316584_0129196 3300036712 Bacteria 1887
207 Ga0373925_0267331 3300037068 Bacteria 1375
208 Ga0395898_0043208 3300037466 Bacteria 4442
209 Ga0436364_0475075 3300037853 Bacteria 64774
210 Ga0436364_0636212 3300037853 Bacteria 4687
211 Ga0436364_1225776 3300037853 Bacteria 23812
212 Ga0436365_0204440 3300039437 Bacteria 69949
213 Ga0436365_0429891 3300039437 Bacteria 4987
214 Ga0436365_1091168 3300039437 Bacteria 34943
215 Ga0436365_1541644 3300039437 Bacteria 6062
216 Ga0436365_1771144 3300039437 Bacteria 2801
217 Ga0439466_0002141 3300041411 Bacteria 7745
218 Ga0439465_0000056 3300041413 Bacteria 24000
219 Ga0439465_0006460 3300041413 Bacteria 3725
220 Ga0451802_1948664 3300041460 Bacteria 1404
221 Ga0439445_0001364 3300042004 Bacteria 5292
222 Ga0466972_0001846 3300044658 Bacteria 10374
223 Ga0466972_0003037 3300044658 Bacteria 8322
224 Ga0466972_0007899 3300044658 Bacteria 5334
225 Ga0466972_0027837 3300044658 Bacteria 2794
226 Ga0466972_0058266 3300044658 Bacteria 1855
227 Ga0466965_0000276 3300044683 Bacteria 16929
228 Ga0466965_0002495 3300044683 Bacteria 7832
229 Ga0466965_0025371 3300044683 Bacteria 2869
230 Ga0466966_0026107 3300044684 Bacteria 3814
231 Ga0466966_0143757 3300044684 Bacteria 1457
232 Ga0466961_0133438 3300044693 Bacteria 1556
233 Ga0466961_0190910 3300044693 Bacteria 1270
234 Ga0466963_0017831 3300044694 Bacteria 4430
235 Ga0466963_0082250 3300044694 Bacteria 2182
236 Ga0466963_0176706 3300044694 Bacteria 1490
237 Ga0466963_0184434 3300044694 Bacteria 1457
238 Ga0466963_0238800 3300044694 Bacteria 1274
239 Ga0466963_0252100 3300044694 Bacteria 1239
240 Ga0466964_0115848 3300044706 Bacteria 1201
241 Ga0466970_0083718 3300044765 Bacteria 1726
242 Ga0466970_0119355 3300044765 Bacteria 1444
243 Ga0466957_0032762 3300044842 Bacteria 3113
244 Ga0466957_0042217 3300044842 Bacteria 2758
245 Ga0466957_0043863 3300044842 Bacteria 2709
246 Ga0466957_0222617 3300044842 Bacteria 1246
247 Ga0466960_0001321 3300044901 Bacteria 8987
248 Ga0466960_0001779 3300044901 Bacteria 7909
249 Ga0466960_0014246 3300044901 Bacteria 3399
250 Ga0466960_0027743 3300044901 Bacteria 2586
251 Ga0466959_0011700 3300045049 Bacteria 6311
252 Ga0466959_0067287 3300045049 Bacteria 2597
253 Ga0466959_0192377 3300045049 Bacteria 1423
254 Ga0466958_0074994 3300045836 Bacteria 2074
255 Ga0466967_0003446 3300045976 Bacteria 10325
256 Ga0466967_0087182 3300045976 Bacteria 2829
257 Ga0466967_0122589 3300045976 Bacteria 2404
258 Ga0466967_0129033 3300045976 Bacteria 2345
259 Ga0466967_0153179 3300045976 Bacteria 2157
260 Ga0466967_0360230 3300045976 Bacteria 1409
261 Ga0466967_0504695 3300045976 Bacteria 1187
262 Ga0495603_0054531 3300046455 Bacteria 2369
263 Ga0495629_0068765 3300046459 Bacteria 2471
264 Ga0495638_0000355 3300046460 Bacteria 57159
265 Ga0495638_0019179 3300046460 Bacteria 4527
266 Ga0495582_0038059 3300046473 Bacteria 2646
267 Ga0495639_0098432 3300046475 Bacteria 1379
268 Ga0495607_0014955 3300046501 Bacteria 5045
269 Ga0495648_0001604 3300046524 Bacteria 22021
270 Ga0495665_0035750 3300046531 Bacteria 2653
271 Ga0495665_0042666 3300046531 Bacteria 2414
272 Ga0495656_0136584 3300046615 Bacteria 1172
273 Ga0495668_0000167 3300046616 Bacteria 97427
274 Ga0495611_0070952 3300046648 Bacteria 1592
275 Ga0495624_0090884 3300046690 Bacteria 1884
276 Ga0495581_0012231 3300047315 Bacteria 4970
277 Ga0495581_0157485 3300047315 Bacteria 1327
278 Ga0495672_0001082 3300047320 Bacteria 27689
279 Ga0495683_0001255 3300047323 Bacteria 17202
280 Ga0495673_0001541 3300047469 Bacteria 18121
281 Ga0495686_0032509 3300047472 Bacteria 3377
282 Ga0495593_0002187 3300047673 Bacteria 11696
283 Ga0495614_0043016 3300048089 Bacteria 1937
284 Ga0496100_0000043 3300048903 Bacteria 89692
285 Ga0496100_0014806 3300048903 Bacteria 4538
286 Ga0496100_0017673 3300048903 Bacteria 4216
287 Ga0496101_0000050 3300048904 Bacteria 144545
288 Ga0496101_0000149 3300048904 Bacteria 60550
289 Ga0496101_0001052 3300048904 Bacteria 16316
290 Ga0496101_0003555 3300048904 Bacteria 9721
291 Ga0496101_0008233 3300048904 Bacteria 6807
292 Ga0496101_0076612 3300048904 Bacteria 2464
293 Ga0496101_0077428 3300048904 Bacteria 2451
294 Ga0496102_0000001 3300048905 Bacteria 873433
295 Ga0496102_0000399 3300048905 Bacteria 50723
296 Ga0496102_0002651 3300048905 Bacteria 15211
297 Ga0496102_0048536 3300048905 Bacteria 3860
298 Ga0496102_0407213 3300048905 Bacteria 1278
299 Ga0496103_0000007 3300048906 Bacteria 354915
300 Ga0496103_0000152 3300048906 Bacteria 72428
301 Ga0496103_0000861 3300048906 Bacteria 22084
302 Ga0496103_0095082 3300048906 Bacteria 1883
303 Ga0496105_0042005 3300048908 Bacteria 3769
304 Ga0496105_0127937 3300048908 Bacteria 2094
305 Ga0496106_0000354 3300048909 Bacteria 32433
306 Ga0496106_0020168 3300048909 Bacteria 4945
307 Ga0496106_0086345 3300048909 Bacteria 2416
308 Ga0496107_0000154 3300048910 Bacteria 34838
309 Ga0496107_0172275 3300048910 Bacteria 1606
310 Ga0496107_0483765 3300048910 Bacteria 918
311 Ga0496108_0001025 3300048911 Bacteria 21763
312 Ga0496108_0070881 3300048911 Bacteria 2941
313 Ga0496108_0089947 3300048911 Bacteria 2609
314 Ga0496108_0179961 3300048911 Bacteria 1831
315 Ga0496109_0000194 3300048912 Bacteria 60448
316 Ga0496109_0059283 3300048912 Bacteria 3497
317 Ga0496109_0095695 3300048912 Bacteria 2750
318 Ga0496109_0187502 3300048912 Bacteria 1943
319 Ga0496110_0125123 3300048913 Bacteria 2319
320 Ga0496110_0213083 3300048913 Bacteria 1756
321 Ga0496111_0185697 3300048914 Bacteria 1546
322 Ga0496112_0011240 3300048915 Bacteria 8166
323 Ga0496112_0016985 3300048915 Bacteria 6830
324 Ga0496112_0118019 3300048915 Bacteria 2623
325 Ga0496113_0048352 3300048916 Bacteria 3164
326 Ga0496113_0091044 3300048916 Bacteria 2350
327 Ga0496113_0376878 3300048916 Bacteria 1139
328 Ga0496114_0000565 3300048917 Bacteria 27454
329 Ga0496114_0116541 3300048917 Bacteria 2293
330 Ga0496114_0281892 3300048917 Bacteria 1465
331 Ga0496115_0003893 3300048918 Bacteria 10757
332 Ga0496115_0057795 3300048918 Bacteria 3120
333 Ga0496115_0147212 3300048918 Bacteria 1944
334 Ga0496116_0000018 3300048919 Bacteria 545877
335 Ga0496116_0006988 3300048919 Bacteria 10113
336 Ga0496117_0000015 3300048920 Bacteria 583316
337 Ga0496117_0007758 3300048920 Bacteria 10364
338 Ga0496117_0016646 3300048920 Bacteria 6187
339 Ga0496118_0000012 3300048921 Bacteria 583316
340 Ga0496118_0001082 3300048921 Bacteria 42392
341 Ga0496118_0001705 3300048921 Bacteria 32141
342 Ga0496118_0004854 3300048921 Bacteria 15656
343 Ga0496119_0000172 3300048922 Bacteria 91464
344 Ga0496119_0001151 3300048922 Bacteria 33191
345 Ga0496119_0003415 3300048922 Bacteria 16502
346 Ga0496120_0000155 3300048923 Bacteria 114046
347 Ga0496120_0022303 3300048923 Bacteria 3985
348 Ga0496120_0025799 3300048923 Bacteria 3643
349 Ga0496120_0035799 3300048923 Bacteria 2961
350 Ga0496121_0000048 3300048924 Bacteria 330242
351 Ga0496121_0001740 3300048924 Bacteria 35570
352 Ga0496121_0008039 3300048924 Bacteria 12574
353 Ga0496122_0000301 3300048925 Bacteria 109636
354 Ga0496122_0024943 3300048925 Bacteria 5217
355 Ga0496123_0003557 3300048926 Bacteria 17285
356 Ga0496123_0008036 3300048926 Bacteria 9767
357 Ga0496124_0000044 3300048927 Bacteria 289064
358 Ga0496124_0221861 3300048927 Bacteria 1421
359 Ga0496125_0000037 3300048928 Bacteria 330242
360 Ga0496125_0004133 3300048928 Bacteria 16948
361 Ga0496125_0073616 3300048928 Bacteria 2654
362 Ga0496125_0135588 3300048928 Bacteria 1723
363 Ga0496126_0000046 3300048929 Bacteria 330242
364 Ga0496126_0000920 3300048929 Bacteria 50943
365 Ga0496126_0001956 3300048929 Bacteria 29218
366 Ga0496126_0016321 3300048929 Bacteria 7430
367 Ga0496126_0042616 3300048929 Bacteria 4191
368 Ga0496126_0060055 3300048929 Bacteria 3421
369 Ga0496126_0310981 3300048929 Bacteria 1297
370 Ga0501031_0082887 3300049568 Bacteria 2090
371 Ga0501032_0004276 3300049569 Bacteria 10782
372 Ga0501032_0029022 3300049569 Bacteria 3799
373 Ga0501033_0054506 3300049570 Bacteria 2958
374 Ga0501033_0187712 3300049570 Bacteria 1480
375 Ga0501034_0012193 3300049571 Bacteria 8889
376 Ga0501034_0018645 3300049571 Bacteria 7113
377 Ga0501034_0023625 3300049571 Bacteria 6262
378 Ga0501036_0033055 3300049572 Bacteria 4374
379 Ga0501036_0310042 3300049572 Bacteria 1319
380 Ga0501037_0000709 3300049573 Bacteria 25325
381 Ga0501037_0090829 3300049573 Bacteria 2208
382 Ga0501038_0000030 3300049574 Bacteria 132455
383 Ga0501043_0001589 3300049579 Bacteria 19750
384 Ga0501046_0000628 3300049580 Bacteria 34641
385 Ga0501047_0007282 3300049581 Bacteria 10401
386 Ga0501047_0007604 3300049581 Bacteria 10198
387 Ga0501048_0004665 3300049582 Bacteria 10430
388 Ga0501067_0175913 3300049583 Bacteria 1192
389 Ga0501069_0051101 3300049585 Bacteria 2300
390 Ga0501070_0001530 3300049586 Bacteria 20572
391 Ga0501070_0005079 3300049586 Bacteria 11217
392 Ga0501070_0130369 3300049586 Bacteria 2077
393 Ga0501073_0108210 3300049589 Bacteria 1929
394 Ga0501080_0211805 3300049742 Bacteria 1776
395 Ga0501083_0037722 3300049744 Bacteria 3289
396 Ga0501035_0000229 3300049822 Bacteria 66514
397 Ga0501035_0001480 3300049822 Bacteria 24041
398 Ga0501044_0000880 3300049823 Bacteria 36201
399 Ga0501044_0006629 3300049823 Bacteria 12768
400 Ga0501044_0011895 3300049823 Bacteria 9431
401 Ga0501044_0014099 3300049823 Bacteria 8629
402 Ga0501044_0170246 3300049823 Bacteria 2150
403 nmdc:mga03683_28758_c1 3300050489 Bacteria 2212
404 nmdc:mga03n38_100657_c1 3300050490 Bacteria 1393
405 nmdc:mga03n38_8539_c1 3300050490 Bacteria 3683
406 nmdc:mga03n38_9350_c1 3300050490 Bacteria 3563
407 nmdc:mga00v17_32160_c1 3300050491 Bacteria 3100
408 nmdc:mga00v17_33477_c1 3300050491 Bacteria 3045
409 nmdc:mga00v17_43101_c1 3300050491 Bacteria 2716
410 nmdc:mga00v17_56873_c1 3300050491 Bacteria 2392
411 nmdc:mga00v17_57422_c1 3300050491 Bacteria 2381
412 nmdc:mga00v17_7765_c1 3300050491 Bacteria 5748
413 nmdc:mga0yw44_15634_c2 3300050492 Bacteria 3365
414 nmdc:mga0yw44_307413_c1 3300050492 Bacteria 1063
415 nmdc:mga0yw44_49093_c1 3300050492 Bacteria 2188
416 nmdc:mga0yw44_52061_c1 3300050492 Bacteria 2481
417 nmdc:mga0yw44_54274_c1 3300050492 Bacteria 2435
418 nmdc:mga0yw44_89454_c1 3300050492 Bacteria 1943
419 nmdc:mga0k408_61875_c1 3300050493 Bacteria 2176
420 nmdc:mga04h51_39021_c1 3300050495 Bacteria 1541
421 nmdc:mga07m45_100391_c1 3300050496 Bacteria 1662
422 nmdc:mga07m45_174308_c1 3300050496 Bacteria 1250
423 nmdc:mga07m45_17456_c1 3300050496 Bacteria 3855
424 nmdc:mga08y16_38030_c1 3300050511 Bacteria 5052
425 nmdc:mga0sz30_25434_c1 3300050516 Bacteria 2420
426 nmdc:mga0sz30_39135_c1 3300050516 Bacteria 1989
427 Ga0500635_0048782 3300053080 Bacteria 1443
428 Ga0495619_0165352 3300053085 Bacteria 1529
429 Ga0500643_015511 3300053087 Bacteria 2609
430 Ga0500641_0063774 3300053096 Bacteria 1538
431 Ga0500562_004842 3300053108 Bacteria 3391
432 Ga0500652_035522 3300053131 Bacteria 1980
433 Ga0500559_0019013 3300053136 Bacteria 2903
434 Ga0500616_0010632 3300053153 Bacteria 5492
435 Ga0500645_000004 3300053730 Bacteria 305014
436 Ga0466962_0016909 3300061719 Bacteria 3515
437 2644517314 2643221692 Bacteria 7282860
438 2523384182 2523231044 Bacteria 6434991
439 2548692441 2547132424 Bacteria 8348532
440 2558910363 2558860112 Bacteria 9931328
441 2566994615 2565956761 Bacteria 6601618
442 2583148728 2582580736 Bacteria 5325865
443 2586057611 2585427649 Bacteria 9053857
444 2643853275 2643221567 Bacteria 4163945
445 2644137237 2643221624 Bacteria 4384879
446 2644639950 2643221715 Bacteria 6671032
447 2738663873 2738541264 Bacteria 5935393
448 2738703217 2738541274 Bacteria 6909446
449 2738891119 2738541308 Bacteria 7020677
450 2739143008 2738541356 Bacteria 5935017
451 2739206417 2738543005 Bacteria 5278128
452 2739239228 2738543011 Bacteria 5731169
453 2739329319 2738543028 Bacteria 6917070
454 2739362984 2738543034 Bacteria 6084756
455 2744956096 2744054611 Bacteria 5611514
456 2753036805 2751185725 Bacteria 5740550
457 2753324676 2751185792 Bacteria 5739090
458 2808874037 2808606365 Bacteria 4301966
459 2809585781 2808606522 Bacteria 9488490
460 2842136190 2842134933 Bacteria 5847019
461 2842892244 2842888712 Bacteria 4279094
462 2866612266 2866612099 Bacteria 7543886
463 2889304182 2889300758 Bacteria 5690814
464 2899376279 2899370129 Bacteria 6781179
465 2902795286 2902792274 Bacteria 7270173
466 2902800381 2902799365 Bacteria 5419524
467 2902810919 2902810491 Bacteria 6794147
468 2902842895 2902837492 Bacteria 6697721
469 2904536138 2904535858 Bacteria 6308016
470 2904768351 2904765812 Bacteria 5369154
471 2904775784 2904770941 Bacteria 5580202
472 2908815676 2908811453 Bacteria 5478616
473 2915771476 2915768154 Bacteria 8424322
474 2917745092 2917736166 Bacteria 9690793
475 2919421722 2919420072 Bacteria 5390363
476 2919434720 2919432681 Bacteria 5390474
477 2919446994 2919446982 Bacteria 3994487
478 2919714766 2919713450 Bacteria 7431245
479 2922558068 2922554459 Bacteria 6683962
480 2928147080 2928142448 Bacteria 5288925
481 2929218410 2929212328 Bacteria 7708288
482 2932400059 2932398195 Bacteria 3847976
483 2939583614 2939582691 Bacteria 7088898
484 2939745424 2939743619 Bacteria 5762299
485 2956940716 2956939328 Bacteria 3474458
486 2974319675 2974315732 Bacteria 4602776
487 2984523541 2984523437 Bacteria 4508481
488 3001120396 3001119090 Bacteria 3449530
489 8003314472 8003314358 Bacteria 10575343
490 JGI24745J21846_1005464
491 JGI24742J22300_10002583
492 Ga0055540_1000127
493 Ga0055540_1000638
494 Ga0055540_1004693
495 Ga0070676_10146116
496 Ga0070683_100131080
497 Ga0070683_100404471
498 Ga0070683_100432280
499 Ga0070670_100072505
500 Ga0068869_100018890
501 Ga0070666_10108311
502 Ga0070682_100006294
503 Ga0070682_100114359
504 Ga0068868_100220550
505 Ga0068868_100229031
506 Ga0068868_100391342
507 Ga0070660_100305608
508 Ga0070689_100098088
509 Ga0070687_100012990
510 Ga0070661_100311803
511 Ga0070668_100005619
512 Ga0070668_100140839
513 Ga0070669_100010575
514 Ga0070669_100153024
515 Ga0070671_100308760
516 Ga0070674_100051270
517 Ga0070659_100026431
518 Ga0070667_100000364
519 Ga0070667_100104707
520 Ga0070667_100170421
521 Ga0070667_100184425
522 Ga0070667_100225445
523 Ga0070709_10083953
524 Ga0070714_100041829
525 Ga0070714_100148170
526 Ga0070714_100322966
527 Ga0070710_10038237
528 Ga0070700_100189349
529 Ga0070663_100003658
530 Ga0070663_100037154
531 Ga0070663_100249099
532 Ga0070678_100121891
533 Ga0068867_100325029
534 Ga0070685_10008844
535 Ga0068853_100018651
536 Ga0070686_100051087
537 Ga0070665_100060873
538 Ga0070665_100321213
539 Ga0070664_100164241
540 Ga0070664_100203262
541 Ga0068857_100063822
542 Ga0068854_100015435
543 Ga0068854_100247884
544 Ga0068852_100070058
545 Ga0068852_100521597
546 Ga0068859_100023413
547 Ga0068864_100070380
548 Ga0068866_10183431
549 Ga0068861_100058263
550 Ga0068863_100001544
551 Ga0068863_100027470
552 Ga0068858_100156673
553 Ga0068858_100268462
554 Ga0068860_100000480
555 Ga0068860_100086371
556 Ga0068860_100477764
557 Ga0068862_100003092
558 Ga0075365_10006226
559 Ga0075365_10011534
560 Ga0075365_10024436
561 Ga0075365_10062177
562 Ga0075365_10083344
563 Ga0075365_10093252
564 Ga0075365_10264812
565 Ga0075363_100008942
566 Ga0075363_100027186
567 Ga0075363_100029747
568 Ga0075363_100055855
569 Ga0075364_10026686
570 Ga0075364_10055171
571 Ga0075364_10083584
572 Ga0075364_10084502
573 Ga0075364_10149918
574 Ga0075362_10034695
575 Ga0075367_10018764
576 Ga0075369_10002483
577 Ga0075369_10004574
578 Ga0075366_10046351
579 Ga0075370_10015997
580 Ga0075370_10065506
581 Ga0075370_10072210
582 Ga0075370_10099684
583 Ga0075428_100221909
584 Ga0075428_100663412
585 Ga0097620_100023416
586 Ga0099795_10003398
587 Ga0105250_10086292
588 Ga0111539_10300497
589 Ga0105247_10000089
590 Ga0105247_10038607
591 Ga0105247_10172792
592 Ga0105243_10332524
593 Ga0105242_10032662
594 Ga0105248_10001655
595 Ga0105237_10011932
596 Ga0105237_10072477
597 Ga0105238_10205436
598 Ga0105238_10588498
599 Ga0105249_10004181
600 Ga0105249_10135779
601 Ga0105239_10003567
602 Ga0105239_10049723
603 Ga0105239_10055107
604 Ga0157370_10250893
605 Ga0163162_10437033
606 Ga0157372_10189279
607 Ga0157375_10215000
608 Ga0163163_10077182
609 Ga0157380_10058071
610 Ga0157379_10030774
611 Ga0157379_10064720
612 Ga0163161_10155029
613 Ga0213876_10005150
614 Ga0213876_10062902
615 Ga0213875_10002397
616 Ga0213875_10015473
617 Ga0213875_10127739
618 Ga0209051_1000014
619 Ga0209051_1000649
620 Ga0209051_1012804
621 Ga0209051_1012898
622 Ga0207642_10128858
623 Ga0207710_10000117
624 Ga0207699_10021941
625 Ga0207645_10027663
626 Ga0207654_10206581
627 Ga0207707_10502738
628 Ga0207671_10017648
629 Ga0207662_10003732
630 Ga0207657_10033309
631 Ga0207652_10379846
632 Ga0207681_10000981
633 Ga0207687_10051560
634 Ga0207664_10064267
635 Ga0207664_10160041
636 Ga0207664_10213658
637 Ga0207664_10218268
638 Ga0207664_10264034
639 Ga0207644_10010354
640 Ga0207690_10310706
641 Ga0207686_10078452
642 Ga0207709_10014345
643 Ga0207704_10250957
644 Ga0207691_10103703
645 Ga0207711_10000738
646 Ga0207689_10321100
647 Ga0207679_10423414
648 Ga0207712_10002271
649 Ga0207668_10141406
650 Ga0207668_10397565
651 Ga0207658_10000680
652 Ga0207658_10068275
653 Ga0207658_10201176
654 Ga0207658_10336222
655 Ga0207677_10197270
656 Ga0207677_10263034
657 Ga0207677_10502088
658 Ga0207703_10087618
659 Ga0207703_10178825
660 Ga0207639_10021723
661 Ga0207678_10000033
662 Ga0207678_10056196
663 Ga0207678_10217033
664 Ga0207678_10370509
665 Ga0207708_10040920
666 Ga0207702_10364167
667 Ga0207641_10001265
668 Ga0207641_10150602
669 Ga0207648_10117659
670 Ga0207676_10078327
671 Ga0207676_10259369
672 Ga0207674_10115800
673 Ga0207675_100088777
674 Ga0207683_10073901
675 Ga0209813_10004918
676 Ga0268266_10073226
677 Ga0268266_10108102
678 Ga0268266_10125070
679 Ga0268265_10002308
680 Ga0268264_10000503
681 Ga0268264_10491720
682 Ga0307515_10042606
683 Ga0265327_10000001
684 Ga0265327_10000113
685 Ga0265327_10001712
686 Ga0265327_10081875
687 Ga0307513_10150460
688 Ga0307410_10092837
689 Ga0307406_10070997
690 Ga0307406_10124536
691 Ga0307409_100000751
692 Ga0307416_100112242
693 Ga0307507_10042509
694 Ga0373956_0002622
695 Ga0316584_0129196
696 Ga0373925_0267331
697 Ga0395898_0043208
698 Ga0436364_0475075
699 Ga0436364_0636212
700 Ga0436364_1225776
701 Ga0436365_0204440
702 Ga0436365_0429891
703 Ga0436365_1091168
704 Ga0436365_1541644
705 Ga0436365_1771144
706 Ga0439466_0002141
707 Ga0439465_0000056
708 Ga0439465_0006460
709 Ga0451802_1948664
710 Ga0439445_0001364
711 Ga0466972_0001846
712 Ga0466972_0003037
713 Ga0466972_0007899
714 Ga0466972_0027837
715 Ga0466972_0058266
716 Ga0466965_0000276
717 Ga0466965_0002495
718 Ga0466965_0025371
719 Ga0466966_0026107
720 Ga0466966_0143757
721 Ga0466961_0133438
722 Ga0466961_0190910
723 Ga0466963_0017831
724 Ga0466963_0082250
725 Ga0466963_0176706
726 Ga0466963_0184434
727 Ga0466963_0238800
728 Ga0466963_0252100
729 Ga0466964_0115848
730 Ga0466970_0083718
731 Ga0466970_0119355
732 Ga0466957_0032762
733 Ga0466957_0042217
734 Ga0466957_0043863
735 Ga0466957_0222617
736 Ga0466960_0001321
737 Ga0466960_0001779
738 Ga0466960_0014246
739 Ga0466960_0027743
740 Ga0466959_0011700
741 Ga0466959_0067287
742 Ga0466959_0192377
743 Ga0466958_0074994
744 Ga0466967_0003446
745 Ga0466967_0087182
746 Ga0466967_0122589
747 Ga0466967_0129033
748 Ga0466967_0153179
749 Ga0466967_0360230
750 Ga0466967_0504695
751 Ga0495603_0054531
752 Ga0495629_0068765
753 Ga0495638_0000355
754 Ga0495638_0019179
755 Ga0495582_0038059
756 Ga0495639_0098432
757 Ga0495607_0014955
758 Ga0495648_0001604
759 Ga0495665_0035750
760 Ga0495665_0042666
761 Ga0495656_0136584
762 Ga0495668_0000167
763 Ga0495611_0070952
764 Ga0495624_0090884
765 Ga0495581_0012231
766 Ga0495581_0157485
767 Ga0495672_0001082
768 Ga0495683_0001255
769 Ga0495673_0001541
770 Ga0495686_0032509
771 Ga0495593_0002187
772 Ga0495614_0043016
773 Ga0496100_0000043
774 Ga0496100_0014806
775 Ga0496100_0017673
776 Ga0496101_0000050
777 Ga0496101_0000149
778 Ga0496101_0001052
779 Ga0496101_0003555
780 Ga0496101_0008233
781 Ga0496101_0076612
782 Ga0496101_0077428
783 Ga0496102_0000001
784 Ga0496102_0000399
785 Ga0496102_0002651
786 Ga0496102_0048536
787 Ga0496102_0407213
788 Ga0496103_0000007
789 Ga0496103_0000152
790 Ga0496103_0000861
791 Ga0496103_0095082
792 Ga0496105_0042005
793 Ga0496105_0127937
794 Ga0496106_0000354
795 Ga0496106_0020168
796 Ga0496106_0086345
797 Ga0496107_0000154
798 Ga0496107_0172275
799 Ga0496107_0483765
800 Ga0496108_0001025
801 Ga0496108_0070881
802 Ga0496108_0089947
803 Ga0496108_0179961
804 Ga0496109_0000194
805 Ga0496109_0059283
806 Ga0496109_0095695
807 Ga0496109_0187502
808 Ga0496110_0125123
809 Ga0496110_0213083
810 Ga0496111_0185697
811 Ga0496112_0011240
812 Ga0496112_0016985
813 Ga0496112_0118019
814 Ga0496113_0048352
815 Ga0496113_0091044
816 Ga0496113_0376878
817 Ga0496114_0000565
818 Ga0496114_0116541
819 Ga0496114_0281892
820 Ga0496115_0003893
821 Ga0496115_0057795
822 Ga0496115_0147212
823 Ga0496116_0000018
824 Ga0496116_0006988
825 Ga0496117_0000015
826 Ga0496117_0007758
827 Ga0496117_0016646
828 Ga0496118_0000012
829 Ga0496118_0001082
830 Ga0496118_0001705
831 Ga0496118_0004854
832 Ga0496119_0000172
833 Ga0496119_0001151
834 Ga0496119_0003415
835 Ga0496120_0000155
836 Ga0496120_0022303
837 Ga0496120_0025799
838 Ga0496120_0035799
839 Ga0496121_0000048
840 Ga0496121_0001740
841 Ga0496121_0008039
842 Ga0496122_0000301
843 Ga0496122_0024943
844 Ga0496123_0003557
845 Ga0496123_0008036
846 Ga0496124_0000044
847 Ga0496124_0221861
848 Ga0496125_0000037
849 Ga0496125_0004133
850 Ga0496125_0073616
851 Ga0496125_0135588
852 Ga0496126_0000046
853 Ga0496126_0000920
854 Ga0496126_0001956
855 Ga0496126_0016321
856 Ga0496126_0042616
857 Ga0496126_0060055
858 Ga0496126_0310981
859 Ga0501031_0082887
860 Ga0501032_0004276
861 Ga0501032_0029022
862 Ga0501033_0054506
863 Ga0501033_0187712
864 Ga0501034_0012193
865 Ga0501034_0018645
866 Ga0501034_0023625
867 Ga0501036_0033055
868 Ga0501036_0310042
869 Ga0501037_0000709
870 Ga0501037_0090829
871 Ga0501038_0000030
872 Ga0501043_0001589
873 Ga0501046_0000628
874 Ga0501047_0007282
875 Ga0501047_0007604
876 Ga0501048_0004665
877 Ga0501067_0175913
878 Ga0501069_0051101
879 Ga0501070_0001530
880 Ga0501070_0005079
881 Ga0501070_0130369
882 Ga0501073_0108210
883 Ga0501080_0211805
884 Ga0501083_0037722
885 Ga0501035_0000229
886 Ga0501035_0001480
887 Ga0501044_0000880
888 Ga0501044_0006629
889 Ga0501044_0011895
890 Ga0501044_0014099
891 Ga0501044_0170246
892 nmdc:mga03683_28758_c1
893 nmdc:mga03n38_100657_c1
894 nmdc:mga03n38_8539_c1
895 nmdc:mga03n38_9350_c1
896 nmdc:mga00v17_32160_c1
897 nmdc:mga00v17_33477_c1
898 nmdc:mga00v17_43101_c1
899 nmdc:mga00v17_56873_c1
900 nmdc:mga00v17_57422_c1
901 nmdc:mga00v17_7765_c1
902 nmdc:mga0yw44_15634_c2
903 nmdc:mga0yw44_307413_c1
904 nmdc:mga0yw44_49093_c1
905 nmdc:mga0yw44_52061_c1
906 nmdc:mga0yw44_54274_c1
907 nmdc:mga0yw44_89454_c1
908 nmdc:mga0k408_61875_c1
909 nmdc:mga04h51_39021_c1
910 nmdc:mga07m45_100391_c1
911 nmdc:mga07m45_174308_c1
912 nmdc:mga07m45_17456_c1
913 nmdc:mga08y16_38030_c1
914 nmdc:mga0sz30_25434_c1
915 nmdc:mga0sz30_39135_c1
916 Ga0500635_0048782
917 Ga0495619_0165352
918 Ga0500643_015511
919 Ga0500641_0063774
920 Ga0500562_004842
921 Ga0500652_035522
922 Ga0500559_0019013
923 Ga0500616_0010632
924 Ga0500645_000004
925 Ga0466962_0016909
926 2644517314
927 2523384182
928 2548692441
929 2558910363
930 2566994615
931 2583148728
932 2586057611
933 2643853275
934 2644137237
935 2644639950
936 2738663873
937 2738703217
938 2738891119
939 2739143008
940 2739206417
941 2739239228
942 2739329319
943 2739362984
944 2744956096
945 2753036805
946 2753324676
947 2808874037
948 2809585781
949 2842136190
950 2842892244
951 2866612266
952 2889304182
953 2899376279
954 2902795286
955 2902800381
956 2902810919
957 2902842895
958 2904536138
959 2904768351
960 2904775784
961 2908815676
962 2915771476
963 2917745092
964 2919421722
965 2919434720
966 2919446994
967 2919714766
968 2922558068
969 2928147080
970 2929218410
971 2932400059
972 2939583614
973 2939745424
974 2956940716
975 2974319675
976 2984523541
977 3001120396
978 8003314472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

70

234

0.83

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

65

309

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7839 6 224
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7831 6 224
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7802 6 224
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7757 6 224
5fv9-assembly1.cif.gz_D crystal structure of galnac-t2 in complex with compound 16d 0.7529 5 223
ID Description Score Start End Superfamily
af_P9WMX3_2_220_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9643 8 225 3.90.550.10
af_P9WMX3_2_220_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.947 8 225 3.90.550.10
af_P9WMX7_1_219_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7995 5 225 3.90.550.10
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7559 9 230 3.90.550.10
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7553 6 223 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7K3SW07-F1-model_v4 Glycosyltransferase 0.9595 4 144 GO:0016740
AF-A0A655DWI7-F1-model_v4 deleted 0.9571 82 300
AF-A0A838DKL6-F1-model_v4 Glycosyltransferase family 2 protein 0.9477 100 307 GO:0016740
AF-F8E3D5-F1-model_v4 Glycosyl transferase 0.9465 36 300 GO:0016740
AF-A0A838DKL6-F1-model_v4 Glycosyltransferase family 2 protein 0.9431 100 307 GO:0016740

Map