F453808
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 489 | 261 | 489 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0004423|Ga0373934_0004423_1147_2085 |
| Length | 312 |
| Sequence | VTVKIAIIGQQDFGKGVLDAFLARGDDVAGVFCAPEKEGAKADVLKVAAQEKGVKVFQFSSLRNKEAHDAMRSLGADLGVMAYVLQFAPQEFVNIPKKGTIQYHPSLLPKYRGPSSINWPIIRGDTKTGLTIFRPNDGLDEGPVILQKETPISADDTLGSVYFDRLFPMGVKAMLEAADLVVAGKHRETVQDESHASYEGWCRAPEAKINWANHVDFVYNVIRGCNPAPGAWTTLNGKKVQIFDSRKQLIRTFGAVKGKIGEISEIGPQSFFVTAQGGRVEVLKAKHEEGKKVSSPEFVAQNSLAVGTLLGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 147 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 148 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 150 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 162 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 163 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 164 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 165 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 166 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 167 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 168 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 173 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 245 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 260 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.84 |
| Nodule | 0 |
| Rhizoplane | 0.61 |
| Rhizosphere | 97.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10153032 | 3300005327 | Bacteria | 1932 |
| 2 | Ga0070683_100020488 | 3300005329 | Bacteria | 5884 |
| 3 | Ga0070690_100029378 | 3300005330 | Bacteria | 3409 |
| 4 | Ga0070690_100312575 | 3300005330 | Bacteria | 1130 |
| 5 | Ga0070680_100099233 | 3300005336 | Bacteria | 2416 |
| 6 | Ga0070680_100223417 | 3300005336 | Bacteria | 1590 |
| 7 | Ga0070680_100251383 | 3300005336 | Bacteria | 1494 |
| 8 | Ga0070660_100295215 | 3300005339 | Bacteria | 1328 |
| 9 | Ga0070692_10026730 | 3300005345 | Bacteria | 2856 |
| 10 | Ga0070692_10201495 | 3300005345 | Bacteria | 1166 |
| 11 | Ga0070669_100025252 | 3300005353 | Bacteria | 4267 |
| 12 | Ga0070675_100016734 | 3300005354 | Bacteria | 5821 |
| 13 | Ga0070674_100269178 | 3300005356 | Bacteria | 1346 |
| 14 | Ga0070673_100162234 | 3300005364 | Bacteria | 1902 |
| 15 | Ga0070688_100066466 | 3300005365 | Bacteria | 2294 |
| 16 | Ga0070709_10108949 | 3300005434 | Bacteria | 1859 |
| 17 | Ga0070714_100025279 | 3300005435 | Bacteria | 4899 |
| 18 | Ga0070714_100033210 | 3300005435 | Bacteria | 4313 |
| 19 | Ga0070713_100015249 | 3300005436 | Bacteria | 5734 |
| 20 | Ga0070713_100327083 | 3300005436 | Bacteria | 1417 |
| 21 | Ga0070701_10018276 | 3300005438 | Bacteria | 3292 |
| 22 | Ga0070701_10079697 | 3300005438 | Bacteria | 1770 |
| 23 | Ga0070705_100006927 | 3300005440 | Bacteria | 5568 |
| 24 | Ga0070705_100054568 | 3300005440 | Bacteria | 2345 |
| 25 | Ga0070705_100144552 | 3300005440 | Bacteria | 1570 |
| 26 | Ga0070700_100003885 | 3300005441 | Bacteria | 7761 |
| 27 | Ga0070700_100125079 | 3300005441 | Bacteria | 1728 |
| 28 | Ga0070694_100005005 | 3300005444 | Bacteria | 7993 |
| 29 | Ga0070678_100101265 | 3300005456 | Bacteria | 2233 |
| 30 | Ga0070681_10046409 | 3300005458 | Bacteria | 4343 |
| 31 | Ga0070681_10091902 | 3300005458 | Bacteria | 2984 |
| 32 | Ga0068867_100000969 | 3300005459 | Bacteria | 19579 |
| 33 | Ga0068867_100105117 | 3300005459 | Bacteria | 2162 |
| 34 | Ga0068867_100223438 | 3300005459 | Bacteria | 1519 |
| 35 | Ga0068867_100285136 | 3300005459 | Bacteria | 1356 |
| 36 | Ga0070685_10228359 | 3300005466 | Bacteria | 1223 |
| 37 | Ga0070707_100237624 | 3300005468 | Bacteria | 1774 |
| 38 | Ga0070707_100383562 | 3300005468 | Bacteria | 1365 |
| 39 | Ga0070698_100015222 | 3300005471 | Bacteria | 8134 |
| 40 | Ga0070699_100018149 | 3300005518 | Bacteria | 6045 |
| 41 | Ga0070699_100148499 | 3300005518 | Bacteria | 2072 |
| 42 | Ga0070699_100276507 | 3300005518 | Bacteria | 1504 |
| 43 | Ga0070699_100389745 | 3300005518 | Bacteria | 1259 |
| 44 | Ga0070679_100250655 | 3300005530 | Bacteria | 1727 |
| 45 | Ga0070684_100267345 | 3300005535 | Bacteria | 1565 |
| 46 | Ga0070697_100023023 | 3300005536 | Bacteria | 4954 |
| 47 | Ga0070697_100079306 | 3300005536 | Bacteria | 2703 |
| 48 | Ga0068853_100030408 | 3300005539 | Bacteria | 4561 |
| 49 | Ga0068853_100041735 | 3300005539 | Bacteria | 3921 |
| 50 | Ga0070672_100218365 | 3300005543 | Bacteria | 1598 |
| 51 | Ga0070672_100411356 | 3300005543 | Bacteria | 1160 |
| 52 | Ga0070686_100149051 | 3300005544 | Bacteria | 1637 |
| 53 | Ga0070695_100008855 | 3300005545 | Bacteria | 5979 |
| 54 | Ga0070695_100036287 | 3300005545 | Bacteria | 3101 |
| 55 | Ga0070695_100150972 | 3300005545 | Bacteria | 1621 |
| 56 | Ga0070696_100011382 | 3300005546 | Bacteria | 5959 |
| 57 | Ga0070696_100029215 | 3300005546 | Bacteria | 3766 |
| 58 | Ga0070696_100070804 | 3300005546 | Bacteria | 2454 |
| 59 | Ga0070696_100108982 | 3300005546 | Bacteria | 1993 |
| 60 | Ga0070693_100073534 | 3300005547 | Bacteria | 2019 |
| 61 | Ga0070693_100144720 | 3300005547 | Bacteria | 1500 |
| 62 | Ga0070665_100227622 | 3300005548 | Bacteria | 1865 |
| 63 | Ga0070704_100000937 | 3300005549 | Bacteria | 14739 |
| 64 | Ga0070704_100015120 | 3300005549 | Bacteria | 4839 |
| 65 | Ga0070704_100055561 | 3300005549 | Bacteria | 2808 |
| 66 | Ga0070704_100096288 | 3300005549 | Bacteria | 2218 |
| 67 | Ga0070704_100125103 | 3300005549 | Bacteria | 1982 |
| 68 | Ga0070704_100181311 | 3300005549 | Bacteria | 1685 |
| 69 | Ga0068855_100001402 | 3300005563 | Bacteria | 29881 |
| 70 | Ga0068855_100003441 | 3300005563 | Bacteria | 19369 |
| 71 | Ga0068855_100005041 | 3300005563 | Bacteria | 16117 |
| 72 | Ga0068855_100031005 | 3300005563 | Bacteria | 6389 |
| 73 | Ga0068855_100119119 | 3300005563 | Bacteria | 3023 |
| 74 | Ga0070702_100036523 | 3300005615 | Bacteria | 2722 |
| 75 | Ga0070702_100056157 | 3300005615 | Bacteria | 2273 |
| 76 | Ga0068852_100000325 | 3300005616 | Bacteria | 32471 |
| 77 | Ga0068852_100007025 | 3300005616 | Bacteria | 8196 |
| 78 | Ga0068852_100349273 | 3300005616 | Bacteria | 1444 |
| 79 | Ga0068859_100032805 | 3300005617 | Bacteria | 5217 |
| 80 | Ga0068861_100079054 | 3300005719 | Bacteria | 2570 |
| 81 | Ga0068851_10133454 | 3300005834 | Bacteria | 1345 |
| 82 | Ga0068870_10046200 | 3300005840 | Bacteria | 2282 |
| 83 | Ga0068858_100004218 | 3300005842 | Bacteria | 14156 |
| 84 | Ga0068862_100054720 | 3300005844 | Bacteria | 3416 |
| 85 | Ga0068862_100112963 | 3300005844 | Bacteria | 2386 |
| 86 | Ga0068862_100353617 | 3300005844 | Bacteria | 1364 |
| 87 | Ga0068862_100405943 | 3300005844 | Bacteria | 1275 |
| 88 | Ga0081538_10145017 | 3300005981 | Bacteria | 1087 |
| 89 | Ga0081539_10004048 | 3300005985 | Bacteria | 16799 |
| 90 | Ga0075365_10057135 | 3300006038 | Bacteria | 2596 |
| 91 | Ga0070716_100045431 | 3300006173 | Bacteria | 2466 |
| 92 | Ga0070716_100196142 | 3300006173 | Bacteria | 1338 |
| 93 | Ga0075366_10003064 | 3300006195 | Bacteria | 8726 |
| 94 | Ga0075366_10031205 | 3300006195 | Bacteria | 3135 |
| 95 | Ga0075366_10034641 | 3300006195 | Bacteria | 2974 |
| 96 | Ga0097621_100018706 | 3300006237 | Bacteria | 5301 |
| 97 | Ga0068871_100068046 | 3300006358 | Bacteria | 2923 |
| 98 | Ga0075428_100020521 | 3300006844 | Bacteria | 7316 |
| 99 | Ga0075428_100032465 | 3300006844 | Bacteria | 5767 |
| 100 | Ga0075430_100001652 | 3300006846 | Bacteria | 18197 |
| 101 | Ga0075430_100112816 | 3300006846 | Bacteria | 2266 |
| 102 | Ga0075430_100158445 | 3300006846 | Bacteria | 1885 |
| 103 | Ga0075430_100306460 | 3300006846 | Bacteria | 1313 |
| 104 | Ga0075431_100068534 | 3300006847 | Bacteria | 3661 |
| 105 | Ga0075433_10029333 | 3300006852 | Bacteria | 4685 |
| 106 | Ga0075433_10120361 | 3300006852 | Bacteria | 2331 |
| 107 | Ga0075434_100125356 | 3300006871 | Bacteria | 2585 |
| 108 | Ga0075434_100198211 | 3300006871 | Bacteria | 2027 |
| 109 | Ga0075429_100005401 | 3300006880 | Bacteria | 10997 |
| 110 | Ga0075429_100081231 | 3300006880 | Bacteria | 2826 |
| 111 | Ga0075429_100369896 | 3300006880 | Bacteria | 1255 |
| 112 | Ga0075436_100001881 | 3300006914 | Bacteria | 14420 |
| 113 | Ga0075436_100021605 | 3300006914 | Bacteria | 4418 |
| 114 | Ga0075436_100028396 | 3300006914 | Bacteria | 3849 |
| 115 | Ga0075436_100032997 | 3300006914 | Bacteria | 3567 |
| 116 | Ga0075436_100053920 | 3300006914 | Bacteria | 2776 |
| 117 | Ga0075436_100080160 | 3300006914 | Bacteria | 2262 |
| 118 | Ga0097620_100032804 | 3300006931 | Bacteria | 5217 |
| 119 | Ga0075435_100265589 | 3300007076 | Bacteria | 1463 |
| 120 | Ga0075435_100311734 | 3300007076 | Bacteria | 1346 |
| 121 | Ga0099794_10007879 | 3300007265 | Bacteria | 4402 |
| 122 | Ga0099794_10048769 | 3300007265 | Bacteria | 2033 |
| 123 | Ga0105240_10002337 | 3300009093 | Bacteria | 30662 |
| 124 | Ga0105240_10022883 | 3300009093 | Bacteria | 8278 |
| 125 | Ga0105240_10066505 | 3300009093 | Bacteria | 4471 |
| 126 | Ga0105240_10224909 | 3300009093 | Bacteria | 2184 |
| 127 | Ga0105240_10361787 | 3300009093 | Bacteria | 1643 |
| 128 | Ga0111539_10011002 | 3300009094 | Bacteria | 11389 |
| 129 | Ga0111539_10069699 | 3300009094 | Bacteria | 4152 |
| 130 | Ga0111539_10402702 | 3300009094 | Bacteria | 1594 |
| 131 | Ga0105245_10250229 | 3300009098 | Bacteria | 1721 |
| 132 | Ga0114129_10000341 | 3300009147 | Bacteria | 54331 |
| 133 | Ga0114129_10157888 | 3300009147 | Bacteria | 3101 |
| 134 | Ga0114129_10480510 | 3300009147 | Bacteria | 1626 |
| 135 | Ga0105241_10031477 | 3300009174 | Bacteria | 3973 |
| 136 | Ga0105241_10134027 | 3300009174 | Bacteria | 2009 |
| 137 | Ga0105242_10001654 | 3300009176 | Bacteria | 17608 |
| 138 | Ga0105242_10003371 | 3300009176 | Bacteria | 12437 |
| 139 | Ga0105248_10066687 | 3300009177 | Bacteria | 4040 |
| 140 | Ga0105248_10210403 | 3300009177 | Bacteria | 2191 |
| 141 | Ga0105238_10016897 | 3300009551 | Bacteria | 7404 |
| 142 | Ga0105238_10073986 | 3300009551 | Bacteria | 3400 |
| 143 | Ga0105238_10155804 | 3300009551 | Bacteria | 2259 |
| 144 | Ga0105249_10003727 | 3300009553 | Bacteria | 13150 |
| 145 | Ga0157370_10027936 | 3300013104 | Bacteria | 5558 |
| 146 | Ga0157370_10118679 | 3300013104 | Bacteria | 2470 |
| 147 | Ga0157370_10294723 | 3300013104 | Bacteria | 1498 |
| 148 | Ga0157369_10000349 | 3300013105 | Bacteria | 61491 |
| 149 | Ga0157369_10192265 | 3300013105 | Bacteria | 2144 |
| 150 | Ga0157374_10017410 | 3300013296 | Bacteria | 6326 |
| 151 | Ga0157378_10066939 | 3300013297 | Bacteria | 3218 |
| 152 | Ga0157372_10010818 | 3300013307 | Bacteria | 9713 |
| 153 | Ga0157372_10089534 | 3300013307 | Bacteria | 3497 |
| 154 | Ga0157372_10448778 | 3300013307 | Bacteria | 1503 |
| 155 | Ga0157375_10137384 | 3300013308 | Bacteria | 2569 |
| 156 | Ga0157375_10450472 | 3300013308 | Bacteria | 1453 |
| 157 | Ga0157380_10036704 | 3300014326 | Bacteria | 3793 |
| 158 | Ga0157380_10133235 | 3300014326 | Bacteria | 2123 |
| 159 | Ga0157380_10193542 | 3300014326 | Bacteria | 1798 |
| 160 | Ga0157379_10115417 | 3300014968 | Bacteria | 2414 |
| 161 | Ga0157376_10074911 | 3300014969 | Bacteria | 2887 |
| 162 | Ga0157376_10391953 | 3300014969 | Bacteria | 1341 |
| 163 | Ga0163161_10041890 | 3300017792 | Bacteria | 3292 |
| 164 | Ga0213875_10047365 | 3300021388 | Bacteria | 2017 |
| 165 | Ga0207656_10000723 | 3300025321 | Bacteria | 10811 |
| 166 | Ga0207699_10055292 | 3300025906 | Bacteria | 2361 |
| 167 | Ga0207643_10011949 | 3300025908 | Bacteria | 4688 |
| 168 | Ga0207643_10077688 | 3300025908 | Bacteria | 1919 |
| 169 | Ga0207705_10005226 | 3300025909 | Bacteria | 9730 |
| 170 | Ga0207654_10122369 | 3300025911 | Bacteria | 1636 |
| 171 | Ga0207707_10301469 | 3300025912 | Bacteria | 1385 |
| 172 | Ga0207695_10002750 | 3300025913 | Bacteria | 25639 |
| 173 | Ga0207695_10045188 | 3300025913 | Bacteria | 4678 |
| 174 | Ga0207695_10102895 | 3300025913 | Bacteria | 2848 |
| 175 | Ga0207695_10180357 | 3300025913 | Bacteria | 2032 |
| 176 | Ga0207693_10168263 | 3300025915 | Bacteria | 1726 |
| 177 | Ga0207660_10077353 | 3300025917 | Bacteria | 2436 |
| 178 | Ga0207660_10340976 | 3300025917 | Bacteria | 1200 |
| 179 | Ga0207662_10163932 | 3300025918 | Bacteria | 1422 |
| 180 | Ga0207649_10025618 | 3300025920 | Bacteria | 3441 |
| 181 | Ga0207652_10035705 | 3300025921 | Bacteria | 4198 |
| 182 | Ga0207652_10112194 | 3300025921 | Bacteria | 2419 |
| 183 | Ga0207652_10201126 | 3300025921 | Bacteria | 1793 |
| 184 | Ga0207681_10002870 | 3300025923 | Bacteria | 10886 |
| 185 | Ga0207694_10048997 | 3300025924 | Bacteria | 3269 |
| 186 | Ga0207694_10108400 | 3300025924 | Bacteria | 2207 |
| 187 | Ga0207694_10119353 | 3300025924 | Bacteria | 2104 |
| 188 | Ga0207694_10119956 | 3300025924 | Bacteria | 2099 |
| 189 | Ga0207694_10317909 | 3300025924 | Bacteria | 1284 |
| 190 | Ga0207659_10093829 | 3300025926 | Bacteria | 2247 |
| 191 | Ga0207659_10108761 | 3300025926 | Bacteria | 2103 |
| 192 | Ga0207687_10010843 | 3300025927 | Bacteria | 5957 |
| 193 | Ga0207700_10095716 | 3300025928 | Bacteria | 2356 |
| 194 | Ga0207664_10328616 | 3300025929 | Bacteria | 1350 |
| 195 | Ga0207706_10430891 | 3300025933 | Bacteria | 1142 |
| 196 | Ga0207686_10087331 | 3300025934 | Bacteria | 2051 |
| 197 | Ga0207686_10204207 | 3300025934 | Bacteria | 1417 |
| 198 | Ga0207709_10076613 | 3300025935 | Bacteria | 2141 |
| 199 | Ga0207709_10116390 | 3300025935 | Bacteria | 1797 |
| 200 | Ga0207670_10002785 | 3300025936 | Bacteria | 9214 |
| 201 | Ga0207670_10092478 | 3300025936 | Bacteria | 2141 |
| 202 | Ga0207669_10184175 | 3300025937 | Bacteria | 1500 |
| 203 | Ga0207665_10040865 | 3300025939 | Bacteria | 3095 |
| 204 | Ga0207691_10227518 | 3300025940 | Bacteria | 1616 |
| 205 | Ga0207691_10277778 | 3300025940 | Bacteria | 1442 |
| 206 | Ga0207711_10059101 | 3300025941 | Bacteria | 3301 |
| 207 | Ga0207711_10260641 | 3300025941 | Bacteria | 1593 |
| 208 | Ga0207661_10048853 | 3300025944 | Bacteria | 3365 |
| 209 | Ga0207667_10061644 | 3300025949 | Bacteria | 3923 |
| 210 | Ga0207667_10280361 | 3300025949 | Bacteria | 1703 |
| 211 | Ga0207667_10379826 | 3300025949 | Bacteria | 1440 |
| 212 | Ga0207651_10064426 | 3300025960 | Bacteria | 2565 |
| 213 | Ga0207712_10001994 | 3300025961 | Bacteria | 13400 |
| 214 | Ga0207712_10217722 | 3300025961 | Bacteria | 1525 |
| 215 | Ga0207640_10147634 | 3300025981 | Bacteria | 1723 |
| 216 | Ga0207640_10245309 | 3300025981 | Bacteria | 1387 |
| 217 | Ga0207703_10063531 | 3300026035 | Bacteria | 3027 |
| 218 | Ga0207639_10375123 | 3300026041 | Bacteria | 1276 |
| 219 | Ga0207708_10009609 | 3300026075 | Bacteria | 7170 |
| 220 | Ga0207708_10093734 | 3300026075 | Bacteria | 2317 |
| 221 | Ga0207648_10005654 | 3300026089 | Bacteria | 12553 |
| 222 | Ga0207648_10263861 | 3300026089 | Bacteria | 1537 |
| 223 | Ga0207674_10034782 | 3300026116 | Bacteria | 5263 |
| 224 | Ga0207675_100075753 | 3300026118 | Bacteria | 3150 |
| 225 | Ga0207675_100136268 | 3300026118 | Bacteria | 2330 |
| 226 | Ga0207675_100159914 | 3300026118 | Bacteria | 2148 |
| 227 | Ga0207675_100314654 | 3300026118 | Bacteria | 1527 |
| 228 | Ga0207683_10054788 | 3300026121 | Bacteria | 3497 |
| 229 | Ga0207683_10284789 | 3300026121 | Bacteria | 1510 |
| 230 | Ga0207698_10019377 | 3300026142 | Bacteria | 4656 |
| 231 | Ga0207698_10076997 | 3300026142 | Bacteria | 2672 |
| 232 | Ga0207698_10164326 | 3300026142 | Bacteria | 1946 |
| 233 | Ga0207698_10444773 | 3300026142 | Bacteria | 1250 |
| 234 | Ga0209973_1003160 | 3300027252 | Bacteria | 1600 |
| 235 | Ga0209969_1002452 | 3300027360 | Bacteria | 2564 |
| 236 | Ga0209967_1003832 | 3300027364 | Bacteria | 1986 |
| 237 | Ga0210000_1001350 | 3300027462 | Bacteria | 3451 |
| 238 | Ga0209968_1007588 | 3300027526 | Bacteria | 1643 |
| 239 | Ga0209999_1006841 | 3300027543 | Bacteria | 2052 |
| 240 | Ga0209971_1026979 | 3300027682 | Bacteria | 1373 |
| 241 | Ga0209974_10001168 | 3300027876 | Bacteria | 9369 |
| 242 | Ga0207428_10006430 | 3300027907 | Bacteria | 10850 |
| 243 | Ga0207428_10128013 | 3300027907 | Bacteria | 1944 |
| 244 | Ga0268266_10109233 | 3300028379 | Bacteria | 2449 |
| 245 | Ga0268265_10003278 | 3300028380 | Bacteria | 11732 |
| 246 | Ga0268265_10291351 | 3300028380 | Bacteria | 1465 |
| 247 | Ga0268265_10433529 | 3300028380 | Bacteria | 1223 |
| 248 | Ga0265760_10028384 | 3300031090 | Bacteria | 1642 |
| 249 | Ga0265328_10001540 | 3300031239 | Bacteria | 10635 |
| 250 | Ga0265329_10044228 | 3300031242 | Bacteria | 1424 |
| 251 | Ga0265331_10002377 | 3300031250 | Bacteria | 12772 |
| 252 | Ga0307408_100034424 | 3300031548 | Bacteria | 3549 |
| 253 | Ga0265314_10000845 | 3300031711 | Bacteria | 36266 |
| 254 | Ga0307405_10219504 | 3300031731 | Bacteria | 1394 |
| 255 | Ga0307413_10430590 | 3300031824 | Bacteria | 1042 |
| 256 | Ga0307416_100054714 | 3300032002 | Bacteria | 3209 |
| 257 | Ga0307416_100225726 | 3300032002 | Bacteria | 1801 |
| 258 | Ga0307416_100377491 | 3300032002 | Bacteria | 1446 |
| 259 | Ga0373934_0002203 | 3300035086 | Bacteria | 7156 |
| 260 | Ga0373934_0004423 | 3300035086 | Bacteria | 5191 |
| 261 | Ga0373934_0031416 | 3300035086 | Bacteria | 2079 |
| 262 | Ga0373923_0016037 | 3300035111 | Bacteria | 2838 |
| 263 | Ga0373923_0091224 | 3300035111 | Bacteria | 1333 |
| 264 | Ga0373932_0026240 | 3300035112 | Bacteria | 1584 |
| 265 | Ga0373936_0014973 | 3300035113 | Bacteria | 2969 |
| 266 | Ga0373953_0130413 | 3300035117 | Bacteria | 1072 |
| 267 | Ga0373954_0000081 | 3300035118 | Bacteria | 33886 |
| 268 | Ga0373954_0000113 | 3300035118 | Bacteria | 27416 |
| 269 | Ga0373954_0001250 | 3300035118 | Bacteria | 10244 |
| 270 | Ga0373954_0044804 | 3300035118 | Bacteria | 2065 |
| 271 | Ga0373956_0000034 | 3300035119 | Bacteria | 43936 |
| 272 | Ga0373956_0020386 | 3300035119 | Bacteria | 2820 |
| 273 | Ga0373957_0003156 | 3300035120 | Bacteria | 4823 |
| 274 | Ga0373957_0005727 | 3300035120 | Bacteria | 3871 |
| 275 | Ga0373946_0021022 | 3300035171 | Bacteria | 2527 |
| 276 | Ga0373955_0015523 | 3300035172 | Bacteria | 3731 |
| 277 | Ga0373955_0126294 | 3300035172 | Bacteria | 1490 |
| 278 | Ga0373924_0044632 | 3300035410 | Bacteria | 1821 |
| 279 | Ga0373931_0146444 | 3300035691 | Bacteria | 1373 |
| 280 | Ga0373927_0118713 | 3300035695 | Bacteria | 1726 |
| 281 | Ga0373933_0000443 | 3300035724 | Bacteria | 25931 |
| 282 | Ga0373933_0028331 | 3300035724 | Bacteria | 3231 |
| 283 | Ga0373947_0074658 | 3300035725 | Bacteria | 2087 |
| 284 | Ga0373937_0000372 | 3300036401 | Bacteria | 41751 |
| 285 | Ga0373937_0001711 | 3300036401 | Bacteria | 18445 |
| 286 | Ga0373937_0021999 | 3300036401 | Bacteria | 5726 |
| 287 | Ga0373937_0158147 | 3300036401 | Bacteria | 2124 |
| 288 | Ga0373937_0251107 | 3300036401 | Bacteria | 1667 |
| 289 | Ga0373937_0282503 | 3300036401 | Bacteria | 1567 |
| 290 | Ga0373925_0018939 | 3300037068 | Bacteria | 5003 |
| 291 | Ga0373925_0238953 | 3300037068 | Bacteria | 1454 |
| 292 | Ga0395905_0019218 | 3300037471 | Bacteria | 6479 |
| 293 | Ga0436364_1508581 | 3300037853 | Bacteria | 6529 |
| 294 | Ga0439439_0029557 | 3300041406 | Bacteria | 1391 |
| 295 | Ga0439441_003397 | 3300042001 | Bacteria | 2346 |
| 296 | Ga0439435_0000598 | 3300042436 | Bacteria | 5854 |
| 297 | Ga0439435_0000692 | 3300042436 | Bacteria | 5606 |
| 298 | Ga0439444_0001842 | 3300042437 | Bacteria | 2812 |
| 299 | Ga0439444_0002291 | 3300042437 | Bacteria | 2595 |
| 300 | Ga0439460_0000117 | 3300042461 | Bacteria | 13698 |
| 301 | Ga0451577_0101105 | 3300042876 | Bacteria | 2576 |
| 302 | Ga0451577_0137252 | 3300042876 | Bacteria | 2196 |
| 303 | Ga0451577_0479666 | 3300042876 | Bacteria | 1129 |
| 304 | Ga0466964_0007550 | 3300044706 | Bacteria | 4069 |
| 305 | Ga0453684_0184561 | 3300044712 | Bacteria | 2446 |
| 306 | Ga0453684_0417363 | 3300044712 | Bacteria | 1500 |
| 307 | Ga0466957_0041340 | 3300044842 | Bacteria | 2788 |
| 308 | Ga0466959_0029045 | 3300045049 | Bacteria | 4096 |
| 309 | Ga0451576_0107595 | 3300045051 | Bacteria | 2901 |
| 310 | Ga0451576_0385850 | 3300045051 | Bacteria | 1468 |
| 311 | Ga0466967_0011505 | 3300045976 | Bacteria | 6708 |
| 312 | Ga0495592_0001366 | 3300046454 | Bacteria | 16866 |
| 313 | Ga0495592_0001493 | 3300046454 | Bacteria | 16284 |
| 314 | Ga0495592_0004439 | 3300046454 | Bacteria | 10268 |
| 315 | Ga0495592_0008347 | 3300046454 | Bacteria | 7767 |
| 316 | Ga0495592_0076133 | 3300046454 | Bacteria | 2435 |
| 317 | Ga0495629_0056064 | 3300046459 | Bacteria | 2756 |
| 318 | Ga0495641_0005331 | 3300046461 | Bacteria | 8724 |
| 319 | Ga0495641_0102883 | 3300046461 | Bacteria | 1274 |
| 320 | Ga0495651_0000056 | 3300046462 | Bacteria | 83191 |
| 321 | Ga0495651_0075197 | 3300046462 | Bacteria | 2561 |
| 322 | Ga0495651_0235197 | 3300046462 | Bacteria | 1260 |
| 323 | Ga0495653_0002911 | 3300046463 | Bacteria | 13684 |
| 324 | Ga0495653_0076630 | 3300046463 | Bacteria | 2485 |
| 325 | Ga0495580_0005602 | 3300046472 | Bacteria | 10347 |
| 326 | Ga0495639_0001202 | 3300046475 | Bacteria | 11671 |
| 327 | Ga0495662_0006369 | 3300046476 | Bacteria | 5899 |
| 328 | Ga0495664_0003368 | 3300046477 | Bacteria | 8688 |
| 329 | Ga0495608_0002230 | 3300046511 | Bacteria | 13989 |
| 330 | Ga0495608_0047953 | 3300046511 | Bacteria | 2838 |
| 331 | Ga0495618_0041357 | 3300046514 | Bacteria | 2902 |
| 332 | Ga0495628_0000532 | 3300046516 | Bacteria | 34861 |
| 333 | Ga0495628_0002277 | 3300046516 | Bacteria | 17372 |
| 334 | Ga0495628_0017670 | 3300046516 | Bacteria | 5929 |
| 335 | Ga0495628_0021328 | 3300046516 | Bacteria | 5331 |
| 336 | Ga0495628_0069425 | 3300046516 | Bacteria | 2748 |
| 337 | Ga0495630_0004976 | 3300046517 | Bacteria | 9348 |
| 338 | Ga0495666_0002281 | 3300046526 | Bacteria | 9548 |
| 339 | Ga0495666_0013811 | 3300046526 | Bacteria | 4026 |
| 340 | Ga0495652_0002507 | 3300046529 | Bacteria | 18834 |
| 341 | Ga0495652_0073319 | 3300046529 | Bacteria | 2851 |
| 342 | Ga0495652_0100231 | 3300046529 | Bacteria | 2350 |
| 343 | Ga0495652_0102392 | 3300046529 | Bacteria | 2320 |
| 344 | Ga0495665_0048980 | 3300046531 | Bacteria | 2240 |
| 345 | Ga0495640_0032482 | 3300046533 | Bacteria | 3717 |
| 346 | Ga0495586_0006091 | 3300046535 | Bacteria | 6448 |
| 347 | Ga0495586_0051019 | 3300046535 | Bacteria | 2238 |
| 348 | Ga0495586_0169257 | 3300046535 | Unclassified | 1234 |
| 349 | Ga0495587_0003519 | 3300046536 | Bacteria | 10428 |
| 350 | Ga0495587_0068210 | 3300046536 | Bacteria | 2072 |
| 351 | Ga0495587_0077374 | 3300046536 | Bacteria | 1931 |
| 352 | Ga0495598_0021124 | 3300046537 | Bacteria | 1728 |
| 353 | Ga0495621_0070320 | 3300046539 | Bacteria | 1288 |
| 354 | Ga0495645_0000502 | 3300046543 | Bacteria | 27029 |
| 355 | Ga0495645_0107749 | 3300046543 | Bacteria | 1974 |
| 356 | Ga0495667_0028552 | 3300046559 | Bacteria | 3757 |
| 357 | Ga0495667_0045555 | 3300046559 | Bacteria | 2903 |
| 358 | Ga0495634_0072129 | 3300046642 | Bacteria | 2271 |
| 359 | Ga0495635_0004806 | 3300046663 | Bacteria | 9395 |
| 360 | Ga0495635_0017682 | 3300046663 | Bacteria | 4979 |
| 361 | Ga0495657_0016008 | 3300046675 | Bacteria | 5472 |
| 362 | Ga0495657_0026776 | 3300046675 | Bacteria | 4080 |
| 363 | Ga0495599_0001123 | 3300046678 | Bacteria | 15093 |
| 364 | Ga0495599_0022963 | 3300046678 | Bacteria | 3896 |
| 365 | Ga0495599_0026836 | 3300046678 | Bacteria | 3610 |
| 366 | Ga0495599_0062282 | 3300046678 | Bacteria | 2330 |
| 367 | Ga0495623_0105668 | 3300046679 | Bacteria | 1711 |
| 368 | Ga0495647_0000693 | 3300046681 | Bacteria | 10014 |
| 369 | Ga0495658_0003469 | 3300046683 | Bacteria | 7793 |
| 370 | Ga0495658_0198118 | 3300046683 | Bacteria | 1251 |
| 371 | Ga0495669_0009889 | 3300046684 | Bacteria | 4031 |
| 372 | Ga0495613_0012092 | 3300046689 | Bacteria | 6416 |
| 373 | Ga0495613_0020534 | 3300046689 | Bacteria | 4924 |
| 374 | Ga0495600_0009363 | 3300046809 | Bacteria | 6051 |
| 375 | Ga0495600_0009561 | 3300046809 | Bacteria | 5993 |
| 376 | Ga0495604_0007827 | 3300047317 | Bacteria | 8458 |
| 377 | Ga0495604_0042437 | 3300047317 | Bacteria | 3564 |
| 378 | Ga0495636_0017406 | 3300047318 | Bacteria | 2877 |
| 379 | Ga0495674_0004795 | 3300047319 | Bacteria | 13012 |
| 380 | Ga0495680_0012907 | 3300047322 | Bacteria | 7320 |
| 381 | Ga0495680_0094373 | 3300047322 | Bacteria | 2238 |
| 382 | Ga0495680_0102000 | 3300047322 | Bacteria | 2137 |
| 383 | Ga0495680_0169904 | 3300047322 | Bacteria | 1579 |
| 384 | Ga0495675_0002113 | 3300047444 | Bacteria | 11847 |
| 385 | Ga0495684_0043615 | 3300047471 | Bacteria | 3434 |
| 386 | Ga0495684_0085778 | 3300047471 | Bacteria | 2387 |
| 387 | Ga0495593_0107806 | 3300047673 | Bacteria | 1424 |
| 388 | Ga0496104_0081492 | 3300048907 | Bacteria | 3086 |
| 389 | Ga0496106_0139269 | 3300048909 | Bacteria | 1908 |
| 390 | Ga0496110_0038826 | 3300048913 | Bacteria | 4144 |
| 391 | Ga0501031_0020879 | 3300049568 | Bacteria | 4270 |
| 392 | Ga0501033_0006757 | 3300049570 | Bacteria | 8960 |
| 393 | Ga0501036_0000162 | 3300049572 | Bacteria | 43591 |
| 394 | Ga0501037_0043345 | 3300049573 | Bacteria | 3307 |
| 395 | Ga0501038_0001044 | 3300049574 | Bacteria | 25020 |
| 396 | Ga0501038_0126417 | 3300049574 | Bacteria | 2104 |
| 397 | Ga0501039_0002679 | 3300049575 | Bacteria | 13284 |
| 398 | Ga0501039_0033444 | 3300049575 | Bacteria | 3964 |
| 399 | Ga0501039_0059602 | 3300049575 | Bacteria | 2956 |
| 400 | Ga0501039_0076946 | 3300049575 | Bacteria | 2595 |
| 401 | Ga0501040_0000167 | 3300049576 | Bacteria | 37032 |
| 402 | Ga0501040_0047366 | 3300049576 | Bacteria | 2936 |
| 403 | Ga0501040_0077338 | 3300049576 | Bacteria | 2302 |
| 404 | Ga0501042_0000122 | 3300049578 | Bacteria | 33231 |
| 405 | Ga0501042_0058277 | 3300049578 | Bacteria | 2756 |
| 406 | Ga0501042_0058523 | 3300049578 | Bacteria | 2751 |
| 407 | Ga0501046_0001014 | 3300049580 | Bacteria | 27382 |
| 408 | Ga0501046_0105012 | 3300049580 | Bacteria | 2164 |
| 409 | Ga0501047_0002291 | 3300049581 | Bacteria | 18316 |
| 410 | Ga0501048_0000147 | 3300049582 | Bacteria | 43084 |
| 411 | Ga0501067_0109076 | 3300049583 | Bacteria | 1539 |
| 412 | Ga0501068_0018296 | 3300049584 | Bacteria | 4059 |
| 413 | Ga0501069_0000781 | 3300049585 | Bacteria | 14959 |
| 414 | Ga0501070_0003184 | 3300049586 | Bacteria | 14271 |
| 415 | Ga0501071_0025357 | 3300049587 | Bacteria | 4152 |
| 416 | Ga0501071_0083413 | 3300049587 | Bacteria | 2341 |
| 417 | Ga0501072_0182813 | 3300049588 | Bacteria | 1672 |
| 418 | Ga0501072_0204177 | 3300049588 | Bacteria | 1576 |
| 419 | Ga0501072_0252786 | 3300049588 | Bacteria | 1403 |
| 420 | Ga0501073_0000370 | 3300049589 | Bacteria | 30322 |
| 421 | Ga0501074_0002082 | 3300049590 | Bacteria | 13828 |
| 422 | Ga0501075_0001960 | 3300049591 | Bacteria | 13574 |
| 423 | Ga0501075_0014080 | 3300049591 | Bacteria | 5728 |
| 424 | Ga0501075_0015847 | 3300049591 | Bacteria | 5421 |
| 425 | Ga0501075_0298511 | 3300049591 | Bacteria | 1227 |
| 426 | Ga0501076_0000726 | 3300049592 | Bacteria | 21331 |
| 427 | Ga0501076_0026775 | 3300049592 | Bacteria | 4469 |
| 428 | Ga0501076_0034331 | 3300049592 | Bacteria | 3964 |
| 429 | Ga0501077_0000231 | 3300049593 | Bacteria | 32894 |
| 430 | Ga0501077_0193430 | 3300049593 | Bacteria | 1292 |
| 431 | Ga0501079_0000211 | 3300049741 | Bacteria | 34187 |
| 432 | Ga0501079_0060506 | 3300049741 | Bacteria | 2921 |
| 433 | Ga0501079_0415049 | 3300049741 | Bacteria | 1056 |
| 434 | Ga0501080_0001759 | 3300049742 | Bacteria | 18574 |
| 435 | Ga0501080_0027900 | 3300049742 | Bacteria | 5250 |
| 436 | Ga0501080_0060796 | 3300049742 | Bacteria | 3517 |
| 437 | Ga0501081_0001106 | 3300049743 | Bacteria | 16196 |
| 438 | Ga0501081_0206564 | 3300049743 | Bacteria | 1425 |
| 439 | Ga0501083_0013773 | 3300049744 | Bacteria | 5653 |
| 440 | Ga0501044_0190739 | 3300049823 | Bacteria | 2012 |
| 441 | Ga0501045_0000489 | 3300049824 | Bacteria | 24526 |
| 442 | Ga0501045_0005120 | 3300049824 | Bacteria | 9070 |
| 443 | Ga0501045_0011791 | 3300049824 | Bacteria | 6140 |
| 444 | Ga0501045_0261708 | 3300049824 | Bacteria | 1287 |
| 445 | nmdc:mga0k408_11885_c2 | 3300050493 | Bacteria | 4190 |
| 446 | nmdc:mga0k408_175992_c1 | 3300050493 | Bacteria | 1276 |
| 447 | nmdc:mga0k408_31189_c1 | 3300050493 | Bacteria | 3042 |
| 448 | nmdc:mga0k408_32688_c1 | 3300050493 | Bacteria | 2972 |
| 449 | nmdc:mga07m45_25068_c1 | 3300050496 | Bacteria | 3269 |
| 450 | nmdc:mga05p37_156714_c1 | 3300050507 | Bacteria | 2782 |
| 451 | nmdc:mga05p37_24332_c1 | 3300050507 | Bacteria | 7359 |
| 452 | nmdc:mga05p37_471977_c1 | 3300050507 | Bacteria | 1447 |
| 453 | nmdc:mga05p37_95402_c1 | 3300050507 | Bacteria | 3664 |
| 454 | nmdc:mga09592_56874_c1 | 3300050508 | Bacteria | 3306 |
| 455 | nmdc:mga0qj67_177928_c1 | 3300050509 | Bacteria | 1728 |
| 456 | nmdc:mga0qj67_23223_c1 | 3300050509 | Bacteria | 4769 |
| 457 | nmdc:mga0qj67_293964_c1 | 3300050509 | Bacteria | 1316 |
| 458 | nmdc:mga06r32_37915_c1 | 3300050510 | Bacteria | 4561 |
| 459 | nmdc:mga06r32_59976_c1 | 3300050510 | Bacteria | 3660 |
| 460 | nmdc:mga08y16_212251_c1 | 3300050511 | Bacteria | 2005 |
| 461 | nmdc:mga08y16_226469_c1 | 3300050511 | Bacteria | 1935 |
| 462 | nmdc:mga08y16_233514_c1 | 3300050511 | Bacteria | 1902 |
| 463 | nmdc:mga08y16_280408_c1 | 3300050511 | Bacteria | 1719 |
| 464 | nmdc:mga0n895_133579_c1 | 3300050512 | Bacteria | 2507 |
| 465 | nmdc:mga0n895_143956_c1 | 3300050512 | Bacteria | 2413 |
| 466 | nmdc:mga0n895_154384_c1 | 3300050512 | Bacteria | 2326 |
| 467 | nmdc:mga0rr50_26715_c1 | 3300050513 | Bacteria | 4033 |
| 468 | nmdc:mga08x19_12791_c1 | 3300050514 | Bacteria | 5062 |
| 469 | nmdc:mga08x19_1505_c1 | 3300050514 | Bacteria | 14437 |
| 470 | nmdc:mga08x19_233500_c1 | 3300050514 | Bacteria | 1266 |
| 471 | nmdc:mga08x19_334263_c1 | 3300050514 | Bacteria | 1056 |
| 472 | nmdc:mga08x19_39821_c1 | 3300050514 | Bacteria | 2989 |
| 473 | nmdc:mga08x19_58159_c1 | 3300050514 | Bacteria | 2500 |
| 474 | nmdc:mga0a205_149754_c1 | 3300050515 | Bacteria | 2234 |
| 475 | nmdc:mga0a205_75607_c1 | 3300050515 | Bacteria | 3254 |
| 476 | Ga0495601_0000144 | 3300053077 | Bacteria | 40543 |
| 477 | Ga0495601_0007306 | 3300053077 | Bacteria | 6476 |
| 478 | Ga0495601_0257074 | 3300053077 | Bacteria | 1140 |
| 479 | Ga0495595_0001310 | 3300053084 | Bacteria | 9672 |
| 480 | Ga0495619_0071640 | 3300053085 | Bacteria | 2319 |
| 481 | Ga0501084_0000262 | 3300054114 | Bacteria | 39735 |
| 482 | Ga0501084_0143451 | 3300054114 | Bacteria | 2011 |
| 483 | Ga0590077_027238 | 3300059426 | Bacteria | 1238 |
| 484 | Ga0501082_0002140 | 3300060353 | Bacteria | 17327 |
| 485 | Ga0501082_0319382 | 3300060353 | Bacteria | 1353 |
| 486 | Ga0501082_0462710 | 3300060353 | Bacteria | 1108 |
| 487 | Ga0530510_0000114 | 3300061734 | Bacteria | 45503 |
| 488 | Ga0530510_0000861 | 3300061734 | Bacteria | 19992 |
| 489 | Ga0530510_0001981 | 3300061734 | Bacteria | 14033 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031824 | Ga0307413_10430590 | Ga0307413_104305902 | 254 |
| 2 | 3300005981 | Ga0081538_10145017 | Ga0081538_101450172 | 262 |
| 3 | 3300005438 | Ga0070701_10018276 | Ga0070701_100182763 | 281 |
| 4 | 3300049575 | Ga0501039_0033444 | Ga0501039_0033444_929_1858 | 292 |
| 5 | 3300049576 | Ga0501040_0047366 | Ga0501040_0047366_255_1184 | 292 |
| 6 | 3300049578 | Ga0501042_0058523 | Ga0501042_0058523_393_1322 | 292 |
| 7 | 3300049591 | Ga0501075_0014080 | Ga0501075_0014080_1070_1999 | 292 |
| 8 | 3300049592 | Ga0501076_0034331 | Ga0501076_0034331_960_1889 | 292 |
| 9 | 3300049593 | Ga0501077_0193430 | Ga0501077_0193430_110_1039 | 292 |
| 10 | 3300049743 | Ga0501081_0206564 | Ga0501081_0206564_93_1022 | 292 |
| 11 | 3300049824 | Ga0501045_0005120 | Ga0501045_0005120_3735_4664 | 292 |
| 12 | 3300060353 | Ga0501082_0462710 | Ga0501082_0462710_27_956 | 292 |
| 13 | 3300061734 | Ga0530510_0000861 | Ga0530510_0000861_7883_8812 | 292 |
| 14 | 3300014326 | Ga0157380_10193542 | Ga0157380_101935422 | 294 |
| 15 | 3300049580 | Ga0501046_0105012 | Ga0501046_0105012_55_942 | 295 |
| 16 | 3300049588 | Ga0501072_0252786 | Ga0501072_0252786_499_1389 | 296 |
| 17 | 3300005545 | Ga0070695_100150972 | Ga0070695_1001509722 | 297 |
| 18 | 3300005549 | Ga0070704_100096288 | Ga0070704_1000962882 | 297 |
| 19 | 3300032002 | Ga0307416_100054714 | Ga0307416_1000547142 | 300 |
| 20 | 3300027252 | Ga0209973_1003160 | Ga0209973_10031601 | 303 |
| 21 | 3300027360 | Ga0209969_1002452 | Ga0209969_10024522 | 303 |
| 22 | 3300027364 | Ga0209967_1003832 | Ga0209967_10038322 | 303 |
| 23 | 3300027462 | Ga0210000_1001350 | Ga0210000_10013502 | 303 |
| 24 | 3300027526 | Ga0209968_1007588 | Ga0209968_10075882 | 303 |
| 25 | 3300027876 | Ga0209974_10001168 | Ga0209974_100011686 | 303 |
| 26 | 3300006038 | Ga0075365_10057135 | Ga0075365_100571352 | 304 |
| 27 | 3300006195 | Ga0075366_10031205 | Ga0075366_100312052 | 304 |
| 28 | 3300050493 | nmdc:mga0k408_31189_c1 | nmdc:mga0k408_31189_c1_1773_2687 | 304 |
| 29 | 3300050496 | nmdc:mga07m45_25068_c1 | nmdc:mga07m45_25068_c1_1960_2874 | 304 |
| 30 | 3300006914 | Ga0075436_100080160 | Ga0075436_1000801602 | 305 |
| 31 | 3300013104 | Ga0157370_10118679 | Ga0157370_101186792 | 306 |
| 32 | 3300042876 | Ga0451577_0101105 | Ga0451577_0101105_42_962 | 306 |
| 33 | 3300005330 | Ga0070690_100312575 | Ga0070690_1003125751 | 309 |
| 34 | 3300005444 | Ga0070694_100005005 | Ga0070694_1000050056 | 309 |
| 35 | 3300005545 | Ga0070695_100036287 | Ga0070695_1000362872 | 309 |
| 36 | 3300005549 | Ga0070704_100015120 | Ga0070704_1000151202 | 309 |
| 37 | 3300005617 | Ga0068859_100032805 | Ga0068859_1000328052 | 309 |
| 38 | 3300006846 | Ga0075430_100001652 | Ga0075430_1000016526 | 309 |
| 39 | 3300006846 | Ga0075430_100306460 | Ga0075430_1003064601 | 309 |
| 40 | 3300006871 | Ga0075434_100125356 | Ga0075434_1001253562 | 309 |
| 41 | 3300006931 | Ga0097620_100032804 | Ga0097620_1000328042 | 309 |
| 42 | 3300007076 | Ga0075435_100311734 | Ga0075435_1003117342 | 309 |
| 43 | 3300009174 | Ga0105241_10134027 | Ga0105241_101340273 | 309 |
| 44 | 3300014326 | Ga0157380_10133235 | Ga0157380_101332352 | 309 |
| 45 | 3300025936 | Ga0207670_10092478 | Ga0207670_100924782 | 309 |
| 46 | 3300025981 | Ga0207640_10147634 | Ga0207640_101476342 | 309 |
| 47 | 3300025981 | Ga0207640_10245309 | Ga0207640_102453092 | 309 |
| 48 | 3300026118 | Ga0207675_100075753 | Ga0207675_1000757532 | 309 |
| 49 | 3300027543 | Ga0209999_1006841 | Ga0209999_10068412 | 309 |
| 50 | 3300027682 | Ga0209971_1026979 | Ga0209971_10269792 | 309 |
| 51 | 3300037068 | Ga0373925_0238953 | Ga0373925_0238953_280_1209 | 309 |
| 52 | 3300042001 | Ga0439441_003397 | Ga0439441_003397_610_1539 | 309 |
| 53 | 3300042436 | Ga0439435_0000598 | Ga0439435_0000598_4753_5682 | 309 |
| 54 | 3300042436 | Ga0439435_0000692 | Ga0439435_0000692_544_1473 | 309 |
| 55 | 3300042437 | Ga0439444_0001842 | Ga0439444_0001842_173_1102 | 309 |
| 56 | 3300042437 | Ga0439444_0002291 | Ga0439444_0002291_949_1878 | 309 |
| 57 | 3300042461 | Ga0439460_0000117 | Ga0439460_0000117_7565_8494 | 309 |
| 58 | 3300049574 | Ga0501038_0126417 | Ga0501038_0126417_1020_1949 | 309 |
| 59 | 3300049587 | Ga0501071_0083413 | Ga0501071_0083413_898_1827 | 309 |
| 60 | 3300049588 | Ga0501072_0204177 | Ga0501072_0204177_408_1337 | 309 |
| 61 | 3300050507 | nmdc:mga05p37_95402_c1 | nmdc:mga05p37_95402_c1_2257_3186 | 309 |
| 62 | 3300050508 | nmdc:mga09592_56874_c1 | nmdc:mga09592_56874_c1_82_1011 | 309 |
| 63 | 3300050509 | nmdc:mga0qj67_177928_c1 | nmdc:mga0qj67_177928_c1_71_1000 | 309 |
| 64 | 3300050509 | nmdc:mga0qj67_23223_c1 | nmdc:mga0qj67_23223_c1_595_1524 | 309 |
| 65 | 3300050510 | nmdc:mga06r32_37915_c1 | nmdc:mga06r32_37915_c1_1424_2353 | 309 |
| 66 | 3300050511 | nmdc:mga08y16_233514_c1 | nmdc:mga08y16_233514_c1_356_1285 | 309 |
| 67 | 3300050512 | nmdc:mga0n895_154384_c1 | nmdc:mga0n895_154384_c1_585_1514 | 309 |
| 68 | 3300050514 | nmdc:mga08x19_39821_c1 | nmdc:mga08x19_39821_c1_751_1680 | 309 |
| 69 | 3300005327 | Ga0070658_10153032 | Ga0070658_101530322 | 310 |
| 70 | 3300005329 | Ga0070683_100020488 | Ga0070683_1000204883 | 310 |
| 71 | 3300005330 | Ga0070690_100029378 | Ga0070690_1000293782 | 310 |
| 72 | 3300005336 | Ga0070680_100099233 | Ga0070680_1000992332 | 310 |
| 73 | 3300005336 | Ga0070680_100223417 | Ga0070680_1002234172 | 310 |
| 74 | 3300005336 | Ga0070680_100251383 | Ga0070680_1002513832 | 310 |
| 75 | 3300005339 | Ga0070660_100295215 | Ga0070660_1002952151 | 310 |
| 76 | 3300005345 | Ga0070692_10026730 | Ga0070692_100267302 | 310 |
| 77 | 3300005345 | Ga0070692_10201495 | Ga0070692_102014951 | 310 |
| 78 | 3300005353 | Ga0070669_100025252 | Ga0070669_1000252522 | 310 |
| 79 | 3300005354 | Ga0070675_100016734 | Ga0070675_1000167342 | 310 |
| 80 | 3300005356 | Ga0070674_100269178 | Ga0070674_1002691782 | 310 |
| 81 | 3300005364 | Ga0070673_100162234 | Ga0070673_1001622342 | 310 |
| 82 | 3300005365 | Ga0070688_100066466 | Ga0070688_1000664661 | 310 |
| 83 | 3300005434 | Ga0070709_10108949 | Ga0070709_101089493 | 310 |
| 84 | 3300005435 | Ga0070714_100025279 | Ga0070714_1000252795 | 310 |
| 85 | 3300005435 | Ga0070714_100033210 | Ga0070714_1000332102 | 310 |
| 86 | 3300005436 | Ga0070713_100015249 | Ga0070713_1000152495 | 310 |
| 87 | 3300005436 | Ga0070713_100327083 | Ga0070713_1003270831 | 310 |
| 88 | 3300005438 | Ga0070701_10079697 | Ga0070701_100796972 | 310 |
| 89 | 3300005440 | Ga0070705_100006927 | Ga0070705_1000069271 | 310 |
| 90 | 3300005440 | Ga0070705_100054568 | Ga0070705_1000545682 | 310 |
| 91 | 3300005440 | Ga0070705_100144552 | Ga0070705_1001445522 | 310 |
| 92 | 3300005441 | Ga0070700_100003885 | Ga0070700_1000038853 | 310 |
| 93 | 3300005441 | Ga0070700_100125079 | Ga0070700_1001250792 | 310 |
| 94 | 3300005456 | Ga0070678_100101265 | Ga0070678_1001012652 | 310 |
| 95 | 3300005458 | Ga0070681_10046409 | Ga0070681_100464092 | 310 |
| 96 | 3300005458 | Ga0070681_10091902 | Ga0070681_100919022 | 310 |
| 97 | 3300005459 | Ga0068867_100000969 | Ga0068867_1000009699 | 310 |
| 98 | 3300005459 | Ga0068867_100105117 | Ga0068867_1001051172 | 310 |
| 99 | 3300005459 | Ga0068867_100223438 | Ga0068867_1002234382 | 310 |
| 100 | 3300005459 | Ga0068867_100285136 | Ga0068867_1002851362 | 310 |
| 101 | 3300005466 | Ga0070685_10228359 | Ga0070685_102283592 | 310 |
| 102 | 3300005468 | Ga0070707_100237624 | Ga0070707_1002376242 | 310 |
| 103 | 3300005468 | Ga0070707_100383562 | Ga0070707_1003835622 | 310 |
| 104 | 3300005471 | Ga0070698_100015222 | Ga0070698_1000152222 | 310 |
| 105 | 3300005518 | Ga0070699_100018149 | Ga0070699_1000181493 | 310 |
| 106 | 3300005518 | Ga0070699_100148499 | Ga0070699_1001484992 | 310 |
| 107 | 3300005518 | Ga0070699_100276507 | Ga0070699_1002765071 | 310 |
| 108 | 3300005518 | Ga0070699_100389745 | Ga0070699_1003897451 | 310 |
| 109 | 3300005530 | Ga0070679_100250655 | Ga0070679_1002506552 | 310 |
| 110 | 3300005535 | Ga0070684_100267345 | Ga0070684_1002673452 | 310 |
| 111 | 3300005536 | Ga0070697_100023023 | Ga0070697_1000230234 | 310 |
| 112 | 3300005536 | Ga0070697_100079306 | Ga0070697_1000793063 | 310 |
| 113 | 3300005539 | Ga0068853_100030408 | Ga0068853_1000304081 | 310 |
| 114 | 3300005539 | Ga0068853_100041735 | Ga0068853_1000417353 | 310 |
| 115 | 3300005543 | Ga0070672_100218365 | Ga0070672_1002183652 | 310 |
| 116 | 3300005543 | Ga0070672_100411356 | Ga0070672_1004113562 | 310 |
| 117 | 3300005544 | Ga0070686_100149051 | Ga0070686_1001490512 | 310 |
| 118 | 3300005545 | Ga0070695_100008855 | Ga0070695_1000088554 | 310 |
| 119 | 3300005546 | Ga0070696_100011382 | Ga0070696_1000113824 | 310 |
| 120 | 3300005546 | Ga0070696_100029215 | Ga0070696_1000292152 | 310 |
| 121 | 3300005546 | Ga0070696_100070804 | Ga0070696_1000708042 | 310 |
| 122 | 3300005546 | Ga0070696_100108982 | Ga0070696_1001089822 | 310 |
| 123 | 3300005547 | Ga0070693_100073534 | Ga0070693_1000735342 | 310 |
| 124 | 3300005547 | Ga0070693_100144720 | Ga0070693_1001447202 | 310 |
| 125 | 3300005548 | Ga0070665_100227622 | Ga0070665_1002276222 | 310 |
| 126 | 3300005549 | Ga0070704_100000937 | Ga0070704_1000009373 | 310 |
| 127 | 3300005549 | Ga0070704_100055561 | Ga0070704_1000555613 | 310 |
| 128 | 3300005549 | Ga0070704_100125103 | Ga0070704_1001251031 | 310 |
| 129 | 3300005549 | Ga0070704_100181311 | Ga0070704_1001813112 | 310 |
| 130 | 3300005563 | Ga0068855_100001402 | Ga0068855_10000140213 | 310 |
| 131 | 3300005563 | Ga0068855_100003441 | Ga0068855_10000344113 | 310 |
| 132 | 3300005563 | Ga0068855_100005041 | Ga0068855_10000504111 | 310 |
| 133 | 3300005563 | Ga0068855_100031005 | Ga0068855_1000310054 | 310 |
| 134 | 3300005563 | Ga0068855_100119119 | Ga0068855_1001191192 | 310 |
| 135 | 3300005615 | Ga0070702_100036523 | Ga0070702_1000365232 | 310 |
| 136 | 3300005615 | Ga0070702_100056157 | Ga0070702_1000561572 | 310 |
| 137 | 3300005616 | Ga0068852_100000325 | Ga0068852_10000032512 | 310 |
| 138 | 3300005616 | Ga0068852_100007025 | Ga0068852_1000070252 | 310 |
| 139 | 3300005616 | Ga0068852_100349273 | Ga0068852_1003492732 | 310 |
| 140 | 3300005719 | Ga0068861_100079054 | Ga0068861_1000790542 | 310 |
| 141 | 3300005834 | Ga0068851_10133454 | Ga0068851_101334542 | 310 |
| 142 | 3300005840 | Ga0068870_10046200 | Ga0068870_100462003 | 310 |
| 143 | 3300005842 | Ga0068858_100004218 | Ga0068858_10000421811 | 310 |
| 144 | 3300005844 | Ga0068862_100054720 | Ga0068862_1000547202 | 310 |
| 145 | 3300005844 | Ga0068862_100112963 | Ga0068862_1001129633 | 310 |
| 146 | 3300005844 | Ga0068862_100353617 | Ga0068862_1003536172 | 310 |
| 147 | 3300005844 | Ga0068862_100405943 | Ga0068862_1004059432 | 310 |
| 148 | 3300005985 | Ga0081539_10004048 | Ga0081539_1000404812 | 310 |
| 149 | 3300006173 | Ga0070716_100045431 | Ga0070716_1000454312 | 310 |
| 150 | 3300006173 | Ga0070716_100196142 | Ga0070716_1001961422 | 310 |
| 151 | 3300006195 | Ga0075366_10003064 | Ga0075366_100030643 | 310 |
| 152 | 3300006195 | Ga0075366_10034641 | Ga0075366_100346413 | 310 |
| 153 | 3300006237 | Ga0097621_100018706 | Ga0097621_1000187065 | 310 |
| 154 | 3300006358 | Ga0068871_100068046 | Ga0068871_1000680463 | 310 |
| 155 | 3300006844 | Ga0075428_100020521 | Ga0075428_1000205213 | 310 |
| 156 | 3300006844 | Ga0075428_100032465 | Ga0075428_1000324655 | 310 |
| 157 | 3300006846 | Ga0075430_100112816 | Ga0075430_1001128163 | 310 |
| 158 | 3300006846 | Ga0075430_100158445 | Ga0075430_1001584452 | 310 |
| 159 | 3300006847 | Ga0075431_100068534 | Ga0075431_1000685343 | 310 |
| 160 | 3300006852 | Ga0075433_10029333 | Ga0075433_100293333 | 310 |
| 161 | 3300006852 | Ga0075433_10120361 | Ga0075433_101203612 | 310 |
| 162 | 3300006871 | Ga0075434_100198211 | Ga0075434_1001982112 | 310 |
| 163 | 3300006880 | Ga0075429_100005401 | Ga0075429_1000054015 | 310 |
| 164 | 3300006880 | Ga0075429_100081231 | Ga0075429_1000812312 | 310 |
| 165 | 3300006880 | Ga0075429_100369896 | Ga0075429_1003698962 | 310 |
| 166 | 3300006914 | Ga0075436_100001881 | Ga0075436_1000018812 | 310 |
| 167 | 3300006914 | Ga0075436_100021605 | Ga0075436_1000216052 | 310 |
| 168 | 3300006914 | Ga0075436_100028396 | Ga0075436_1000283962 | 310 |
| 169 | 3300006914 | Ga0075436_100032997 | Ga0075436_1000329973 | 310 |
| 170 | 3300006914 | Ga0075436_100053920 | Ga0075436_1000539202 | 310 |
| 171 | 3300007076 | Ga0075435_100265589 | Ga0075435_1002655892 | 310 |
| 172 | 3300007265 | Ga0099794_10007879 | Ga0099794_100078793 | 310 |
| 173 | 3300007265 | Ga0099794_10048769 | Ga0099794_100487692 | 310 |
| 174 | 3300009093 | Ga0105240_10002337 | Ga0105240_100023376 | 310 |
| 175 | 3300009093 | Ga0105240_10022883 | Ga0105240_100228837 | 310 |
| 176 | 3300009093 | Ga0105240_10066505 | Ga0105240_100665053 | 310 |
| 177 | 3300009093 | Ga0105240_10224909 | Ga0105240_102249092 | 310 |
| 178 | 3300009093 | Ga0105240_10361787 | Ga0105240_103617872 | 310 |
| 179 | 3300009094 | Ga0111539_10011002 | Ga0111539_100110024 | 310 |
| 180 | 3300009094 | Ga0111539_10069699 | Ga0111539_100696992 | 310 |
| 181 | 3300009094 | Ga0111539_10402702 | Ga0111539_104027021 | 310 |
| 182 | 3300009098 | Ga0105245_10250229 | Ga0105245_102502292 | 310 |
| 183 | 3300009147 | Ga0114129_10000341 | Ga0114129_1000034110 | 310 |
| 184 | 3300009147 | Ga0114129_10157888 | Ga0114129_101578883 | 310 |
| 185 | 3300009147 | Ga0114129_10480510 | Ga0114129_104805101 | 310 |
| 186 | 3300009174 | Ga0105241_10031477 | Ga0105241_100314772 | 310 |
| 187 | 3300009176 | Ga0105242_10001654 | Ga0105242_100016547 | 310 |
| 188 | 3300009176 | Ga0105242_10003371 | Ga0105242_100033718 | 310 |
| 189 | 3300009177 | Ga0105248_10066687 | Ga0105248_100666872 | 310 |
| 190 | 3300009177 | Ga0105248_10210403 | Ga0105248_102104032 | 310 |
| 191 | 3300009551 | Ga0105238_10016897 | Ga0105238_100168977 | 310 |
| 192 | 3300009551 | Ga0105238_10073986 | Ga0105238_100739862 | 310 |
| 193 | 3300009551 | Ga0105238_10155804 | Ga0105238_101558042 | 310 |
| 194 | 3300009553 | Ga0105249_10003727 | Ga0105249_100037276 | 310 |
| 195 | 3300013104 | Ga0157370_10027936 | Ga0157370_100279363 | 310 |
| 196 | 3300013104 | Ga0157370_10294723 | Ga0157370_102947231 | 310 |
| 197 | 3300013105 | Ga0157369_10000349 | Ga0157369_1000034949 | 310 |
| 198 | 3300013105 | Ga0157369_10192265 | Ga0157369_101922652 | 310 |
| 199 | 3300013296 | Ga0157374_10017410 | Ga0157374_100174104 | 310 |
| 200 | 3300013297 | Ga0157378_10066939 | Ga0157378_100669395 | 310 |
| 201 | 3300013307 | Ga0157372_10010818 | Ga0157372_100108183 | 310 |
| 202 | 3300013307 | Ga0157372_10089534 | Ga0157372_100895342 | 310 |
| 203 | 3300013307 | Ga0157372_10448778 | Ga0157372_104487782 | 310 |
| 204 | 3300013308 | Ga0157375_10137384 | Ga0157375_101373842 | 310 |
| 205 | 3300013308 | Ga0157375_10450472 | Ga0157375_104504721 | 310 |
| 206 | 3300014326 | Ga0157380_10036704 | Ga0157380_100367043 | 310 |
| 207 | 3300014968 | Ga0157379_10115417 | Ga0157379_101154172 | 310 |
| 208 | 3300014969 | Ga0157376_10074911 | Ga0157376_100749113 | 310 |
| 209 | 3300014969 | Ga0157376_10391953 | Ga0157376_103919531 | 310 |
| 210 | 3300017792 | Ga0163161_10041890 | Ga0163161_100418904 | 310 |
| 211 | 3300021388 | Ga0213875_10047365 | Ga0213875_100473652 | 310 |
| 212 | 3300025321 | Ga0207656_10000723 | Ga0207656_100007236 | 310 |
| 213 | 3300025906 | Ga0207699_10055292 | Ga0207699_100552922 | 310 |
| 214 | 3300025908 | Ga0207643_10011949 | Ga0207643_100119493 | 310 |
| 215 | 3300025908 | Ga0207643_10077688 | Ga0207643_100776883 | 310 |
| 216 | 3300025909 | Ga0207705_10005226 | Ga0207705_100052263 | 310 |
| 217 | 3300025911 | Ga0207654_10122369 | Ga0207654_101223691 | 310 |
| 218 | 3300025912 | Ga0207707_10301469 | Ga0207707_103014692 | 310 |
| 219 | 3300025913 | Ga0207695_10002750 | Ga0207695_1000275022 | 310 |
| 220 | 3300025913 | Ga0207695_10045188 | Ga0207695_100451883 | 310 |
| 221 | 3300025913 | Ga0207695_10102895 | Ga0207695_101028952 | 310 |
| 222 | 3300025913 | Ga0207695_10180357 | Ga0207695_101803572 | 310 |
| 223 | 3300025915 | Ga0207693_10168263 | Ga0207693_101682632 | 310 |
| 224 | 3300025917 | Ga0207660_10077353 | Ga0207660_100773532 | 310 |
| 225 | 3300025917 | Ga0207660_10340976 | Ga0207660_103409761 | 310 |
| 226 | 3300025918 | Ga0207662_10163932 | Ga0207662_101639321 | 310 |
| 227 | 3300025920 | Ga0207649_10025618 | Ga0207649_100256183 | 310 |
| 228 | 3300025921 | Ga0207652_10035705 | Ga0207652_100357053 | 310 |
| 229 | 3300025921 | Ga0207652_10112194 | Ga0207652_101121942 | 310 |
| 230 | 3300025921 | Ga0207652_10201126 | Ga0207652_102011262 | 310 |
| 231 | 3300025923 | Ga0207681_10002870 | Ga0207681_100028705 | 310 |
| 232 | 3300025924 | Ga0207694_10048997 | Ga0207694_100489974 | 310 |
| 233 | 3300025924 | Ga0207694_10108400 | Ga0207694_101084002 | 310 |
| 234 | 3300025924 | Ga0207694_10119353 | Ga0207694_101193532 | 310 |
| 235 | 3300025924 | Ga0207694_10119956 | Ga0207694_101199561 | 310 |
| 236 | 3300025924 | Ga0207694_10317909 | Ga0207694_103179091 | 310 |
| 237 | 3300025926 | Ga0207659_10093829 | Ga0207659_100938291 | 310 |
| 238 | 3300025926 | Ga0207659_10108761 | Ga0207659_101087611 | 310 |
| 239 | 3300025927 | Ga0207687_10010843 | Ga0207687_100108435 | 310 |
| 240 | 3300025928 | Ga0207700_10095716 | Ga0207700_100957161 | 310 |
| 241 | 3300025929 | Ga0207664_10328616 | Ga0207664_103286162 | 310 |
| 242 | 3300025933 | Ga0207706_10430891 | Ga0207706_104308911 | 310 |
| 243 | 3300025934 | Ga0207686_10087331 | Ga0207686_100873312 | 310 |
| 244 | 3300025934 | Ga0207686_10204207 | Ga0207686_102042071 | 310 |
| 245 | 3300025935 | Ga0207709_10076613 | Ga0207709_100766132 | 310 |
| 246 | 3300025935 | Ga0207709_10116390 | Ga0207709_101163902 | 310 |
| 247 | 3300025936 | Ga0207670_10002785 | Ga0207670_100027858 | 310 |
| 248 | 3300025937 | Ga0207669_10184175 | Ga0207669_101841752 | 310 |
| 249 | 3300025939 | Ga0207665_10040865 | Ga0207665_100408652 | 310 |
| 250 | 3300025940 | Ga0207691_10227518 | Ga0207691_102275182 | 310 |
| 251 | 3300025940 | Ga0207691_10277778 | Ga0207691_102777782 | 310 |
| 252 | 3300025941 | Ga0207711_10059101 | Ga0207711_100591013 | 310 |
| 253 | 3300025941 | Ga0207711_10260641 | Ga0207711_102606412 | 310 |
| 254 | 3300025944 | Ga0207661_10048853 | Ga0207661_100488533 | 310 |
| 255 | 3300025949 | Ga0207667_10061644 | Ga0207667_100616442 | 310 |
| 256 | 3300025949 | Ga0207667_10280361 | Ga0207667_102803612 | 310 |
| 257 | 3300025949 | Ga0207667_10379826 | Ga0207667_103798262 | 310 |
| 258 | 3300025960 | Ga0207651_10064426 | Ga0207651_100644263 | 310 |
| 259 | 3300025961 | Ga0207712_10001994 | Ga0207712_100019946 | 310 |
| 260 | 3300025961 | Ga0207712_10217722 | Ga0207712_102177222 | 310 |
| 261 | 3300026035 | Ga0207703_10063531 | Ga0207703_100635312 | 310 |
| 262 | 3300026041 | Ga0207639_10375123 | Ga0207639_103751231 | 310 |
| 263 | 3300026075 | Ga0207708_10009609 | Ga0207708_100096092 | 310 |
| 264 | 3300026075 | Ga0207708_10093734 | Ga0207708_100937344 | 310 |
| 265 | 3300026089 | Ga0207648_10005654 | Ga0207648_100056548 | 310 |
| 266 | 3300026089 | Ga0207648_10263861 | Ga0207648_102638612 | 310 |
| 267 | 3300026116 | Ga0207674_10034782 | Ga0207674_100347824 | 310 |
| 268 | 3300026118 | Ga0207675_100136268 | Ga0207675_1001362683 | 310 |
| 269 | 3300026118 | Ga0207675_100159914 | Ga0207675_1001599142 | 310 |
| 270 | 3300026118 | Ga0207675_100314654 | Ga0207675_1003146542 | 310 |
| 271 | 3300026121 | Ga0207683_10054788 | Ga0207683_100547882 | 310 |
| 272 | 3300026121 | Ga0207683_10284789 | Ga0207683_102847892 | 310 |
| 273 | 3300026142 | Ga0207698_10019377 | Ga0207698_100193773 | 310 |
| 274 | 3300026142 | Ga0207698_10076997 | Ga0207698_100769973 | 310 |
| 275 | 3300026142 | Ga0207698_10164326 | Ga0207698_101643262 | 310 |
| 276 | 3300026142 | Ga0207698_10444773 | Ga0207698_104447731 | 310 |
| 277 | 3300027907 | Ga0207428_10006430 | Ga0207428_100064307 | 310 |
| 278 | 3300027907 | Ga0207428_10128013 | Ga0207428_101280132 | 310 |
| 279 | 3300028379 | Ga0268266_10109233 | Ga0268266_101092332 | 310 |
| 280 | 3300028380 | Ga0268265_10003278 | Ga0268265_100032782 | 310 |
| 281 | 3300028380 | Ga0268265_10291351 | Ga0268265_102913512 | 310 |
| 282 | 3300028380 | Ga0268265_10433529 | Ga0268265_104335292 | 310 |
| 283 | 3300031090 | Ga0265760_10028384 | Ga0265760_100283842 | 310 |
| 284 | 3300031239 | Ga0265328_10001540 | Ga0265328_100015405 | 310 |
| 285 | 3300031242 | Ga0265329_10044228 | Ga0265329_100442281 | 310 |
| 286 | 3300031250 | Ga0265331_10002377 | Ga0265331_100023778 | 310 |
| 287 | 3300031548 | Ga0307408_100034424 | Ga0307408_1000344243 | 310 |
| 288 | 3300031711 | Ga0265314_10000845 | Ga0265314_1000084518 | 310 |
| 289 | 3300031731 | Ga0307405_10219504 | Ga0307405_102195041 | 310 |
| 290 | 3300032002 | Ga0307416_100225726 | Ga0307416_1002257263 | 310 |
| 291 | 3300032002 | Ga0307416_100377491 | Ga0307416_1003774912 | 310 |
| 292 | 3300035086 | Ga0373934_0002203 | Ga0373934_0002203_4729_5661 | 310 |
| 293 | 3300035086 | Ga0373934_0004423 | Ga0373934_0004423_1147_2085 | 310 |
| 294 | 3300035086 | Ga0373934_0031416 | Ga0373934_0031416_1012_1944 | 310 |
| 295 | 3300035111 | Ga0373923_0016037 | Ga0373923_0016037_1115_2047 | 310 |
| 296 | 3300035111 | Ga0373923_0091224 | Ga0373923_0091224_137_1069 | 310 |
| 297 | 3300035112 | Ga0373932_0026240 | Ga0373932_0026240_469_1401 | 310 |
| 298 | 3300035113 | Ga0373936_0014973 | Ga0373936_0014973_788_1720 | 310 |
| 299 | 3300035117 | Ga0373953_0130413 | Ga0373953_0130413_14_946 | 310 |
| 300 | 3300035118 | Ga0373954_0000081 | Ga0373954_0000081_12859_13791 | 310 |
| 301 | 3300035118 | Ga0373954_0000113 | Ga0373954_0000113_3311_4243 | 310 |
| 302 | 3300035118 | Ga0373954_0001250 | Ga0373954_0001250_6673_7605 | 310 |
| 303 | 3300035118 | Ga0373954_0044804 | Ga0373954_0044804_361_1293 | 310 |
| 304 | 3300035119 | Ga0373956_0000034 | Ga0373956_0000034_29117_30055 | 310 |
| 305 | 3300035119 | Ga0373956_0020386 | Ga0373956_0020386_1115_2047 | 310 |
| 306 | 3300035120 | Ga0373957_0003156 | Ga0373957_0003156_926_1864 | 310 |
| 307 | 3300035120 | Ga0373957_0005727 | Ga0373957_0005727_431_1363 | 310 |
| 308 | 3300035171 | Ga0373946_0021022 | Ga0373946_0021022_349_1281 | 310 |
| 309 | 3300035172 | Ga0373955_0015523 | Ga0373955_0015523_1771_2709 | 310 |
| 310 | 3300035172 | Ga0373955_0126294 | Ga0373955_0126294_370_1302 | 310 |
| 311 | 3300035410 | Ga0373924_0044632 | Ga0373924_0044632_74_1006 | 310 |
| 312 | 3300035691 | Ga0373931_0146444 | Ga0373931_0146444_94_1026 | 310 |
| 313 | 3300035695 | Ga0373927_0118713 | Ga0373927_0118713_545_1477 | 310 |
| 314 | 3300035724 | Ga0373933_0000443 | Ga0373933_0000443_5971_6909 | 310 |
| 315 | 3300035724 | Ga0373933_0028331 | Ga0373933_0028331_1934_2866 | 310 |
| 316 | 3300035725 | Ga0373947_0074658 | Ga0373947_0074658_84_1016 | 310 |
| 317 | 3300036401 | Ga0373937_0000372 | Ga0373937_0000372_2519_3457 | 310 |
| 318 | 3300036401 | Ga0373937_0001711 | Ga0373937_0001711_13887_14819 | 310 |
| 319 | 3300036401 | Ga0373937_0021999 | Ga0373937_0021999_3969_4901 | 310 |
| 320 | 3300036401 | Ga0373937_0158147 | Ga0373937_0158147_983_1915 | 310 |
| 321 | 3300036401 | Ga0373937_0251107 | Ga0373937_0251107_431_1363 | 310 |
| 322 | 3300036401 | Ga0373937_0282503 | Ga0373937_0282503_84_1016 | 310 |
| 323 | 3300037068 | Ga0373925_0018939 | Ga0373925_0018939_2336_3268 | 310 |
| 324 | 3300037471 | Ga0395905_0019218 | Ga0395905_0019218_5521_6453 | 310 |
| 325 | 3300037853 | Ga0436364_1508581 | Ga0436364_1508581_5399_6331 | 310 |
| 326 | 3300041406 | Ga0439439_0029557 | Ga0439439_0029557_177_1109 | 310 |
| 327 | 3300042876 | Ga0451577_0137252 | Ga0451577_0137252_185_1117 | 310 |
| 328 | 3300042876 | Ga0451577_0479666 | Ga0451577_0479666_119_1051 | 310 |
| 329 | 3300044706 | Ga0466964_0007550 | Ga0466964_0007550_2544_3476 | 310 |
| 330 | 3300044712 | Ga0453684_0184561 | Ga0453684_0184561_352_1284 | 310 |
| 331 | 3300044712 | Ga0453684_0417363 | Ga0453684_0417363_238_1170 | 310 |
| 332 | 3300044842 | Ga0466957_0041340 | Ga0466957_0041340_311_1243 | 310 |
| 333 | 3300045049 | Ga0466959_0029045 | Ga0466959_0029045_1231_2163 | 310 |
| 334 | 3300045051 | Ga0451576_0107595 | Ga0451576_0107595_925_1857 | 310 |
| 335 | 3300045051 | Ga0451576_0385850 | Ga0451576_0385850_119_1051 | 310 |
| 336 | 3300045976 | Ga0466967_0011505 | Ga0466967_0011505_5541_6473 | 310 |
| 337 | 3300046454 | Ga0495592_0001366 | Ga0495592_0001366_1569_2501 | 310 |
| 338 | 3300046454 | Ga0495592_0001493 | Ga0495592_0001493_2785_3717 | 310 |
| 339 | 3300046454 | Ga0495592_0004439 | Ga0495592_0004439_3829_4761 | 310 |
| 340 | 3300046454 | Ga0495592_0008347 | Ga0495592_0008347_638_1570 | 310 |
| 341 | 3300046454 | Ga0495592_0076133 | Ga0495592_0076133_591_1523 | 310 |
| 342 | 3300046459 | Ga0495629_0056064 | Ga0495629_0056064_1559_2491 | 310 |
| 343 | 3300046461 | Ga0495641_0005331 | Ga0495641_0005331_1519_2451 | 310 |
| 344 | 3300046461 | Ga0495641_0102883 | Ga0495641_0102883_109_1041 | 310 |
| 345 | 3300046462 | Ga0495651_0000056 | Ga0495651_0000056_26935_27873 | 310 |
| 346 | 3300046462 | Ga0495651_0075197 | Ga0495651_0075197_1130_2062 | 310 |
| 347 | 3300046462 | Ga0495651_0235197 | Ga0495651_0235197_300_1232 | 310 |
| 348 | 3300046463 | Ga0495653_0002911 | Ga0495653_0002911_1494_2426 | 310 |
| 349 | 3300046463 | Ga0495653_0076630 | Ga0495653_0076630_816_1748 | 310 |
| 350 | 3300046472 | Ga0495580_0005602 | Ga0495580_0005602_4315_5247 | 310 |
| 351 | 3300046475 | Ga0495639_0001202 | Ga0495639_0001202_9856_10788 | 310 |
| 352 | 3300046476 | Ga0495662_0006369 | Ga0495662_0006369_1361_2293 | 310 |
| 353 | 3300046477 | Ga0495664_0003368 | Ga0495664_0003368_1003_1935 | 310 |
| 354 | 3300046511 | Ga0495608_0002230 | Ga0495608_0002230_1741_2673 | 310 |
| 355 | 3300046511 | Ga0495608_0047953 | Ga0495608_0047953_1534_2466 | 310 |
| 356 | 3300046514 | Ga0495618_0041357 | Ga0495618_0041357_475_1407 | 310 |
| 357 | 3300046516 | Ga0495628_0000532 | Ga0495628_0000532_11621_12553 | 310 |
| 358 | 3300046516 | Ga0495628_0002277 | Ga0495628_0002277_7294_8226 | 310 |
| 359 | 3300046516 | Ga0495628_0017670 | Ga0495628_0017670_4814_5746 | 310 |
| 360 | 3300046516 | Ga0495628_0021328 | Ga0495628_0021328_1003_1935 | 310 |
| 361 | 3300046516 | Ga0495628_0069425 | Ga0495628_0069425_1373_2305 | 310 |
| 362 | 3300046517 | Ga0495630_0004976 | Ga0495630_0004976_5500_6432 | 310 |
| 363 | 3300046526 | Ga0495666_0002281 | Ga0495666_0002281_6939_7871 | 310 |
| 364 | 3300046526 | Ga0495666_0013811 | Ga0495666_0013811_2187_3119 | 310 |
| 365 | 3300046529 | Ga0495652_0002507 | Ga0495652_0002507_7333_8265 | 310 |
| 366 | 3300046529 | Ga0495652_0073319 | Ga0495652_0073319_877_1809 | 310 |
| 367 | 3300046529 | Ga0495652_0100231 | Ga0495652_0100231_900_1832 | 310 |
| 368 | 3300046529 | Ga0495652_0102392 | Ga0495652_0102392_742_1674 | 310 |
| 369 | 3300046531 | Ga0495665_0048980 | Ga0495665_0048980_758_1690 | 310 |
| 370 | 3300046533 | Ga0495640_0032482 | Ga0495640_0032482_2482_3414 | 310 |
| 371 | 3300046535 | Ga0495586_0006091 | Ga0495586_0006091_2919_3851 | 310 |
| 372 | 3300046535 | Ga0495586_0051019 | Ga0495586_0051019_304_1236 | 310 |
| 373 | 3300046535 | Ga0495586_0169257 | Ga0495586_0169257_186_1118 | 310 |
| 374 | 3300046536 | Ga0495587_0003519 | Ga0495587_0003519_6282_7214 | 310 |
| 375 | 3300046536 | Ga0495587_0068210 | Ga0495587_0068210_857_1789 | 310 |
| 376 | 3300046536 | Ga0495587_0077374 | Ga0495587_0077374_426_1358 | 310 |
| 377 | 3300046537 | Ga0495598_0021124 | Ga0495598_0021124_319_1251 | 310 |
| 378 | 3300046539 | Ga0495621_0070320 | Ga0495621_0070320_107_1039 | 310 |
| 379 | 3300046543 | Ga0495645_0000502 | Ga0495645_0000502_7163_8095 | 310 |
| 380 | 3300046543 | Ga0495645_0107749 | Ga0495645_0107749_681_1613 | 310 |
| 381 | 3300046559 | Ga0495667_0028552 | Ga0495667_0028552_1787_2719 | 310 |
| 382 | 3300046559 | Ga0495667_0045555 | Ga0495667_0045555_1003_1935 | 310 |
| 383 | 3300046642 | Ga0495634_0072129 | Ga0495634_0072129_203_1135 | 310 |
| 384 | 3300046663 | Ga0495635_0004806 | Ga0495635_0004806_968_1900 | 310 |
| 385 | 3300046663 | Ga0495635_0017682 | Ga0495635_0017682_2100_3032 | 310 |
| 386 | 3300046675 | Ga0495657_0016008 | Ga0495657_0016008_1496_2428 | 310 |
| 387 | 3300046675 | Ga0495657_0026776 | Ga0495657_0026776_2586_3518 | 310 |
| 388 | 3300046678 | Ga0495599_0001123 | Ga0495599_0001123_13465_14397 | 310 |
| 389 | 3300046678 | Ga0495599_0022963 | Ga0495599_0022963_552_1484 | 310 |
| 390 | 3300046678 | Ga0495599_0026836 | Ga0495599_0026836_1612_2544 | 310 |
| 391 | 3300046678 | Ga0495599_0062282 | Ga0495599_0062282_392_1324 | 310 |
| 392 | 3300046679 | Ga0495623_0105668 | Ga0495623_0105668_462_1394 | 310 |
| 393 | 3300046681 | Ga0495647_0000693 | Ga0495647_0000693_8301_9233 | 310 |
| 394 | 3300046683 | Ga0495658_0003469 | Ga0495658_0003469_5500_6432 | 310 |
| 395 | 3300046683 | Ga0495658_0198118 | Ga0495658_0198118_264_1196 | 310 |
| 396 | 3300046684 | Ga0495669_0009889 | Ga0495669_0009889_1292_2224 | 310 |
| 397 | 3300046689 | Ga0495613_0012092 | Ga0495613_0012092_2469_3401 | 310 |
| 398 | 3300046689 | Ga0495613_0020534 | Ga0495613_0020534_2187_3119 | 310 |
| 399 | 3300046809 | Ga0495600_0009363 | Ga0495600_0009363_2412_3344 | 310 |
| 400 | 3300046809 | Ga0495600_0009561 | Ga0495600_0009561_4730_5662 | 310 |
| 401 | 3300047317 | Ga0495604_0007827 | Ga0495604_0007827_7280_8212 | 310 |
| 402 | 3300047317 | Ga0495604_0042437 | Ga0495604_0042437_1496_2428 | 310 |
| 403 | 3300047318 | Ga0495636_0017406 | Ga0495636_0017406_142_1074 | 310 |
| 404 | 3300047319 | Ga0495674_0004795 | Ga0495674_0004795_1496_2428 | 310 |
| 405 | 3300047322 | Ga0495680_0012907 | Ga0495680_0012907_5958_6890 | 310 |
| 406 | 3300047322 | Ga0495680_0094373 | Ga0495680_0094373_304_1236 | 310 |
| 407 | 3300047322 | Ga0495680_0102000 | Ga0495680_0102000_816_1748 | 310 |
| 408 | 3300047322 | Ga0495680_0169904 | Ga0495680_0169904_431_1369 | 310 |
| 409 | 3300047444 | Ga0495675_0002113 | Ga0495675_0002113_782_1714 | 310 |
| 410 | 3300047471 | Ga0495684_0043615 | Ga0495684_0043615_1534_2466 | 310 |
| 411 | 3300047471 | Ga0495684_0085778 | Ga0495684_0085778_462_1394 | 310 |
| 412 | 3300047673 | Ga0495593_0107806 | Ga0495593_0107806_315_1247 | 310 |
| 413 | 3300048907 | Ga0496104_0081492 | Ga0496104_0081492_104_1036 | 310 |
| 414 | 3300048909 | Ga0496106_0139269 | Ga0496106_0139269_809_1741 | 310 |
| 415 | 3300048913 | Ga0496110_0038826 | Ga0496110_0038826_1716_2648 | 310 |
| 416 | 3300049568 | Ga0501031_0020879 | Ga0501031_0020879_2533_3465 | 310 |
| 417 | 3300049570 | Ga0501033_0006757 | Ga0501033_0006757_4500_5432 | 310 |
| 418 | 3300049572 | Ga0501036_0000162 | Ga0501036_0000162_1084_2016 | 310 |
| 419 | 3300049573 | Ga0501037_0043345 | Ga0501037_0043345_1526_2458 | 310 |
| 420 | 3300049574 | Ga0501038_0001044 | Ga0501038_0001044_2961_3893 | 310 |
| 421 | 3300049575 | Ga0501039_0002679 | Ga0501039_0002679_8582_9514 | 310 |
| 422 | 3300049575 | Ga0501039_0059602 | Ga0501039_0059602_1830_2762 | 310 |
| 423 | 3300049575 | Ga0501039_0076946 | Ga0501039_0076946_1340_2272 | 310 |
| 424 | 3300049576 | Ga0501040_0000167 | Ga0501040_0000167_32155_33087 | 310 |
| 425 | 3300049576 | Ga0501040_0077338 | Ga0501040_0077338_189_1121 | 310 |
| 426 | 3300049578 | Ga0501042_0000122 | Ga0501042_0000122_1641_2573 | 310 |
| 427 | 3300049578 | Ga0501042_0058277 | Ga0501042_0058277_694_1626 | 310 |
| 428 | 3300049580 | Ga0501046_0001014 | Ga0501046_0001014_12395_13327 | 310 |
| 429 | 3300049581 | Ga0501047_0002291 | Ga0501047_0002291_549_1481 | 310 |
| 430 | 3300049582 | Ga0501048_0000147 | Ga0501048_0000147_28929_29861 | 310 |
| 431 | 3300049583 | Ga0501067_0109076 | Ga0501067_0109076_273_1205 | 310 |
| 432 | 3300049584 | Ga0501068_0018296 | Ga0501068_0018296_497_1429 | 310 |
| 433 | 3300049585 | Ga0501069_0000781 | Ga0501069_0000781_622_1554 | 310 |
| 434 | 3300049586 | Ga0501070_0003184 | Ga0501070_0003184_10649_11581 | 310 |
| 435 | 3300049587 | Ga0501071_0025357 | Ga0501071_0025357_3146_4078 | 310 |
| 436 | 3300049588 | Ga0501072_0182813 | Ga0501072_0182813_492_1424 | 310 |
| 437 | 3300049589 | Ga0501073_0000370 | Ga0501073_0000370_26918_27850 | 310 |
| 438 | 3300049590 | Ga0501074_0002082 | Ga0501074_0002082_551_1483 | 310 |
| 439 | 3300049591 | Ga0501075_0001960 | Ga0501075_0001960_871_1803 | 310 |
| 440 | 3300049591 | Ga0501075_0015847 | Ga0501075_0015847_1625_2557 | 310 |
| 441 | 3300049591 | Ga0501075_0298511 | Ga0501075_0298511_113_1048 | 310 |
| 442 | 3300049592 | Ga0501076_0000726 | Ga0501076_0000726_8419_9351 | 310 |
| 443 | 3300049592 | Ga0501076_0026775 | Ga0501076_0026775_704_1636 | 310 |
| 444 | 3300049593 | Ga0501077_0000231 | Ga0501077_0000231_2649_3581 | 310 |
| 445 | 3300049741 | Ga0501079_0000211 | Ga0501079_0000211_28467_29399 | 310 |
| 446 | 3300049741 | Ga0501079_0060506 | Ga0501079_0060506_78_1010 | 310 |
| 447 | 3300049741 | Ga0501079_0415049 | Ga0501079_0415049_92_1024 | 310 |
| 448 | 3300049742 | Ga0501080_0001759 | Ga0501080_0001759_1282_2214 | 310 |
| 449 | 3300049742 | Ga0501080_0027900 | Ga0501080_0027900_1459_2391 | 310 |
| 450 | 3300049742 | Ga0501080_0060796 | Ga0501080_0060796_2474_3406 | 310 |
| 451 | 3300049743 | Ga0501081_0001106 | Ga0501081_0001106_13428_14360 | 310 |
| 452 | 3300049744 | Ga0501083_0013773 | Ga0501083_0013773_4011_4943 | 310 |
| 453 | 3300049823 | Ga0501044_0190739 | Ga0501044_0190739_306_1238 | 310 |
| 454 | 3300049824 | Ga0501045_0000489 | Ga0501045_0000489_20897_21829 | 310 |
| 455 | 3300049824 | Ga0501045_0011791 | Ga0501045_0011791_4338_5270 | 310 |
| 456 | 3300049824 | Ga0501045_0261708 | Ga0501045_0261708_319_1251 | 310 |
| 457 | 3300050493 | nmdc:mga0k408_11885_c2 | nmdc:mga0k408_11885_c2_2499_3431 | 310 |
| 458 | 3300050493 | nmdc:mga0k408_175992_c1 | nmdc:mga0k408_175992_c1_214_1146 | 310 |
| 459 | 3300050493 | nmdc:mga0k408_32688_c1 | nmdc:mga0k408_32688_c1_792_1724 | 310 |
| 460 | 3300050507 | nmdc:mga05p37_156714_c1 | nmdc:mga05p37_156714_c1_1594_2526 | 310 |
| 461 | 3300050507 | nmdc:mga05p37_24332_c1 | nmdc:mga05p37_24332_c1_956_1888 | 310 |
| 462 | 3300050507 | nmdc:mga05p37_471977_c1 | nmdc:mga05p37_471977_c1_441_1373 | 310 |
| 463 | 3300050509 | nmdc:mga0qj67_293964_c1 | nmdc:mga0qj67_293964_c1_97_1029 | 310 |
| 464 | 3300050510 | nmdc:mga06r32_59976_c1 | nmdc:mga06r32_59976_c1_2342_3274 | 310 |
| 465 | 3300050511 | nmdc:mga08y16_212251_c1 | nmdc:mga08y16_212251_c1_159_1091 | 310 |
| 466 | 3300050511 | nmdc:mga08y16_226469_c1 | nmdc:mga08y16_226469_c1_805_1737 | 310 |
| 467 | 3300050511 | nmdc:mga08y16_280408_c1 | nmdc:mga08y16_280408_c1_381_1313 | 310 |
| 468 | 3300050512 | nmdc:mga0n895_133579_c1 | nmdc:mga0n895_133579_c1_309_1241 | 310 |
| 469 | 3300050512 | nmdc:mga0n895_143956_c1 | nmdc:mga0n895_143956_c1_1102_2034 | 310 |
| 470 | 3300050513 | nmdc:mga0rr50_26715_c1 | nmdc:mga0rr50_26715_c1_3091_4023 | 310 |
| 471 | 3300050514 | nmdc:mga08x19_12791_c1 | nmdc:mga08x19_12791_c1_3766_4698 | 310 |
| 472 | 3300050514 | nmdc:mga08x19_1505_c1 | nmdc:mga08x19_1505_c1_12211_13143 | 310 |
| 473 | 3300050514 | nmdc:mga08x19_233500_c1 | nmdc:mga08x19_233500_c1_122_1054 | 310 |
| 474 | 3300050514 | nmdc:mga08x19_334263_c1 | nmdc:mga08x19_334263_c1_23_955 | 310 |
| 475 | 3300050514 | nmdc:mga08x19_58159_c1 | nmdc:mga08x19_58159_c1_505_1437 | 310 |
| 476 | 3300050515 | nmdc:mga0a205_149754_c1 | nmdc:mga0a205_149754_c1_1089_2021 | 310 |
| 477 | 3300050515 | nmdc:mga0a205_75607_c1 | nmdc:mga0a205_75607_c1_1902_2834 | 310 |
| 478 | 3300053077 | Ga0495601_0000144 | Ga0495601_0000144_31848_32780 | 310 |
| 479 | 3300053077 | Ga0495601_0007306 | Ga0495601_0007306_1321_2253 | 310 |
| 480 | 3300053077 | Ga0495601_0257074 | Ga0495601_0257074_109_1041 | 310 |
| 481 | 3300053084 | Ga0495595_0001310 | Ga0495595_0001310_1676_2608 | 310 |
| 482 | 3300053085 | Ga0495619_0071640 | Ga0495619_0071640_385_1317 | 310 |
| 483 | 3300054114 | Ga0501084_0000262 | Ga0501084_0000262_30694_31626 | 310 |
| 484 | 3300054114 | Ga0501084_0143451 | Ga0501084_0143451_892_1824 | 310 |
| 485 | 3300059426 | Ga0590077_027238 | Ga0590077_027238_246_1178 | 310 |
| 486 | 3300060353 | Ga0501082_0002140 | Ga0501082_0002140_13456_14388 | 310 |
| 487 | 3300060353 | Ga0501082_0319382 | Ga0501082_0319382_252_1184 | 310 |
| 488 | 3300061734 | Ga0530510_0000114 | Ga0530510_0000114_7199_8131 | 310 |
| 489 | 3300061734 | Ga0530510_0001981 | Ga0530510_0001981_1966_2898 | 310 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tqq-assembly1.cif.gz_A | structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii | 0.9252 | 2 | 309 |
| 4iqf-assembly2.cif.gz_B | crystal structure of methyionyl-trna formyltransferase from bacillus anthracis | 0.9159 | 1 | 310 |
| 3tqq-assembly1.cif.gz_A | structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii | 0.9137 | 2 | 309 |
| 4iqf-assembly2.cif.gz_B | crystal structure of methyionyl-trna formyltransferase from bacillus anthracis | 0.9131 | 1 | 310 |
| 3q0i-assembly1.cif.gz_A | methionyl-trna formyltransferase from vibrio cholerae | 0.9127 | 1 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G5ECV9_1_209_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9484 | 1 | 199 | 3.40.50.170 |
| 3tqqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9304 | 2 | 201 | 3.40.50.170 |
| 3tqqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9167 | 2 | 201 | 3.40.50.170 |
| af_B4FRN6_28_246_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9078 | 2 | 201 | 3.40.50.170 |
| 2blnB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9052 | 1 | 200 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3Q1E9-F1-model_v4 | deleted | 0.9897 | 1 | 170 |
|
| AF-A0A1F3ZN46-F1-model_v4 | Methionyl-tRNA formyltransferase | 0.9886 | 1 | 310 |
GO:0004479
GO:0005829 |
| AF-A0A519XIL3-F1-model_v4 | deleted | 0.9879 | 1 | 271 |
|
| AF-A0A519XIL3-F1-model_v4 | deleted | 0.9843 | 1 | 271 |
|
| AF-A0A4Q3Q1E9-F1-model_v4 | deleted | 0.9782 | 1 | 170 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar