F453808

General Info

Members Datasets Scaffolds Average Seq Length
489 261 489 309

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0004423|Ga0373934_0004423_1147_2085
Length 312
Sequence VTVKIAIIGQQDFGKGVLDAFLARGDDVAGVFCAPEKEGAKADVLKVAAQEKGVKVFQFSSLRNKEAHDAMRSLGADLGVMAYVLQFAPQEFVNIPKKGTIQYHPSLLPKYRGPSSINWPIIRGDTKTGLTIFRPNDGLDEGPVILQKETPISADDTLGSVYFDRLFPMGVKAMLEAADLVVAGKHRETVQDESHASYEGWCRAPEAKINWANHVDFVYNVIRGCNPAPGAWTTLNGKKVQIFDSRKQLIRTFGAVKGKIGEISEIGPQSFFVTAQGGRVEVLKAKHEEGKKVSSPEFVAQNSLAVGTLLGS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 0.61
Rhizosphere 97.14
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10153032 3300005327 Bacteria 1932
2 Ga0070683_100020488 3300005329 Bacteria 5884
3 Ga0070690_100029378 3300005330 Bacteria 3409
4 Ga0070690_100312575 3300005330 Bacteria 1130
5 Ga0070680_100099233 3300005336 Bacteria 2416
6 Ga0070680_100223417 3300005336 Bacteria 1590
7 Ga0070680_100251383 3300005336 Bacteria 1494
8 Ga0070660_100295215 3300005339 Bacteria 1328
9 Ga0070692_10026730 3300005345 Bacteria 2856
10 Ga0070692_10201495 3300005345 Bacteria 1166
11 Ga0070669_100025252 3300005353 Bacteria 4267
12 Ga0070675_100016734 3300005354 Bacteria 5821
13 Ga0070674_100269178 3300005356 Bacteria 1346
14 Ga0070673_100162234 3300005364 Bacteria 1902
15 Ga0070688_100066466 3300005365 Bacteria 2294
16 Ga0070709_10108949 3300005434 Bacteria 1859
17 Ga0070714_100025279 3300005435 Bacteria 4899
18 Ga0070714_100033210 3300005435 Bacteria 4313
19 Ga0070713_100015249 3300005436 Bacteria 5734
20 Ga0070713_100327083 3300005436 Bacteria 1417
21 Ga0070701_10018276 3300005438 Bacteria 3292
22 Ga0070701_10079697 3300005438 Bacteria 1770
23 Ga0070705_100006927 3300005440 Bacteria 5568
24 Ga0070705_100054568 3300005440 Bacteria 2345
25 Ga0070705_100144552 3300005440 Bacteria 1570
26 Ga0070700_100003885 3300005441 Bacteria 7761
27 Ga0070700_100125079 3300005441 Bacteria 1728
28 Ga0070694_100005005 3300005444 Bacteria 7993
29 Ga0070678_100101265 3300005456 Bacteria 2233
30 Ga0070681_10046409 3300005458 Bacteria 4343
31 Ga0070681_10091902 3300005458 Bacteria 2984
32 Ga0068867_100000969 3300005459 Bacteria 19579
33 Ga0068867_100105117 3300005459 Bacteria 2162
34 Ga0068867_100223438 3300005459 Bacteria 1519
35 Ga0068867_100285136 3300005459 Bacteria 1356
36 Ga0070685_10228359 3300005466 Bacteria 1223
37 Ga0070707_100237624 3300005468 Bacteria 1774
38 Ga0070707_100383562 3300005468 Bacteria 1365
39 Ga0070698_100015222 3300005471 Bacteria 8134
40 Ga0070699_100018149 3300005518 Bacteria 6045
41 Ga0070699_100148499 3300005518 Bacteria 2072
42 Ga0070699_100276507 3300005518 Bacteria 1504
43 Ga0070699_100389745 3300005518 Bacteria 1259
44 Ga0070679_100250655 3300005530 Bacteria 1727
45 Ga0070684_100267345 3300005535 Bacteria 1565
46 Ga0070697_100023023 3300005536 Bacteria 4954
47 Ga0070697_100079306 3300005536 Bacteria 2703
48 Ga0068853_100030408 3300005539 Bacteria 4561
49 Ga0068853_100041735 3300005539 Bacteria 3921
50 Ga0070672_100218365 3300005543 Bacteria 1598
51 Ga0070672_100411356 3300005543 Bacteria 1160
52 Ga0070686_100149051 3300005544 Bacteria 1637
53 Ga0070695_100008855 3300005545 Bacteria 5979
54 Ga0070695_100036287 3300005545 Bacteria 3101
55 Ga0070695_100150972 3300005545 Bacteria 1621
56 Ga0070696_100011382 3300005546 Bacteria 5959
57 Ga0070696_100029215 3300005546 Bacteria 3766
58 Ga0070696_100070804 3300005546 Bacteria 2454
59 Ga0070696_100108982 3300005546 Bacteria 1993
60 Ga0070693_100073534 3300005547 Bacteria 2019
61 Ga0070693_100144720 3300005547 Bacteria 1500
62 Ga0070665_100227622 3300005548 Bacteria 1865
63 Ga0070704_100000937 3300005549 Bacteria 14739
64 Ga0070704_100015120 3300005549 Bacteria 4839
65 Ga0070704_100055561 3300005549 Bacteria 2808
66 Ga0070704_100096288 3300005549 Bacteria 2218
67 Ga0070704_100125103 3300005549 Bacteria 1982
68 Ga0070704_100181311 3300005549 Bacteria 1685
69 Ga0068855_100001402 3300005563 Bacteria 29881
70 Ga0068855_100003441 3300005563 Bacteria 19369
71 Ga0068855_100005041 3300005563 Bacteria 16117
72 Ga0068855_100031005 3300005563 Bacteria 6389
73 Ga0068855_100119119 3300005563 Bacteria 3023
74 Ga0070702_100036523 3300005615 Bacteria 2722
75 Ga0070702_100056157 3300005615 Bacteria 2273
76 Ga0068852_100000325 3300005616 Bacteria 32471
77 Ga0068852_100007025 3300005616 Bacteria 8196
78 Ga0068852_100349273 3300005616 Bacteria 1444
79 Ga0068859_100032805 3300005617 Bacteria 5217
80 Ga0068861_100079054 3300005719 Bacteria 2570
81 Ga0068851_10133454 3300005834 Bacteria 1345
82 Ga0068870_10046200 3300005840 Bacteria 2282
83 Ga0068858_100004218 3300005842 Bacteria 14156
84 Ga0068862_100054720 3300005844 Bacteria 3416
85 Ga0068862_100112963 3300005844 Bacteria 2386
86 Ga0068862_100353617 3300005844 Bacteria 1364
87 Ga0068862_100405943 3300005844 Bacteria 1275
88 Ga0081538_10145017 3300005981 Bacteria 1087
89 Ga0081539_10004048 3300005985 Bacteria 16799
90 Ga0075365_10057135 3300006038 Bacteria 2596
91 Ga0070716_100045431 3300006173 Bacteria 2466
92 Ga0070716_100196142 3300006173 Bacteria 1338
93 Ga0075366_10003064 3300006195 Bacteria 8726
94 Ga0075366_10031205 3300006195 Bacteria 3135
95 Ga0075366_10034641 3300006195 Bacteria 2974
96 Ga0097621_100018706 3300006237 Bacteria 5301
97 Ga0068871_100068046 3300006358 Bacteria 2923
98 Ga0075428_100020521 3300006844 Bacteria 7316
99 Ga0075428_100032465 3300006844 Bacteria 5767
100 Ga0075430_100001652 3300006846 Bacteria 18197
101 Ga0075430_100112816 3300006846 Bacteria 2266
102 Ga0075430_100158445 3300006846 Bacteria 1885
103 Ga0075430_100306460 3300006846 Bacteria 1313
104 Ga0075431_100068534 3300006847 Bacteria 3661
105 Ga0075433_10029333 3300006852 Bacteria 4685
106 Ga0075433_10120361 3300006852 Bacteria 2331
107 Ga0075434_100125356 3300006871 Bacteria 2585
108 Ga0075434_100198211 3300006871 Bacteria 2027
109 Ga0075429_100005401 3300006880 Bacteria 10997
110 Ga0075429_100081231 3300006880 Bacteria 2826
111 Ga0075429_100369896 3300006880 Bacteria 1255
112 Ga0075436_100001881 3300006914 Bacteria 14420
113 Ga0075436_100021605 3300006914 Bacteria 4418
114 Ga0075436_100028396 3300006914 Bacteria 3849
115 Ga0075436_100032997 3300006914 Bacteria 3567
116 Ga0075436_100053920 3300006914 Bacteria 2776
117 Ga0075436_100080160 3300006914 Bacteria 2262
118 Ga0097620_100032804 3300006931 Bacteria 5217
119 Ga0075435_100265589 3300007076 Bacteria 1463
120 Ga0075435_100311734 3300007076 Bacteria 1346
121 Ga0099794_10007879 3300007265 Bacteria 4402
122 Ga0099794_10048769 3300007265 Bacteria 2033
123 Ga0105240_10002337 3300009093 Bacteria 30662
124 Ga0105240_10022883 3300009093 Bacteria 8278
125 Ga0105240_10066505 3300009093 Bacteria 4471
126 Ga0105240_10224909 3300009093 Bacteria 2184
127 Ga0105240_10361787 3300009093 Bacteria 1643
128 Ga0111539_10011002 3300009094 Bacteria 11389
129 Ga0111539_10069699 3300009094 Bacteria 4152
130 Ga0111539_10402702 3300009094 Bacteria 1594
131 Ga0105245_10250229 3300009098 Bacteria 1721
132 Ga0114129_10000341 3300009147 Bacteria 54331
133 Ga0114129_10157888 3300009147 Bacteria 3101
134 Ga0114129_10480510 3300009147 Bacteria 1626
135 Ga0105241_10031477 3300009174 Bacteria 3973
136 Ga0105241_10134027 3300009174 Bacteria 2009
137 Ga0105242_10001654 3300009176 Bacteria 17608
138 Ga0105242_10003371 3300009176 Bacteria 12437
139 Ga0105248_10066687 3300009177 Bacteria 4040
140 Ga0105248_10210403 3300009177 Bacteria 2191
141 Ga0105238_10016897 3300009551 Bacteria 7404
142 Ga0105238_10073986 3300009551 Bacteria 3400
143 Ga0105238_10155804 3300009551 Bacteria 2259
144 Ga0105249_10003727 3300009553 Bacteria 13150
145 Ga0157370_10027936 3300013104 Bacteria 5558
146 Ga0157370_10118679 3300013104 Bacteria 2470
147 Ga0157370_10294723 3300013104 Bacteria 1498
148 Ga0157369_10000349 3300013105 Bacteria 61491
149 Ga0157369_10192265 3300013105 Bacteria 2144
150 Ga0157374_10017410 3300013296 Bacteria 6326
151 Ga0157378_10066939 3300013297 Bacteria 3218
152 Ga0157372_10010818 3300013307 Bacteria 9713
153 Ga0157372_10089534 3300013307 Bacteria 3497
154 Ga0157372_10448778 3300013307 Bacteria 1503
155 Ga0157375_10137384 3300013308 Bacteria 2569
156 Ga0157375_10450472 3300013308 Bacteria 1453
157 Ga0157380_10036704 3300014326 Bacteria 3793
158 Ga0157380_10133235 3300014326 Bacteria 2123
159 Ga0157380_10193542 3300014326 Bacteria 1798
160 Ga0157379_10115417 3300014968 Bacteria 2414
161 Ga0157376_10074911 3300014969 Bacteria 2887
162 Ga0157376_10391953 3300014969 Bacteria 1341
163 Ga0163161_10041890 3300017792 Bacteria 3292
164 Ga0213875_10047365 3300021388 Bacteria 2017
165 Ga0207656_10000723 3300025321 Bacteria 10811
166 Ga0207699_10055292 3300025906 Bacteria 2361
167 Ga0207643_10011949 3300025908 Bacteria 4688
168 Ga0207643_10077688 3300025908 Bacteria 1919
169 Ga0207705_10005226 3300025909 Bacteria 9730
170 Ga0207654_10122369 3300025911 Bacteria 1636
171 Ga0207707_10301469 3300025912 Bacteria 1385
172 Ga0207695_10002750 3300025913 Bacteria 25639
173 Ga0207695_10045188 3300025913 Bacteria 4678
174 Ga0207695_10102895 3300025913 Bacteria 2848
175 Ga0207695_10180357 3300025913 Bacteria 2032
176 Ga0207693_10168263 3300025915 Bacteria 1726
177 Ga0207660_10077353 3300025917 Bacteria 2436
178 Ga0207660_10340976 3300025917 Bacteria 1200
179 Ga0207662_10163932 3300025918 Bacteria 1422
180 Ga0207649_10025618 3300025920 Bacteria 3441
181 Ga0207652_10035705 3300025921 Bacteria 4198
182 Ga0207652_10112194 3300025921 Bacteria 2419
183 Ga0207652_10201126 3300025921 Bacteria 1793
184 Ga0207681_10002870 3300025923 Bacteria 10886
185 Ga0207694_10048997 3300025924 Bacteria 3269
186 Ga0207694_10108400 3300025924 Bacteria 2207
187 Ga0207694_10119353 3300025924 Bacteria 2104
188 Ga0207694_10119956 3300025924 Bacteria 2099
189 Ga0207694_10317909 3300025924 Bacteria 1284
190 Ga0207659_10093829 3300025926 Bacteria 2247
191 Ga0207659_10108761 3300025926 Bacteria 2103
192 Ga0207687_10010843 3300025927 Bacteria 5957
193 Ga0207700_10095716 3300025928 Bacteria 2356
194 Ga0207664_10328616 3300025929 Bacteria 1350
195 Ga0207706_10430891 3300025933 Bacteria 1142
196 Ga0207686_10087331 3300025934 Bacteria 2051
197 Ga0207686_10204207 3300025934 Bacteria 1417
198 Ga0207709_10076613 3300025935 Bacteria 2141
199 Ga0207709_10116390 3300025935 Bacteria 1797
200 Ga0207670_10002785 3300025936 Bacteria 9214
201 Ga0207670_10092478 3300025936 Bacteria 2141
202 Ga0207669_10184175 3300025937 Bacteria 1500
203 Ga0207665_10040865 3300025939 Bacteria 3095
204 Ga0207691_10227518 3300025940 Bacteria 1616
205 Ga0207691_10277778 3300025940 Bacteria 1442
206 Ga0207711_10059101 3300025941 Bacteria 3301
207 Ga0207711_10260641 3300025941 Bacteria 1593
208 Ga0207661_10048853 3300025944 Bacteria 3365
209 Ga0207667_10061644 3300025949 Bacteria 3923
210 Ga0207667_10280361 3300025949 Bacteria 1703
211 Ga0207667_10379826 3300025949 Bacteria 1440
212 Ga0207651_10064426 3300025960 Bacteria 2565
213 Ga0207712_10001994 3300025961 Bacteria 13400
214 Ga0207712_10217722 3300025961 Bacteria 1525
215 Ga0207640_10147634 3300025981 Bacteria 1723
216 Ga0207640_10245309 3300025981 Bacteria 1387
217 Ga0207703_10063531 3300026035 Bacteria 3027
218 Ga0207639_10375123 3300026041 Bacteria 1276
219 Ga0207708_10009609 3300026075 Bacteria 7170
220 Ga0207708_10093734 3300026075 Bacteria 2317
221 Ga0207648_10005654 3300026089 Bacteria 12553
222 Ga0207648_10263861 3300026089 Bacteria 1537
223 Ga0207674_10034782 3300026116 Bacteria 5263
224 Ga0207675_100075753 3300026118 Bacteria 3150
225 Ga0207675_100136268 3300026118 Bacteria 2330
226 Ga0207675_100159914 3300026118 Bacteria 2148
227 Ga0207675_100314654 3300026118 Bacteria 1527
228 Ga0207683_10054788 3300026121 Bacteria 3497
229 Ga0207683_10284789 3300026121 Bacteria 1510
230 Ga0207698_10019377 3300026142 Bacteria 4656
231 Ga0207698_10076997 3300026142 Bacteria 2672
232 Ga0207698_10164326 3300026142 Bacteria 1946
233 Ga0207698_10444773 3300026142 Bacteria 1250
234 Ga0209973_1003160 3300027252 Bacteria 1600
235 Ga0209969_1002452 3300027360 Bacteria 2564
236 Ga0209967_1003832 3300027364 Bacteria 1986
237 Ga0210000_1001350 3300027462 Bacteria 3451
238 Ga0209968_1007588 3300027526 Bacteria 1643
239 Ga0209999_1006841 3300027543 Bacteria 2052
240 Ga0209971_1026979 3300027682 Bacteria 1373
241 Ga0209974_10001168 3300027876 Bacteria 9369
242 Ga0207428_10006430 3300027907 Bacteria 10850
243 Ga0207428_10128013 3300027907 Bacteria 1944
244 Ga0268266_10109233 3300028379 Bacteria 2449
245 Ga0268265_10003278 3300028380 Bacteria 11732
246 Ga0268265_10291351 3300028380 Bacteria 1465
247 Ga0268265_10433529 3300028380 Bacteria 1223
248 Ga0265760_10028384 3300031090 Bacteria 1642
249 Ga0265328_10001540 3300031239 Bacteria 10635
250 Ga0265329_10044228 3300031242 Bacteria 1424
251 Ga0265331_10002377 3300031250 Bacteria 12772
252 Ga0307408_100034424 3300031548 Bacteria 3549
253 Ga0265314_10000845 3300031711 Bacteria 36266
254 Ga0307405_10219504 3300031731 Bacteria 1394
255 Ga0307413_10430590 3300031824 Bacteria 1042
256 Ga0307416_100054714 3300032002 Bacteria 3209
257 Ga0307416_100225726 3300032002 Bacteria 1801
258 Ga0307416_100377491 3300032002 Bacteria 1446
259 Ga0373934_0002203 3300035086 Bacteria 7156
260 Ga0373934_0004423 3300035086 Bacteria 5191
261 Ga0373934_0031416 3300035086 Bacteria 2079
262 Ga0373923_0016037 3300035111 Bacteria 2838
263 Ga0373923_0091224 3300035111 Bacteria 1333
264 Ga0373932_0026240 3300035112 Bacteria 1584
265 Ga0373936_0014973 3300035113 Bacteria 2969
266 Ga0373953_0130413 3300035117 Bacteria 1072
267 Ga0373954_0000081 3300035118 Bacteria 33886
268 Ga0373954_0000113 3300035118 Bacteria 27416
269 Ga0373954_0001250 3300035118 Bacteria 10244
270 Ga0373954_0044804 3300035118 Bacteria 2065
271 Ga0373956_0000034 3300035119 Bacteria 43936
272 Ga0373956_0020386 3300035119 Bacteria 2820
273 Ga0373957_0003156 3300035120 Bacteria 4823
274 Ga0373957_0005727 3300035120 Bacteria 3871
275 Ga0373946_0021022 3300035171 Bacteria 2527
276 Ga0373955_0015523 3300035172 Bacteria 3731
277 Ga0373955_0126294 3300035172 Bacteria 1490
278 Ga0373924_0044632 3300035410 Bacteria 1821
279 Ga0373931_0146444 3300035691 Bacteria 1373
280 Ga0373927_0118713 3300035695 Bacteria 1726
281 Ga0373933_0000443 3300035724 Bacteria 25931
282 Ga0373933_0028331 3300035724 Bacteria 3231
283 Ga0373947_0074658 3300035725 Bacteria 2087
284 Ga0373937_0000372 3300036401 Bacteria 41751
285 Ga0373937_0001711 3300036401 Bacteria 18445
286 Ga0373937_0021999 3300036401 Bacteria 5726
287 Ga0373937_0158147 3300036401 Bacteria 2124
288 Ga0373937_0251107 3300036401 Bacteria 1667
289 Ga0373937_0282503 3300036401 Bacteria 1567
290 Ga0373925_0018939 3300037068 Bacteria 5003
291 Ga0373925_0238953 3300037068 Bacteria 1454
292 Ga0395905_0019218 3300037471 Bacteria 6479
293 Ga0436364_1508581 3300037853 Bacteria 6529
294 Ga0439439_0029557 3300041406 Bacteria 1391
295 Ga0439441_003397 3300042001 Bacteria 2346
296 Ga0439435_0000598 3300042436 Bacteria 5854
297 Ga0439435_0000692 3300042436 Bacteria 5606
298 Ga0439444_0001842 3300042437 Bacteria 2812
299 Ga0439444_0002291 3300042437 Bacteria 2595
300 Ga0439460_0000117 3300042461 Bacteria 13698
301 Ga0451577_0101105 3300042876 Bacteria 2576
302 Ga0451577_0137252 3300042876 Bacteria 2196
303 Ga0451577_0479666 3300042876 Bacteria 1129
304 Ga0466964_0007550 3300044706 Bacteria 4069
305 Ga0453684_0184561 3300044712 Bacteria 2446
306 Ga0453684_0417363 3300044712 Bacteria 1500
307 Ga0466957_0041340 3300044842 Bacteria 2788
308 Ga0466959_0029045 3300045049 Bacteria 4096
309 Ga0451576_0107595 3300045051 Bacteria 2901
310 Ga0451576_0385850 3300045051 Bacteria 1468
311 Ga0466967_0011505 3300045976 Bacteria 6708
312 Ga0495592_0001366 3300046454 Bacteria 16866
313 Ga0495592_0001493 3300046454 Bacteria 16284
314 Ga0495592_0004439 3300046454 Bacteria 10268
315 Ga0495592_0008347 3300046454 Bacteria 7767
316 Ga0495592_0076133 3300046454 Bacteria 2435
317 Ga0495629_0056064 3300046459 Bacteria 2756
318 Ga0495641_0005331 3300046461 Bacteria 8724
319 Ga0495641_0102883 3300046461 Bacteria 1274
320 Ga0495651_0000056 3300046462 Bacteria 83191
321 Ga0495651_0075197 3300046462 Bacteria 2561
322 Ga0495651_0235197 3300046462 Bacteria 1260
323 Ga0495653_0002911 3300046463 Bacteria 13684
324 Ga0495653_0076630 3300046463 Bacteria 2485
325 Ga0495580_0005602 3300046472 Bacteria 10347
326 Ga0495639_0001202 3300046475 Bacteria 11671
327 Ga0495662_0006369 3300046476 Bacteria 5899
328 Ga0495664_0003368 3300046477 Bacteria 8688
329 Ga0495608_0002230 3300046511 Bacteria 13989
330 Ga0495608_0047953 3300046511 Bacteria 2838
331 Ga0495618_0041357 3300046514 Bacteria 2902
332 Ga0495628_0000532 3300046516 Bacteria 34861
333 Ga0495628_0002277 3300046516 Bacteria 17372
334 Ga0495628_0017670 3300046516 Bacteria 5929
335 Ga0495628_0021328 3300046516 Bacteria 5331
336 Ga0495628_0069425 3300046516 Bacteria 2748
337 Ga0495630_0004976 3300046517 Bacteria 9348
338 Ga0495666_0002281 3300046526 Bacteria 9548
339 Ga0495666_0013811 3300046526 Bacteria 4026
340 Ga0495652_0002507 3300046529 Bacteria 18834
341 Ga0495652_0073319 3300046529 Bacteria 2851
342 Ga0495652_0100231 3300046529 Bacteria 2350
343 Ga0495652_0102392 3300046529 Bacteria 2320
344 Ga0495665_0048980 3300046531 Bacteria 2240
345 Ga0495640_0032482 3300046533 Bacteria 3717
346 Ga0495586_0006091 3300046535 Bacteria 6448
347 Ga0495586_0051019 3300046535 Bacteria 2238
348 Ga0495586_0169257 3300046535 Unclassified 1234
349 Ga0495587_0003519 3300046536 Bacteria 10428
350 Ga0495587_0068210 3300046536 Bacteria 2072
351 Ga0495587_0077374 3300046536 Bacteria 1931
352 Ga0495598_0021124 3300046537 Bacteria 1728
353 Ga0495621_0070320 3300046539 Bacteria 1288
354 Ga0495645_0000502 3300046543 Bacteria 27029
355 Ga0495645_0107749 3300046543 Bacteria 1974
356 Ga0495667_0028552 3300046559 Bacteria 3757
357 Ga0495667_0045555 3300046559 Bacteria 2903
358 Ga0495634_0072129 3300046642 Bacteria 2271
359 Ga0495635_0004806 3300046663 Bacteria 9395
360 Ga0495635_0017682 3300046663 Bacteria 4979
361 Ga0495657_0016008 3300046675 Bacteria 5472
362 Ga0495657_0026776 3300046675 Bacteria 4080
363 Ga0495599_0001123 3300046678 Bacteria 15093
364 Ga0495599_0022963 3300046678 Bacteria 3896
365 Ga0495599_0026836 3300046678 Bacteria 3610
366 Ga0495599_0062282 3300046678 Bacteria 2330
367 Ga0495623_0105668 3300046679 Bacteria 1711
368 Ga0495647_0000693 3300046681 Bacteria 10014
369 Ga0495658_0003469 3300046683 Bacteria 7793
370 Ga0495658_0198118 3300046683 Bacteria 1251
371 Ga0495669_0009889 3300046684 Bacteria 4031
372 Ga0495613_0012092 3300046689 Bacteria 6416
373 Ga0495613_0020534 3300046689 Bacteria 4924
374 Ga0495600_0009363 3300046809 Bacteria 6051
375 Ga0495600_0009561 3300046809 Bacteria 5993
376 Ga0495604_0007827 3300047317 Bacteria 8458
377 Ga0495604_0042437 3300047317 Bacteria 3564
378 Ga0495636_0017406 3300047318 Bacteria 2877
379 Ga0495674_0004795 3300047319 Bacteria 13012
380 Ga0495680_0012907 3300047322 Bacteria 7320
381 Ga0495680_0094373 3300047322 Bacteria 2238
382 Ga0495680_0102000 3300047322 Bacteria 2137
383 Ga0495680_0169904 3300047322 Bacteria 1579
384 Ga0495675_0002113 3300047444 Bacteria 11847
385 Ga0495684_0043615 3300047471 Bacteria 3434
386 Ga0495684_0085778 3300047471 Bacteria 2387
387 Ga0495593_0107806 3300047673 Bacteria 1424
388 Ga0496104_0081492 3300048907 Bacteria 3086
389 Ga0496106_0139269 3300048909 Bacteria 1908
390 Ga0496110_0038826 3300048913 Bacteria 4144
391 Ga0501031_0020879 3300049568 Bacteria 4270
392 Ga0501033_0006757 3300049570 Bacteria 8960
393 Ga0501036_0000162 3300049572 Bacteria 43591
394 Ga0501037_0043345 3300049573 Bacteria 3307
395 Ga0501038_0001044 3300049574 Bacteria 25020
396 Ga0501038_0126417 3300049574 Bacteria 2104
397 Ga0501039_0002679 3300049575 Bacteria 13284
398 Ga0501039_0033444 3300049575 Bacteria 3964
399 Ga0501039_0059602 3300049575 Bacteria 2956
400 Ga0501039_0076946 3300049575 Bacteria 2595
401 Ga0501040_0000167 3300049576 Bacteria 37032
402 Ga0501040_0047366 3300049576 Bacteria 2936
403 Ga0501040_0077338 3300049576 Bacteria 2302
404 Ga0501042_0000122 3300049578 Bacteria 33231
405 Ga0501042_0058277 3300049578 Bacteria 2756
406 Ga0501042_0058523 3300049578 Bacteria 2751
407 Ga0501046_0001014 3300049580 Bacteria 27382
408 Ga0501046_0105012 3300049580 Bacteria 2164
409 Ga0501047_0002291 3300049581 Bacteria 18316
410 Ga0501048_0000147 3300049582 Bacteria 43084
411 Ga0501067_0109076 3300049583 Bacteria 1539
412 Ga0501068_0018296 3300049584 Bacteria 4059
413 Ga0501069_0000781 3300049585 Bacteria 14959
414 Ga0501070_0003184 3300049586 Bacteria 14271
415 Ga0501071_0025357 3300049587 Bacteria 4152
416 Ga0501071_0083413 3300049587 Bacteria 2341
417 Ga0501072_0182813 3300049588 Bacteria 1672
418 Ga0501072_0204177 3300049588 Bacteria 1576
419 Ga0501072_0252786 3300049588 Bacteria 1403
420 Ga0501073_0000370 3300049589 Bacteria 30322
421 Ga0501074_0002082 3300049590 Bacteria 13828
422 Ga0501075_0001960 3300049591 Bacteria 13574
423 Ga0501075_0014080 3300049591 Bacteria 5728
424 Ga0501075_0015847 3300049591 Bacteria 5421
425 Ga0501075_0298511 3300049591 Bacteria 1227
426 Ga0501076_0000726 3300049592 Bacteria 21331
427 Ga0501076_0026775 3300049592 Bacteria 4469
428 Ga0501076_0034331 3300049592 Bacteria 3964
429 Ga0501077_0000231 3300049593 Bacteria 32894
430 Ga0501077_0193430 3300049593 Bacteria 1292
431 Ga0501079_0000211 3300049741 Bacteria 34187
432 Ga0501079_0060506 3300049741 Bacteria 2921
433 Ga0501079_0415049 3300049741 Bacteria 1056
434 Ga0501080_0001759 3300049742 Bacteria 18574
435 Ga0501080_0027900 3300049742 Bacteria 5250
436 Ga0501080_0060796 3300049742 Bacteria 3517
437 Ga0501081_0001106 3300049743 Bacteria 16196
438 Ga0501081_0206564 3300049743 Bacteria 1425
439 Ga0501083_0013773 3300049744 Bacteria 5653
440 Ga0501044_0190739 3300049823 Bacteria 2012
441 Ga0501045_0000489 3300049824 Bacteria 24526
442 Ga0501045_0005120 3300049824 Bacteria 9070
443 Ga0501045_0011791 3300049824 Bacteria 6140
444 Ga0501045_0261708 3300049824 Bacteria 1287
445 nmdc:mga0k408_11885_c2 3300050493 Bacteria 4190
446 nmdc:mga0k408_175992_c1 3300050493 Bacteria 1276
447 nmdc:mga0k408_31189_c1 3300050493 Bacteria 3042
448 nmdc:mga0k408_32688_c1 3300050493 Bacteria 2972
449 nmdc:mga07m45_25068_c1 3300050496 Bacteria 3269
450 nmdc:mga05p37_156714_c1 3300050507 Bacteria 2782
451 nmdc:mga05p37_24332_c1 3300050507 Bacteria 7359
452 nmdc:mga05p37_471977_c1 3300050507 Bacteria 1447
453 nmdc:mga05p37_95402_c1 3300050507 Bacteria 3664
454 nmdc:mga09592_56874_c1 3300050508 Bacteria 3306
455 nmdc:mga0qj67_177928_c1 3300050509 Bacteria 1728
456 nmdc:mga0qj67_23223_c1 3300050509 Bacteria 4769
457 nmdc:mga0qj67_293964_c1 3300050509 Bacteria 1316
458 nmdc:mga06r32_37915_c1 3300050510 Bacteria 4561
459 nmdc:mga06r32_59976_c1 3300050510 Bacteria 3660
460 nmdc:mga08y16_212251_c1 3300050511 Bacteria 2005
461 nmdc:mga08y16_226469_c1 3300050511 Bacteria 1935
462 nmdc:mga08y16_233514_c1 3300050511 Bacteria 1902
463 nmdc:mga08y16_280408_c1 3300050511 Bacteria 1719
464 nmdc:mga0n895_133579_c1 3300050512 Bacteria 2507
465 nmdc:mga0n895_143956_c1 3300050512 Bacteria 2413
466 nmdc:mga0n895_154384_c1 3300050512 Bacteria 2326
467 nmdc:mga0rr50_26715_c1 3300050513 Bacteria 4033
468 nmdc:mga08x19_12791_c1 3300050514 Bacteria 5062
469 nmdc:mga08x19_1505_c1 3300050514 Bacteria 14437
470 nmdc:mga08x19_233500_c1 3300050514 Bacteria 1266
471 nmdc:mga08x19_334263_c1 3300050514 Bacteria 1056
472 nmdc:mga08x19_39821_c1 3300050514 Bacteria 2989
473 nmdc:mga08x19_58159_c1 3300050514 Bacteria 2500
474 nmdc:mga0a205_149754_c1 3300050515 Bacteria 2234
475 nmdc:mga0a205_75607_c1 3300050515 Bacteria 3254
476 Ga0495601_0000144 3300053077 Bacteria 40543
477 Ga0495601_0007306 3300053077 Bacteria 6476
478 Ga0495601_0257074 3300053077 Bacteria 1140
479 Ga0495595_0001310 3300053084 Bacteria 9672
480 Ga0495619_0071640 3300053085 Bacteria 2319
481 Ga0501084_0000262 3300054114 Bacteria 39735
482 Ga0501084_0143451 3300054114 Bacteria 2011
483 Ga0590077_027238 3300059426 Bacteria 1238
484 Ga0501082_0002140 3300060353 Bacteria 17327
485 Ga0501082_0319382 3300060353 Bacteria 1353
486 Ga0501082_0462710 3300060353 Bacteria 1108
487 Ga0530510_0000114 3300061734 Bacteria 45503
488 Ga0530510_0000861 3300061734 Bacteria 19992
489 Ga0530510_0001981 3300061734 Bacteria 14033

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_10430590 Ga0307413_104305902 254
2 3300005981 Ga0081538_10145017 Ga0081538_101450172 262
3 3300005438 Ga0070701_10018276 Ga0070701_100182763 281
4 3300049575 Ga0501039_0033444 Ga0501039_0033444_929_1858 292
5 3300049576 Ga0501040_0047366 Ga0501040_0047366_255_1184 292
6 3300049578 Ga0501042_0058523 Ga0501042_0058523_393_1322 292
7 3300049591 Ga0501075_0014080 Ga0501075_0014080_1070_1999 292
8 3300049592 Ga0501076_0034331 Ga0501076_0034331_960_1889 292
9 3300049593 Ga0501077_0193430 Ga0501077_0193430_110_1039 292
10 3300049743 Ga0501081_0206564 Ga0501081_0206564_93_1022 292
11 3300049824 Ga0501045_0005120 Ga0501045_0005120_3735_4664 292
12 3300060353 Ga0501082_0462710 Ga0501082_0462710_27_956 292
13 3300061734 Ga0530510_0000861 Ga0530510_0000861_7883_8812 292
14 3300014326 Ga0157380_10193542 Ga0157380_101935422 294
15 3300049580 Ga0501046_0105012 Ga0501046_0105012_55_942 295
16 3300049588 Ga0501072_0252786 Ga0501072_0252786_499_1389 296
17 3300005545 Ga0070695_100150972 Ga0070695_1001509722 297
18 3300005549 Ga0070704_100096288 Ga0070704_1000962882 297
19 3300032002 Ga0307416_100054714 Ga0307416_1000547142 300
20 3300027252 Ga0209973_1003160 Ga0209973_10031601 303
21 3300027360 Ga0209969_1002452 Ga0209969_10024522 303
22 3300027364 Ga0209967_1003832 Ga0209967_10038322 303
23 3300027462 Ga0210000_1001350 Ga0210000_10013502 303
24 3300027526 Ga0209968_1007588 Ga0209968_10075882 303
25 3300027876 Ga0209974_10001168 Ga0209974_100011686 303
26 3300006038 Ga0075365_10057135 Ga0075365_100571352 304
27 3300006195 Ga0075366_10031205 Ga0075366_100312052 304
28 3300050493 nmdc:mga0k408_31189_c1 nmdc:mga0k408_31189_c1_1773_2687 304
29 3300050496 nmdc:mga07m45_25068_c1 nmdc:mga07m45_25068_c1_1960_2874 304
30 3300006914 Ga0075436_100080160 Ga0075436_1000801602 305
31 3300013104 Ga0157370_10118679 Ga0157370_101186792 306
32 3300042876 Ga0451577_0101105 Ga0451577_0101105_42_962 306
33 3300005330 Ga0070690_100312575 Ga0070690_1003125751 309
34 3300005444 Ga0070694_100005005 Ga0070694_1000050056 309
35 3300005545 Ga0070695_100036287 Ga0070695_1000362872 309
36 3300005549 Ga0070704_100015120 Ga0070704_1000151202 309
37 3300005617 Ga0068859_100032805 Ga0068859_1000328052 309
38 3300006846 Ga0075430_100001652 Ga0075430_1000016526 309
39 3300006846 Ga0075430_100306460 Ga0075430_1003064601 309
40 3300006871 Ga0075434_100125356 Ga0075434_1001253562 309
41 3300006931 Ga0097620_100032804 Ga0097620_1000328042 309
42 3300007076 Ga0075435_100311734 Ga0075435_1003117342 309
43 3300009174 Ga0105241_10134027 Ga0105241_101340273 309
44 3300014326 Ga0157380_10133235 Ga0157380_101332352 309
45 3300025936 Ga0207670_10092478 Ga0207670_100924782 309
46 3300025981 Ga0207640_10147634 Ga0207640_101476342 309
47 3300025981 Ga0207640_10245309 Ga0207640_102453092 309
48 3300026118 Ga0207675_100075753 Ga0207675_1000757532 309
49 3300027543 Ga0209999_1006841 Ga0209999_10068412 309
50 3300027682 Ga0209971_1026979 Ga0209971_10269792 309
51 3300037068 Ga0373925_0238953 Ga0373925_0238953_280_1209 309
52 3300042001 Ga0439441_003397 Ga0439441_003397_610_1539 309
53 3300042436 Ga0439435_0000598 Ga0439435_0000598_4753_5682 309
54 3300042436 Ga0439435_0000692 Ga0439435_0000692_544_1473 309
55 3300042437 Ga0439444_0001842 Ga0439444_0001842_173_1102 309
56 3300042437 Ga0439444_0002291 Ga0439444_0002291_949_1878 309
57 3300042461 Ga0439460_0000117 Ga0439460_0000117_7565_8494 309
58 3300049574 Ga0501038_0126417 Ga0501038_0126417_1020_1949 309
59 3300049587 Ga0501071_0083413 Ga0501071_0083413_898_1827 309
60 3300049588 Ga0501072_0204177 Ga0501072_0204177_408_1337 309
61 3300050507 nmdc:mga05p37_95402_c1 nmdc:mga05p37_95402_c1_2257_3186 309
62 3300050508 nmdc:mga09592_56874_c1 nmdc:mga09592_56874_c1_82_1011 309
63 3300050509 nmdc:mga0qj67_177928_c1 nmdc:mga0qj67_177928_c1_71_1000 309
64 3300050509 nmdc:mga0qj67_23223_c1 nmdc:mga0qj67_23223_c1_595_1524 309
65 3300050510 nmdc:mga06r32_37915_c1 nmdc:mga06r32_37915_c1_1424_2353 309
66 3300050511 nmdc:mga08y16_233514_c1 nmdc:mga08y16_233514_c1_356_1285 309
67 3300050512 nmdc:mga0n895_154384_c1 nmdc:mga0n895_154384_c1_585_1514 309
68 3300050514 nmdc:mga08x19_39821_c1 nmdc:mga08x19_39821_c1_751_1680 309
69 3300005327 Ga0070658_10153032 Ga0070658_101530322 310
70 3300005329 Ga0070683_100020488 Ga0070683_1000204883 310
71 3300005330 Ga0070690_100029378 Ga0070690_1000293782 310
72 3300005336 Ga0070680_100099233 Ga0070680_1000992332 310
73 3300005336 Ga0070680_100223417 Ga0070680_1002234172 310
74 3300005336 Ga0070680_100251383 Ga0070680_1002513832 310
75 3300005339 Ga0070660_100295215 Ga0070660_1002952151 310
76 3300005345 Ga0070692_10026730 Ga0070692_100267302 310
77 3300005345 Ga0070692_10201495 Ga0070692_102014951 310
78 3300005353 Ga0070669_100025252 Ga0070669_1000252522 310
79 3300005354 Ga0070675_100016734 Ga0070675_1000167342 310
80 3300005356 Ga0070674_100269178 Ga0070674_1002691782 310
81 3300005364 Ga0070673_100162234 Ga0070673_1001622342 310
82 3300005365 Ga0070688_100066466 Ga0070688_1000664661 310
83 3300005434 Ga0070709_10108949 Ga0070709_101089493 310
84 3300005435 Ga0070714_100025279 Ga0070714_1000252795 310
85 3300005435 Ga0070714_100033210 Ga0070714_1000332102 310
86 3300005436 Ga0070713_100015249 Ga0070713_1000152495 310
87 3300005436 Ga0070713_100327083 Ga0070713_1003270831 310
88 3300005438 Ga0070701_10079697 Ga0070701_100796972 310
89 3300005440 Ga0070705_100006927 Ga0070705_1000069271 310
90 3300005440 Ga0070705_100054568 Ga0070705_1000545682 310
91 3300005440 Ga0070705_100144552 Ga0070705_1001445522 310
92 3300005441 Ga0070700_100003885 Ga0070700_1000038853 310
93 3300005441 Ga0070700_100125079 Ga0070700_1001250792 310
94 3300005456 Ga0070678_100101265 Ga0070678_1001012652 310
95 3300005458 Ga0070681_10046409 Ga0070681_100464092 310
96 3300005458 Ga0070681_10091902 Ga0070681_100919022 310
97 3300005459 Ga0068867_100000969 Ga0068867_1000009699 310
98 3300005459 Ga0068867_100105117 Ga0068867_1001051172 310
99 3300005459 Ga0068867_100223438 Ga0068867_1002234382 310
100 3300005459 Ga0068867_100285136 Ga0068867_1002851362 310
101 3300005466 Ga0070685_10228359 Ga0070685_102283592 310
102 3300005468 Ga0070707_100237624 Ga0070707_1002376242 310
103 3300005468 Ga0070707_100383562 Ga0070707_1003835622 310
104 3300005471 Ga0070698_100015222 Ga0070698_1000152222 310
105 3300005518 Ga0070699_100018149 Ga0070699_1000181493 310
106 3300005518 Ga0070699_100148499 Ga0070699_1001484992 310
107 3300005518 Ga0070699_100276507 Ga0070699_1002765071 310
108 3300005518 Ga0070699_100389745 Ga0070699_1003897451 310
109 3300005530 Ga0070679_100250655 Ga0070679_1002506552 310
110 3300005535 Ga0070684_100267345 Ga0070684_1002673452 310
111 3300005536 Ga0070697_100023023 Ga0070697_1000230234 310
112 3300005536 Ga0070697_100079306 Ga0070697_1000793063 310
113 3300005539 Ga0068853_100030408 Ga0068853_1000304081 310
114 3300005539 Ga0068853_100041735 Ga0068853_1000417353 310
115 3300005543 Ga0070672_100218365 Ga0070672_1002183652 310
116 3300005543 Ga0070672_100411356 Ga0070672_1004113562 310
117 3300005544 Ga0070686_100149051 Ga0070686_1001490512 310
118 3300005545 Ga0070695_100008855 Ga0070695_1000088554 310
119 3300005546 Ga0070696_100011382 Ga0070696_1000113824 310
120 3300005546 Ga0070696_100029215 Ga0070696_1000292152 310
121 3300005546 Ga0070696_100070804 Ga0070696_1000708042 310
122 3300005546 Ga0070696_100108982 Ga0070696_1001089822 310
123 3300005547 Ga0070693_100073534 Ga0070693_1000735342 310
124 3300005547 Ga0070693_100144720 Ga0070693_1001447202 310
125 3300005548 Ga0070665_100227622 Ga0070665_1002276222 310
126 3300005549 Ga0070704_100000937 Ga0070704_1000009373 310
127 3300005549 Ga0070704_100055561 Ga0070704_1000555613 310
128 3300005549 Ga0070704_100125103 Ga0070704_1001251031 310
129 3300005549 Ga0070704_100181311 Ga0070704_1001813112 310
130 3300005563 Ga0068855_100001402 Ga0068855_10000140213 310
131 3300005563 Ga0068855_100003441 Ga0068855_10000344113 310
132 3300005563 Ga0068855_100005041 Ga0068855_10000504111 310
133 3300005563 Ga0068855_100031005 Ga0068855_1000310054 310
134 3300005563 Ga0068855_100119119 Ga0068855_1001191192 310
135 3300005615 Ga0070702_100036523 Ga0070702_1000365232 310
136 3300005615 Ga0070702_100056157 Ga0070702_1000561572 310
137 3300005616 Ga0068852_100000325 Ga0068852_10000032512 310
138 3300005616 Ga0068852_100007025 Ga0068852_1000070252 310
139 3300005616 Ga0068852_100349273 Ga0068852_1003492732 310
140 3300005719 Ga0068861_100079054 Ga0068861_1000790542 310
141 3300005834 Ga0068851_10133454 Ga0068851_101334542 310
142 3300005840 Ga0068870_10046200 Ga0068870_100462003 310
143 3300005842 Ga0068858_100004218 Ga0068858_10000421811 310
144 3300005844 Ga0068862_100054720 Ga0068862_1000547202 310
145 3300005844 Ga0068862_100112963 Ga0068862_1001129633 310
146 3300005844 Ga0068862_100353617 Ga0068862_1003536172 310
147 3300005844 Ga0068862_100405943 Ga0068862_1004059432 310
148 3300005985 Ga0081539_10004048 Ga0081539_1000404812 310
149 3300006173 Ga0070716_100045431 Ga0070716_1000454312 310
150 3300006173 Ga0070716_100196142 Ga0070716_1001961422 310
151 3300006195 Ga0075366_10003064 Ga0075366_100030643 310
152 3300006195 Ga0075366_10034641 Ga0075366_100346413 310
153 3300006237 Ga0097621_100018706 Ga0097621_1000187065 310
154 3300006358 Ga0068871_100068046 Ga0068871_1000680463 310
155 3300006844 Ga0075428_100020521 Ga0075428_1000205213 310
156 3300006844 Ga0075428_100032465 Ga0075428_1000324655 310
157 3300006846 Ga0075430_100112816 Ga0075430_1001128163 310
158 3300006846 Ga0075430_100158445 Ga0075430_1001584452 310
159 3300006847 Ga0075431_100068534 Ga0075431_1000685343 310
160 3300006852 Ga0075433_10029333 Ga0075433_100293333 310
161 3300006852 Ga0075433_10120361 Ga0075433_101203612 310
162 3300006871 Ga0075434_100198211 Ga0075434_1001982112 310
163 3300006880 Ga0075429_100005401 Ga0075429_1000054015 310
164 3300006880 Ga0075429_100081231 Ga0075429_1000812312 310
165 3300006880 Ga0075429_100369896 Ga0075429_1003698962 310
166 3300006914 Ga0075436_100001881 Ga0075436_1000018812 310
167 3300006914 Ga0075436_100021605 Ga0075436_1000216052 310
168 3300006914 Ga0075436_100028396 Ga0075436_1000283962 310
169 3300006914 Ga0075436_100032997 Ga0075436_1000329973 310
170 3300006914 Ga0075436_100053920 Ga0075436_1000539202 310
171 3300007076 Ga0075435_100265589 Ga0075435_1002655892 310
172 3300007265 Ga0099794_10007879 Ga0099794_100078793 310
173 3300007265 Ga0099794_10048769 Ga0099794_100487692 310
174 3300009093 Ga0105240_10002337 Ga0105240_100023376 310
175 3300009093 Ga0105240_10022883 Ga0105240_100228837 310
176 3300009093 Ga0105240_10066505 Ga0105240_100665053 310
177 3300009093 Ga0105240_10224909 Ga0105240_102249092 310
178 3300009093 Ga0105240_10361787 Ga0105240_103617872 310
179 3300009094 Ga0111539_10011002 Ga0111539_100110024 310
180 3300009094 Ga0111539_10069699 Ga0111539_100696992 310
181 3300009094 Ga0111539_10402702 Ga0111539_104027021 310
182 3300009098 Ga0105245_10250229 Ga0105245_102502292 310
183 3300009147 Ga0114129_10000341 Ga0114129_1000034110 310
184 3300009147 Ga0114129_10157888 Ga0114129_101578883 310
185 3300009147 Ga0114129_10480510 Ga0114129_104805101 310
186 3300009174 Ga0105241_10031477 Ga0105241_100314772 310
187 3300009176 Ga0105242_10001654 Ga0105242_100016547 310
188 3300009176 Ga0105242_10003371 Ga0105242_100033718 310
189 3300009177 Ga0105248_10066687 Ga0105248_100666872 310
190 3300009177 Ga0105248_10210403 Ga0105248_102104032 310
191 3300009551 Ga0105238_10016897 Ga0105238_100168977 310
192 3300009551 Ga0105238_10073986 Ga0105238_100739862 310
193 3300009551 Ga0105238_10155804 Ga0105238_101558042 310
194 3300009553 Ga0105249_10003727 Ga0105249_100037276 310
195 3300013104 Ga0157370_10027936 Ga0157370_100279363 310
196 3300013104 Ga0157370_10294723 Ga0157370_102947231 310
197 3300013105 Ga0157369_10000349 Ga0157369_1000034949 310
198 3300013105 Ga0157369_10192265 Ga0157369_101922652 310
199 3300013296 Ga0157374_10017410 Ga0157374_100174104 310
200 3300013297 Ga0157378_10066939 Ga0157378_100669395 310
201 3300013307 Ga0157372_10010818 Ga0157372_100108183 310
202 3300013307 Ga0157372_10089534 Ga0157372_100895342 310
203 3300013307 Ga0157372_10448778 Ga0157372_104487782 310
204 3300013308 Ga0157375_10137384 Ga0157375_101373842 310
205 3300013308 Ga0157375_10450472 Ga0157375_104504721 310
206 3300014326 Ga0157380_10036704 Ga0157380_100367043 310
207 3300014968 Ga0157379_10115417 Ga0157379_101154172 310
208 3300014969 Ga0157376_10074911 Ga0157376_100749113 310
209 3300014969 Ga0157376_10391953 Ga0157376_103919531 310
210 3300017792 Ga0163161_10041890 Ga0163161_100418904 310
211 3300021388 Ga0213875_10047365 Ga0213875_100473652 310
212 3300025321 Ga0207656_10000723 Ga0207656_100007236 310
213 3300025906 Ga0207699_10055292 Ga0207699_100552922 310
214 3300025908 Ga0207643_10011949 Ga0207643_100119493 310
215 3300025908 Ga0207643_10077688 Ga0207643_100776883 310
216 3300025909 Ga0207705_10005226 Ga0207705_100052263 310
217 3300025911 Ga0207654_10122369 Ga0207654_101223691 310
218 3300025912 Ga0207707_10301469 Ga0207707_103014692 310
219 3300025913 Ga0207695_10002750 Ga0207695_1000275022 310
220 3300025913 Ga0207695_10045188 Ga0207695_100451883 310
221 3300025913 Ga0207695_10102895 Ga0207695_101028952 310
222 3300025913 Ga0207695_10180357 Ga0207695_101803572 310
223 3300025915 Ga0207693_10168263 Ga0207693_101682632 310
224 3300025917 Ga0207660_10077353 Ga0207660_100773532 310
225 3300025917 Ga0207660_10340976 Ga0207660_103409761 310
226 3300025918 Ga0207662_10163932 Ga0207662_101639321 310
227 3300025920 Ga0207649_10025618 Ga0207649_100256183 310
228 3300025921 Ga0207652_10035705 Ga0207652_100357053 310
229 3300025921 Ga0207652_10112194 Ga0207652_101121942 310
230 3300025921 Ga0207652_10201126 Ga0207652_102011262 310
231 3300025923 Ga0207681_10002870 Ga0207681_100028705 310
232 3300025924 Ga0207694_10048997 Ga0207694_100489974 310
233 3300025924 Ga0207694_10108400 Ga0207694_101084002 310
234 3300025924 Ga0207694_10119353 Ga0207694_101193532 310
235 3300025924 Ga0207694_10119956 Ga0207694_101199561 310
236 3300025924 Ga0207694_10317909 Ga0207694_103179091 310
237 3300025926 Ga0207659_10093829 Ga0207659_100938291 310
238 3300025926 Ga0207659_10108761 Ga0207659_101087611 310
239 3300025927 Ga0207687_10010843 Ga0207687_100108435 310
240 3300025928 Ga0207700_10095716 Ga0207700_100957161 310
241 3300025929 Ga0207664_10328616 Ga0207664_103286162 310
242 3300025933 Ga0207706_10430891 Ga0207706_104308911 310
243 3300025934 Ga0207686_10087331 Ga0207686_100873312 310
244 3300025934 Ga0207686_10204207 Ga0207686_102042071 310
245 3300025935 Ga0207709_10076613 Ga0207709_100766132 310
246 3300025935 Ga0207709_10116390 Ga0207709_101163902 310
247 3300025936 Ga0207670_10002785 Ga0207670_100027858 310
248 3300025937 Ga0207669_10184175 Ga0207669_101841752 310
249 3300025939 Ga0207665_10040865 Ga0207665_100408652 310
250 3300025940 Ga0207691_10227518 Ga0207691_102275182 310
251 3300025940 Ga0207691_10277778 Ga0207691_102777782 310
252 3300025941 Ga0207711_10059101 Ga0207711_100591013 310
253 3300025941 Ga0207711_10260641 Ga0207711_102606412 310
254 3300025944 Ga0207661_10048853 Ga0207661_100488533 310
255 3300025949 Ga0207667_10061644 Ga0207667_100616442 310
256 3300025949 Ga0207667_10280361 Ga0207667_102803612 310
257 3300025949 Ga0207667_10379826 Ga0207667_103798262 310
258 3300025960 Ga0207651_10064426 Ga0207651_100644263 310
259 3300025961 Ga0207712_10001994 Ga0207712_100019946 310
260 3300025961 Ga0207712_10217722 Ga0207712_102177222 310
261 3300026035 Ga0207703_10063531 Ga0207703_100635312 310
262 3300026041 Ga0207639_10375123 Ga0207639_103751231 310
263 3300026075 Ga0207708_10009609 Ga0207708_100096092 310
264 3300026075 Ga0207708_10093734 Ga0207708_100937344 310
265 3300026089 Ga0207648_10005654 Ga0207648_100056548 310
266 3300026089 Ga0207648_10263861 Ga0207648_102638612 310
267 3300026116 Ga0207674_10034782 Ga0207674_100347824 310
268 3300026118 Ga0207675_100136268 Ga0207675_1001362683 310
269 3300026118 Ga0207675_100159914 Ga0207675_1001599142 310
270 3300026118 Ga0207675_100314654 Ga0207675_1003146542 310
271 3300026121 Ga0207683_10054788 Ga0207683_100547882 310
272 3300026121 Ga0207683_10284789 Ga0207683_102847892 310
273 3300026142 Ga0207698_10019377 Ga0207698_100193773 310
274 3300026142 Ga0207698_10076997 Ga0207698_100769973 310
275 3300026142 Ga0207698_10164326 Ga0207698_101643262 310
276 3300026142 Ga0207698_10444773 Ga0207698_104447731 310
277 3300027907 Ga0207428_10006430 Ga0207428_100064307 310
278 3300027907 Ga0207428_10128013 Ga0207428_101280132 310
279 3300028379 Ga0268266_10109233 Ga0268266_101092332 310
280 3300028380 Ga0268265_10003278 Ga0268265_100032782 310
281 3300028380 Ga0268265_10291351 Ga0268265_102913512 310
282 3300028380 Ga0268265_10433529 Ga0268265_104335292 310
283 3300031090 Ga0265760_10028384 Ga0265760_100283842 310
284 3300031239 Ga0265328_10001540 Ga0265328_100015405 310
285 3300031242 Ga0265329_10044228 Ga0265329_100442281 310
286 3300031250 Ga0265331_10002377 Ga0265331_100023778 310
287 3300031548 Ga0307408_100034424 Ga0307408_1000344243 310
288 3300031711 Ga0265314_10000845 Ga0265314_1000084518 310
289 3300031731 Ga0307405_10219504 Ga0307405_102195041 310
290 3300032002 Ga0307416_100225726 Ga0307416_1002257263 310
291 3300032002 Ga0307416_100377491 Ga0307416_1003774912 310
292 3300035086 Ga0373934_0002203 Ga0373934_0002203_4729_5661 310
293 3300035086 Ga0373934_0004423 Ga0373934_0004423_1147_2085 310
294 3300035086 Ga0373934_0031416 Ga0373934_0031416_1012_1944 310
295 3300035111 Ga0373923_0016037 Ga0373923_0016037_1115_2047 310
296 3300035111 Ga0373923_0091224 Ga0373923_0091224_137_1069 310
297 3300035112 Ga0373932_0026240 Ga0373932_0026240_469_1401 310
298 3300035113 Ga0373936_0014973 Ga0373936_0014973_788_1720 310
299 3300035117 Ga0373953_0130413 Ga0373953_0130413_14_946 310
300 3300035118 Ga0373954_0000081 Ga0373954_0000081_12859_13791 310
301 3300035118 Ga0373954_0000113 Ga0373954_0000113_3311_4243 310
302 3300035118 Ga0373954_0001250 Ga0373954_0001250_6673_7605 310
303 3300035118 Ga0373954_0044804 Ga0373954_0044804_361_1293 310
304 3300035119 Ga0373956_0000034 Ga0373956_0000034_29117_30055 310
305 3300035119 Ga0373956_0020386 Ga0373956_0020386_1115_2047 310
306 3300035120 Ga0373957_0003156 Ga0373957_0003156_926_1864 310
307 3300035120 Ga0373957_0005727 Ga0373957_0005727_431_1363 310
308 3300035171 Ga0373946_0021022 Ga0373946_0021022_349_1281 310
309 3300035172 Ga0373955_0015523 Ga0373955_0015523_1771_2709 310
310 3300035172 Ga0373955_0126294 Ga0373955_0126294_370_1302 310
311 3300035410 Ga0373924_0044632 Ga0373924_0044632_74_1006 310
312 3300035691 Ga0373931_0146444 Ga0373931_0146444_94_1026 310
313 3300035695 Ga0373927_0118713 Ga0373927_0118713_545_1477 310
314 3300035724 Ga0373933_0000443 Ga0373933_0000443_5971_6909 310
315 3300035724 Ga0373933_0028331 Ga0373933_0028331_1934_2866 310
316 3300035725 Ga0373947_0074658 Ga0373947_0074658_84_1016 310
317 3300036401 Ga0373937_0000372 Ga0373937_0000372_2519_3457 310
318 3300036401 Ga0373937_0001711 Ga0373937_0001711_13887_14819 310
319 3300036401 Ga0373937_0021999 Ga0373937_0021999_3969_4901 310
320 3300036401 Ga0373937_0158147 Ga0373937_0158147_983_1915 310
321 3300036401 Ga0373937_0251107 Ga0373937_0251107_431_1363 310
322 3300036401 Ga0373937_0282503 Ga0373937_0282503_84_1016 310
323 3300037068 Ga0373925_0018939 Ga0373925_0018939_2336_3268 310
324 3300037471 Ga0395905_0019218 Ga0395905_0019218_5521_6453 310
325 3300037853 Ga0436364_1508581 Ga0436364_1508581_5399_6331 310
326 3300041406 Ga0439439_0029557 Ga0439439_0029557_177_1109 310
327 3300042876 Ga0451577_0137252 Ga0451577_0137252_185_1117 310
328 3300042876 Ga0451577_0479666 Ga0451577_0479666_119_1051 310
329 3300044706 Ga0466964_0007550 Ga0466964_0007550_2544_3476 310
330 3300044712 Ga0453684_0184561 Ga0453684_0184561_352_1284 310
331 3300044712 Ga0453684_0417363 Ga0453684_0417363_238_1170 310
332 3300044842 Ga0466957_0041340 Ga0466957_0041340_311_1243 310
333 3300045049 Ga0466959_0029045 Ga0466959_0029045_1231_2163 310
334 3300045051 Ga0451576_0107595 Ga0451576_0107595_925_1857 310
335 3300045051 Ga0451576_0385850 Ga0451576_0385850_119_1051 310
336 3300045976 Ga0466967_0011505 Ga0466967_0011505_5541_6473 310
337 3300046454 Ga0495592_0001366 Ga0495592_0001366_1569_2501 310
338 3300046454 Ga0495592_0001493 Ga0495592_0001493_2785_3717 310
339 3300046454 Ga0495592_0004439 Ga0495592_0004439_3829_4761 310
340 3300046454 Ga0495592_0008347 Ga0495592_0008347_638_1570 310
341 3300046454 Ga0495592_0076133 Ga0495592_0076133_591_1523 310
342 3300046459 Ga0495629_0056064 Ga0495629_0056064_1559_2491 310
343 3300046461 Ga0495641_0005331 Ga0495641_0005331_1519_2451 310
344 3300046461 Ga0495641_0102883 Ga0495641_0102883_109_1041 310
345 3300046462 Ga0495651_0000056 Ga0495651_0000056_26935_27873 310
346 3300046462 Ga0495651_0075197 Ga0495651_0075197_1130_2062 310
347 3300046462 Ga0495651_0235197 Ga0495651_0235197_300_1232 310
348 3300046463 Ga0495653_0002911 Ga0495653_0002911_1494_2426 310
349 3300046463 Ga0495653_0076630 Ga0495653_0076630_816_1748 310
350 3300046472 Ga0495580_0005602 Ga0495580_0005602_4315_5247 310
351 3300046475 Ga0495639_0001202 Ga0495639_0001202_9856_10788 310
352 3300046476 Ga0495662_0006369 Ga0495662_0006369_1361_2293 310
353 3300046477 Ga0495664_0003368 Ga0495664_0003368_1003_1935 310
354 3300046511 Ga0495608_0002230 Ga0495608_0002230_1741_2673 310
355 3300046511 Ga0495608_0047953 Ga0495608_0047953_1534_2466 310
356 3300046514 Ga0495618_0041357 Ga0495618_0041357_475_1407 310
357 3300046516 Ga0495628_0000532 Ga0495628_0000532_11621_12553 310
358 3300046516 Ga0495628_0002277 Ga0495628_0002277_7294_8226 310
359 3300046516 Ga0495628_0017670 Ga0495628_0017670_4814_5746 310
360 3300046516 Ga0495628_0021328 Ga0495628_0021328_1003_1935 310
361 3300046516 Ga0495628_0069425 Ga0495628_0069425_1373_2305 310
362 3300046517 Ga0495630_0004976 Ga0495630_0004976_5500_6432 310
363 3300046526 Ga0495666_0002281 Ga0495666_0002281_6939_7871 310
364 3300046526 Ga0495666_0013811 Ga0495666_0013811_2187_3119 310
365 3300046529 Ga0495652_0002507 Ga0495652_0002507_7333_8265 310
366 3300046529 Ga0495652_0073319 Ga0495652_0073319_877_1809 310
367 3300046529 Ga0495652_0100231 Ga0495652_0100231_900_1832 310
368 3300046529 Ga0495652_0102392 Ga0495652_0102392_742_1674 310
369 3300046531 Ga0495665_0048980 Ga0495665_0048980_758_1690 310
370 3300046533 Ga0495640_0032482 Ga0495640_0032482_2482_3414 310
371 3300046535 Ga0495586_0006091 Ga0495586_0006091_2919_3851 310
372 3300046535 Ga0495586_0051019 Ga0495586_0051019_304_1236 310
373 3300046535 Ga0495586_0169257 Ga0495586_0169257_186_1118 310
374 3300046536 Ga0495587_0003519 Ga0495587_0003519_6282_7214 310
375 3300046536 Ga0495587_0068210 Ga0495587_0068210_857_1789 310
376 3300046536 Ga0495587_0077374 Ga0495587_0077374_426_1358 310
377 3300046537 Ga0495598_0021124 Ga0495598_0021124_319_1251 310
378 3300046539 Ga0495621_0070320 Ga0495621_0070320_107_1039 310
379 3300046543 Ga0495645_0000502 Ga0495645_0000502_7163_8095 310
380 3300046543 Ga0495645_0107749 Ga0495645_0107749_681_1613 310
381 3300046559 Ga0495667_0028552 Ga0495667_0028552_1787_2719 310
382 3300046559 Ga0495667_0045555 Ga0495667_0045555_1003_1935 310
383 3300046642 Ga0495634_0072129 Ga0495634_0072129_203_1135 310
384 3300046663 Ga0495635_0004806 Ga0495635_0004806_968_1900 310
385 3300046663 Ga0495635_0017682 Ga0495635_0017682_2100_3032 310
386 3300046675 Ga0495657_0016008 Ga0495657_0016008_1496_2428 310
387 3300046675 Ga0495657_0026776 Ga0495657_0026776_2586_3518 310
388 3300046678 Ga0495599_0001123 Ga0495599_0001123_13465_14397 310
389 3300046678 Ga0495599_0022963 Ga0495599_0022963_552_1484 310
390 3300046678 Ga0495599_0026836 Ga0495599_0026836_1612_2544 310
391 3300046678 Ga0495599_0062282 Ga0495599_0062282_392_1324 310
392 3300046679 Ga0495623_0105668 Ga0495623_0105668_462_1394 310
393 3300046681 Ga0495647_0000693 Ga0495647_0000693_8301_9233 310
394 3300046683 Ga0495658_0003469 Ga0495658_0003469_5500_6432 310
395 3300046683 Ga0495658_0198118 Ga0495658_0198118_264_1196 310
396 3300046684 Ga0495669_0009889 Ga0495669_0009889_1292_2224 310
397 3300046689 Ga0495613_0012092 Ga0495613_0012092_2469_3401 310
398 3300046689 Ga0495613_0020534 Ga0495613_0020534_2187_3119 310
399 3300046809 Ga0495600_0009363 Ga0495600_0009363_2412_3344 310
400 3300046809 Ga0495600_0009561 Ga0495600_0009561_4730_5662 310
401 3300047317 Ga0495604_0007827 Ga0495604_0007827_7280_8212 310
402 3300047317 Ga0495604_0042437 Ga0495604_0042437_1496_2428 310
403 3300047318 Ga0495636_0017406 Ga0495636_0017406_142_1074 310
404 3300047319 Ga0495674_0004795 Ga0495674_0004795_1496_2428 310
405 3300047322 Ga0495680_0012907 Ga0495680_0012907_5958_6890 310
406 3300047322 Ga0495680_0094373 Ga0495680_0094373_304_1236 310
407 3300047322 Ga0495680_0102000 Ga0495680_0102000_816_1748 310
408 3300047322 Ga0495680_0169904 Ga0495680_0169904_431_1369 310
409 3300047444 Ga0495675_0002113 Ga0495675_0002113_782_1714 310
410 3300047471 Ga0495684_0043615 Ga0495684_0043615_1534_2466 310
411 3300047471 Ga0495684_0085778 Ga0495684_0085778_462_1394 310
412 3300047673 Ga0495593_0107806 Ga0495593_0107806_315_1247 310
413 3300048907 Ga0496104_0081492 Ga0496104_0081492_104_1036 310
414 3300048909 Ga0496106_0139269 Ga0496106_0139269_809_1741 310
415 3300048913 Ga0496110_0038826 Ga0496110_0038826_1716_2648 310
416 3300049568 Ga0501031_0020879 Ga0501031_0020879_2533_3465 310
417 3300049570 Ga0501033_0006757 Ga0501033_0006757_4500_5432 310
418 3300049572 Ga0501036_0000162 Ga0501036_0000162_1084_2016 310
419 3300049573 Ga0501037_0043345 Ga0501037_0043345_1526_2458 310
420 3300049574 Ga0501038_0001044 Ga0501038_0001044_2961_3893 310
421 3300049575 Ga0501039_0002679 Ga0501039_0002679_8582_9514 310
422 3300049575 Ga0501039_0059602 Ga0501039_0059602_1830_2762 310
423 3300049575 Ga0501039_0076946 Ga0501039_0076946_1340_2272 310
424 3300049576 Ga0501040_0000167 Ga0501040_0000167_32155_33087 310
425 3300049576 Ga0501040_0077338 Ga0501040_0077338_189_1121 310
426 3300049578 Ga0501042_0000122 Ga0501042_0000122_1641_2573 310
427 3300049578 Ga0501042_0058277 Ga0501042_0058277_694_1626 310
428 3300049580 Ga0501046_0001014 Ga0501046_0001014_12395_13327 310
429 3300049581 Ga0501047_0002291 Ga0501047_0002291_549_1481 310
430 3300049582 Ga0501048_0000147 Ga0501048_0000147_28929_29861 310
431 3300049583 Ga0501067_0109076 Ga0501067_0109076_273_1205 310
432 3300049584 Ga0501068_0018296 Ga0501068_0018296_497_1429 310
433 3300049585 Ga0501069_0000781 Ga0501069_0000781_622_1554 310
434 3300049586 Ga0501070_0003184 Ga0501070_0003184_10649_11581 310
435 3300049587 Ga0501071_0025357 Ga0501071_0025357_3146_4078 310
436 3300049588 Ga0501072_0182813 Ga0501072_0182813_492_1424 310
437 3300049589 Ga0501073_0000370 Ga0501073_0000370_26918_27850 310
438 3300049590 Ga0501074_0002082 Ga0501074_0002082_551_1483 310
439 3300049591 Ga0501075_0001960 Ga0501075_0001960_871_1803 310
440 3300049591 Ga0501075_0015847 Ga0501075_0015847_1625_2557 310
441 3300049591 Ga0501075_0298511 Ga0501075_0298511_113_1048 310
442 3300049592 Ga0501076_0000726 Ga0501076_0000726_8419_9351 310
443 3300049592 Ga0501076_0026775 Ga0501076_0026775_704_1636 310
444 3300049593 Ga0501077_0000231 Ga0501077_0000231_2649_3581 310
445 3300049741 Ga0501079_0000211 Ga0501079_0000211_28467_29399 310
446 3300049741 Ga0501079_0060506 Ga0501079_0060506_78_1010 310
447 3300049741 Ga0501079_0415049 Ga0501079_0415049_92_1024 310
448 3300049742 Ga0501080_0001759 Ga0501080_0001759_1282_2214 310
449 3300049742 Ga0501080_0027900 Ga0501080_0027900_1459_2391 310
450 3300049742 Ga0501080_0060796 Ga0501080_0060796_2474_3406 310
451 3300049743 Ga0501081_0001106 Ga0501081_0001106_13428_14360 310
452 3300049744 Ga0501083_0013773 Ga0501083_0013773_4011_4943 310
453 3300049823 Ga0501044_0190739 Ga0501044_0190739_306_1238 310
454 3300049824 Ga0501045_0000489 Ga0501045_0000489_20897_21829 310
455 3300049824 Ga0501045_0011791 Ga0501045_0011791_4338_5270 310
456 3300049824 Ga0501045_0261708 Ga0501045_0261708_319_1251 310
457 3300050493 nmdc:mga0k408_11885_c2 nmdc:mga0k408_11885_c2_2499_3431 310
458 3300050493 nmdc:mga0k408_175992_c1 nmdc:mga0k408_175992_c1_214_1146 310
459 3300050493 nmdc:mga0k408_32688_c1 nmdc:mga0k408_32688_c1_792_1724 310
460 3300050507 nmdc:mga05p37_156714_c1 nmdc:mga05p37_156714_c1_1594_2526 310
461 3300050507 nmdc:mga05p37_24332_c1 nmdc:mga05p37_24332_c1_956_1888 310
462 3300050507 nmdc:mga05p37_471977_c1 nmdc:mga05p37_471977_c1_441_1373 310
463 3300050509 nmdc:mga0qj67_293964_c1 nmdc:mga0qj67_293964_c1_97_1029 310
464 3300050510 nmdc:mga06r32_59976_c1 nmdc:mga06r32_59976_c1_2342_3274 310
465 3300050511 nmdc:mga08y16_212251_c1 nmdc:mga08y16_212251_c1_159_1091 310
466 3300050511 nmdc:mga08y16_226469_c1 nmdc:mga08y16_226469_c1_805_1737 310
467 3300050511 nmdc:mga08y16_280408_c1 nmdc:mga08y16_280408_c1_381_1313 310
468 3300050512 nmdc:mga0n895_133579_c1 nmdc:mga0n895_133579_c1_309_1241 310
469 3300050512 nmdc:mga0n895_143956_c1 nmdc:mga0n895_143956_c1_1102_2034 310
470 3300050513 nmdc:mga0rr50_26715_c1 nmdc:mga0rr50_26715_c1_3091_4023 310
471 3300050514 nmdc:mga08x19_12791_c1 nmdc:mga08x19_12791_c1_3766_4698 310
472 3300050514 nmdc:mga08x19_1505_c1 nmdc:mga08x19_1505_c1_12211_13143 310
473 3300050514 nmdc:mga08x19_233500_c1 nmdc:mga08x19_233500_c1_122_1054 310
474 3300050514 nmdc:mga08x19_334263_c1 nmdc:mga08x19_334263_c1_23_955 310
475 3300050514 nmdc:mga08x19_58159_c1 nmdc:mga08x19_58159_c1_505_1437 310
476 3300050515 nmdc:mga0a205_149754_c1 nmdc:mga0a205_149754_c1_1089_2021 310
477 3300050515 nmdc:mga0a205_75607_c1 nmdc:mga0a205_75607_c1_1902_2834 310
478 3300053077 Ga0495601_0000144 Ga0495601_0000144_31848_32780 310
479 3300053077 Ga0495601_0007306 Ga0495601_0007306_1321_2253 310
480 3300053077 Ga0495601_0257074 Ga0495601_0257074_109_1041 310
481 3300053084 Ga0495595_0001310 Ga0495595_0001310_1676_2608 310
482 3300053085 Ga0495619_0071640 Ga0495619_0071640_385_1317 310
483 3300054114 Ga0501084_0000262 Ga0501084_0000262_30694_31626 310
484 3300054114 Ga0501084_0143451 Ga0501084_0143451_892_1824 310
485 3300059426 Ga0590077_027238 Ga0590077_027238_246_1178 310
486 3300060353 Ga0501082_0002140 Ga0501082_0002140_13456_14388 310
487 3300060353 Ga0501082_0319382 Ga0501082_0319382_252_1184 310
488 3300061734 Ga0530510_0000114 Ga0530510_0000114_7199_8131 310
489 3300061734 Ga0530510_0001981 Ga0530510_0001981_1966_2898 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

203

303

0.9

PF00551

Formyl_trans_N

Formyl transferase

3

178

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9252 2 309
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9159 1 310
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9137 2 309
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9131 1 310
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.9127 1 308
ID Description Score Start End Superfamily
af_G5ECV9_1_209_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9484 1 199 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9304 2 201 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9167 2 201 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9078 2 201 3.40.50.170
2blnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9052 1 200 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A4Q3Q1E9-F1-model_v4 deleted 0.9897 1 170
AF-A0A1F3ZN46-F1-model_v4 Methionyl-tRNA formyltransferase 0.9886 1 310 GO:0004479
GO:0005829
AF-A0A519XIL3-F1-model_v4 deleted 0.9879 1 271
AF-A0A519XIL3-F1-model_v4 deleted 0.9843 1 271
AF-A0A4Q3Q1E9-F1-model_v4 deleted 0.9782 1 170

Feature Viewer

pLDDT pTM Quality
95.3 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map