F453807

General Info

Members Datasets Scaffolds Average Seq Length
489 289 464 114

Family's Representative Sequence

Representative Sequence 3300034820|Ga0373959_0207253|Ga0373959_0207253_144_506
Length 105
Sequence VKRAALVAVALAALCAPGAALAHAFLDHAQPAVGSTVHGQPAEVKLWFTQRLEPAFSRVRVLDADGTLMRVSLPKLAPGKYRVVWRVLSVDAHATEGDYTFEVAP

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
5 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
6 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
7 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
8 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
9 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
10 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
11 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
12 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
13 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
14 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
15 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
16 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
17 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
18 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
139 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
140 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
280 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
281 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
282 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
285 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
286 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
287 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
288 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
289 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0.41
Isolates 4.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.75
Nodule 5.73
Rhizoplane 2.86
Rhizosphere 80.37
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10168128 3300001990 Bacteria 647
2 JGI24738J21930_10029356 3300002075 Bacteria 1125
3 JGI24738J21930_10112649 3300002075 Bacteria 587
4 Ga0055529_1038046 3300003763 Bacteria 585
5 Ga0070670_100248523 3300005331 Bacteria 1549
6 Ga0070666_10506889 3300005335 Bacteria 875
7 Ga0070680_100102489 3300005336 Bacteria 2377
8 Ga0070680_100452923 3300005336 Bacteria 1096
9 Ga0070680_101567719 3300005336 Bacteria 570
10 Ga0070660_101230844 3300005339 Bacteria 635
11 Ga0070668_100064213 3300005347 Bacteria 2846
12 Ga0070671_100276322 3300005355 Bacteria 1428
13 Ga0070674_100294756 3300005356 Bacteria 1291
14 Ga0070673_101177969 3300005364 Bacteria 717
15 Ga0070659_100447239 3300005366 Bacteria 1096
16 Ga0070659_101149906 3300005366 Bacteria 685
17 Ga0070667_100155191 3300005367 Bacteria 2013
18 Ga0070709_10739725 3300005434 Bacteria 768
19 Ga0070709_11537090 3300005434 Bacteria 541
20 Ga0070714_100290241 3300005435 Bacteria 1522
21 Ga0070714_102222339 3300005435 Bacteria 534
22 Ga0070713_100003086 3300005436 Bacteria 10954
23 Ga0070713_100824213 3300005436 Unclassified 890
24 Ga0070710_10761718 3300005437 Bacteria 688
25 Ga0070711_100603401 3300005439 Bacteria 916
26 Ga0070711_101570394 3300005439 Unclassified 575
27 Ga0070663_100053435 3300005455 Bacteria 2884
28 Ga0070663_100071960 3300005455 Bacteria 2517
29 Ga0070663_100114375 3300005455 Bacteria 2032
30 Ga0070662_100766529 3300005457 Bacteria 819
31 Ga0070681_10369113 3300005458 Bacteria 1345
32 Ga0070681_11040489 3300005458 Bacteria 739
33 Ga0070707_100125055 3300005468 Bacteria 2498
34 Ga0070698_100462099 3300005471 Bacteria 1205
35 Ga0070679_100386524 3300005530 Bacteria 1346
36 Ga0070697_100017721 3300005536 Bacteria 5610
37 Ga0070697_100338687 3300005536 Bacteria 1298
38 Ga0068853_100012194 3300005539 Bacteria 6991
39 Ga0068853_100099279 3300005539 Bacteria 2572
40 Ga0068853_100154302 3300005539 Bacteria 2068
41 Ga0070672_100912223 3300005543 Bacteria 776
42 Ga0068855_100071950 3300005563 Bacteria 4019
43 Ga0068855_100280285 3300005563 Bacteria 1851
44 Ga0068855_100563817 3300005563 Bacteria 1232
45 Ga0068855_101053460 3300005563 Bacteria 852
46 Ga0068857_100002027 3300005577 Bacteria 16423
47 Ga0068857_100072557 3300005577 Bacteria 3068
48 Ga0068857_100597033 3300005577 Bacteria 1043
49 Ga0068857_100817021 3300005577 Bacteria 891
50 Ga0068854_100001896 3300005578 Bacteria 12736
51 Ga0068854_100029564 3300005578 Bacteria 3794
52 Ga0068854_100248525 3300005578 Bacteria 1419
53 Ga0068854_100494375 3300005578 Bacteria 1029
54 Ga0068856_100021205 3300005614 Bacteria 6311
55 Ga0068856_100094253 3300005614 Bacteria 2980
56 Ga0068856_100173883 3300005614 Bacteria 2166
57 Ga0068856_100610604 3300005614 Bacteria 1111
58 Ga0068852_100005230 3300005616 Bacteria 9254
59 Ga0068852_100038827 3300005616 Bacteria 4004
60 Ga0068852_100051668 3300005616 Bacteria 3529
61 Ga0068859_100365398 3300005617 Bacteria 1538
62 Ga0068864_101375440 3300005618 Bacteria 707
63 Ga0068851_10019679 3300005834 Bacteria 3263
64 Ga0068851_10149606 3300005834 Bacteria 1275
65 Ga0068851_10352878 3300005834 Bacteria 856
66 Ga0068851_10675386 3300005834 Bacteria 634
67 Ga0068858_100061940 3300005842 Bacteria 3459
68 Ga0068862_101352993 3300005844 Bacteria 714
69 Ga0081540_1083789 3300005983 Bacteria 1425
70 Ga0070717_10002657 3300006028 Bacteria 12592
71 Ga0070717_11716327 3300006028 Bacteria 568
72 Ga0075365_10089353 3300006038 Bacteria 2097
73 Ga0075368_10012743 3300006042 Bacteria 3079
74 Ga0075363_100013029 3300006048 Bacteria 4018
75 Ga0075364_10023572 3300006051 Bacteria 3897
76 Ga0070716_100413408 3300006173 Bacteria 973
77 Ga0070716_101358774 3300006173 Bacteria 576
78 Ga0070712_100257105 3300006175 Bacteria 1398
79 Ga0075362_10031362 3300006177 Bacteria 2300
80 Ga0075367_10101753 3300006178 Bacteria 1757
81 Ga0075369_10053139 3300006186 Bacteria 1757
82 Ga0075366_10001415 3300006195 Bacteria 11974
83 Ga0075370_10044518 3300006353 Bacteria 2509
84 Ga0075434_100007911 3300006871 Bacteria 9852
85 Ga0097620_100365390 3300006931 Bacteria 1538
86 Ga0099822_1000677 3300006943 Bacteria 34391
87 Ga0075435_100402660 3300007076 Bacteria 1177
88 Ga0099794_10048045 3300007265 Bacteria 2048
89 Ga0099795_10000591 3300007788 Bacteria 6923
90 Ga0099795_10017104 3300007788 Bacteria 2306
91 Ga0099795_10202377 3300007788 Bacteria 838
92 Ga0105240_10006632 3300009093 Bacteria 16989
93 Ga0105240_10009482 3300009093 Bacteria 13781
94 Ga0105240_10011767 3300009093 Bacteria 12156
95 Ga0105240_10058977 3300009093 Bacteria 4791
96 Ga0105240_10157036 3300009093 Bacteria 2704
97 Ga0105240_10185381 3300009093 Bacteria 2451
98 Ga0105245_10773771 3300009098 Bacteria 997
99 Ga0105247_10029289 3300009101 Bacteria 3336
100 Ga0105243_10102181 3300009148 Bacteria 2382
101 Ga0105241_10001043 3300009174 Bacteria 21105
102 Ga0105241_10223287 3300009174 Bacteria 1585
103 Ga0105242_10596550 3300009176 Bacteria 1066
104 Ga0105248_10075668 3300009177 Bacteria 3784
105 Ga0105237_10020327 3300009545 Bacteria 6848
106 Ga0105237_10101619 3300009545 Bacteria 2867
107 Ga0105237_10163834 3300009545 Bacteria 2222
108 Ga0105237_12425932 3300009545 Bacteria 535
109 Ga0105238_10027445 3300009551 Bacteria 5802
110 Ga0105238_10080474 3300009551 Bacteria 3247
111 Ga0105238_10104788 3300009551 Bacteria 2809
112 Ga0105249_10178229 3300009553 Bacteria 2066
113 Ga0099796_10005279 3300010159 Bacteria 3210
114 Ga0105239_10078444 3300010375 Bacteria 3634
115 Ga0105239_10090548 3300010375 Bacteria 3375
116 Ga0105239_10137961 3300010375 Bacteria 2716
117 Ga0105246_10009456 3300011119 Bacteria 6006
118 Ga0157370_10898715 3300013104 Bacteria 804
119 Ga0157369_10002440 3300013105 Bacteria 22333
120 Ga0157369_10140796 3300013105 Bacteria 2553
121 Ga0157374_10071598 3300013296 Bacteria 3269
122 Ga0157378_10346369 3300013297 Bacteria 1450
123 Ga0163162_11959506 3300013306 Bacteria 671
124 Ga0157372_10065649 3300013307 Bacteria 4076
125 Ga0157372_11207698 3300013307 Bacteria 874
126 Ga0163161_11150237 3300017792 Bacteria 669
127 Ga0206356_10921192 3300020070 Bacteria 595
128 Ga0206354_11155827 3300020081 Bacteria 614
129 Ga0213873_10026525 3300021358 Bacteria 1407
130 Ga0209677_100984 3300025253 Bacteria 13755
131 Ga0209455_1004408 3300025272 Bacteria 4621
132 Ga0209758_1005279 3300025297 Bacteria 10098
133 Ga0209758_1118724 3300025297 Bacteria 717
134 Ga0209257_1017460 3300025304 Bacteria 2824
135 Ga0207656_10071944 3300025321 Bacteria 1538
136 Ga0207656_10256457 3300025321 Bacteria 858
137 Ga0207710_10293984 3300025900 Bacteria 819
138 Ga0207680_10463702 3300025903 Bacteria 900
139 Ga0207647_10000668 3300025904 Bacteria 26811
140 Ga0207647_10028187 3300025904 Bacteria 3651
141 Ga0207647_10147576 3300025904 Bacteria 1376
142 Ga0207699_10160901 3300025906 Bacteria 1494
143 Ga0207699_10217565 3300025906 Bacteria 1302
144 Ga0207654_10000654 3300025911 Bacteria 19613
145 Ga0207654_10065872 3300025911 Bacteria 2134
146 Ga0207707_11492412 3300025912 Bacteria 536
147 Ga0207695_10001204 3300025913 Bacteria 44455
148 Ga0207695_10028122 3300025913 Bacteria 6242
149 Ga0207695_10079056 3300025913 Bacteria 3335
150 Ga0207695_10382081 3300025913 Bacteria 1294
151 Ga0207695_10636176 3300025913 Bacteria 948
152 Ga0207695_11643125 3300025913 Bacteria 523
153 Ga0207671_10150688 3300025914 Bacteria 1797
154 Ga0207671_10215998 3300025914 Unclassified 1501
155 Ga0207671_10404550 3300025914 Bacteria 1086
156 Ga0207693_10322536 3300025915 Bacteria 1209
157 Ga0207663_10111490 3300025916 Bacteria 1857
158 Ga0207660_10141926 3300025917 Bacteria 1837
159 Ga0207660_10357769 3300025917 Bacteria 1171
160 Ga0207652_10036740 3300025921 Bacteria 4142
161 Ga0207646_10230579 3300025922 Bacteria 1673
162 Ga0207694_10000270 3300025924 Bacteria 49357
163 Ga0207694_10040563 3300025924 Bacteria 3585
164 Ga0207694_10375723 3300025924 Bacteria 1179
165 Ga0207700_10004236 3300025928 Bacteria 8428
166 Ga0207664_10626312 3300025929 Bacteria 966
167 Ga0207664_11905263 3300025929 Bacteria 517
168 Ga0207644_10170836 3300025931 Bacteria 1697
169 Ga0207690_11428166 3300025932 Bacteria 579
170 Ga0207690_11588884 3300025932 Bacteria 547
171 Ga0207706_10188333 3300025933 Bacteria 1811
172 Ga0207709_10645793 3300025935 Bacteria 842
173 Ga0207665_10664972 3300025939 Bacteria 817
174 Ga0207691_10817079 3300025940 Bacteria 783
175 Ga0207711_10255653 3300025941 Bacteria 1609
176 Ga0207661_10007575 3300025944 Bacteria 7720
177 Ga0207661_10520127 3300025944 Bacteria 1088
178 Ga0207667_10066639 3300025949 Bacteria 3753
179 Ga0207667_10066849 3300025949 Bacteria 3746
180 Ga0207667_10916219 3300025949 Bacteria 868
181 Ga0207651_11055754 3300025960 Bacteria 727
182 Ga0207668_10091795 3300025972 Bacteria 2233
183 Ga0207668_10412237 3300025972 Bacteria 1145
184 Ga0207640_10023983 3300025981 Bacteria 3674
185 Ga0207658_10144596 3300025986 Bacteria 1929
186 Ga0207639_10037736 3300026041 Bacteria 3591
187 Ga0207639_10125070 3300026041 Bacteria 2119
188 Ga0207678_10079067 3300026067 Bacteria 2816
189 Ga0207678_10164638 3300026067 Bacteria 1894
190 Ga0207702_10000379 3300026078 Bacteria 50639
191 Ga0207702_10120340 3300026078 Bacteria 2349
192 Ga0207702_10122825 3300026078 Bacteria 2326
193 Ga0207702_10180931 3300026078 Bacteria 1941
194 Ga0207702_11522437 3300026078 Bacteria 662
195 Ga0207676_11144722 3300026095 Bacteria 770
196 Ga0207674_10004705 3300026116 Bacteria 16367
197 Ga0207674_10008086 3300026116 Bacteria 12193
198 Ga0207674_10488239 3300026116 Bacteria 1190
199 Ga0207674_11865029 3300026116 Bacteria 568
200 Ga0207698_10216766 3300026142 Bacteria 1726
201 Ga0207698_10448726 3300026142 Bacteria 1244
202 Ga0209589_1000006 3300027357 Bacteria 436292
203 Ga0209589_1029348 3300027357 Bacteria 3195
204 Ga0209489_100007 3300027361 Bacteria 436292
205 Ga0209489_100090 3300027361 Bacteria 123931
206 Ga0209700_100008 3300027363 Bacteria 436292
207 Ga0209179_1001099 3300027512 Bacteria 3151
208 Ga0209179_1015480 3300027512 Bacteria 1417
209 Ga0209813_10005322 3300027866 Bacteria 3116
210 Ga0307517_10295151 3300028786 Bacteria 913
211 Ga0265325_10012511 3300031241 Bacteria 4851
212 Ga0265339_10119797 3300031249 Bacteria 1354
213 Ga0265331_10048630 3300031250 Bacteria 2038
214 Ga0265316_10102746 3300031344 Bacteria 2171
215 Ga0307508_10000038 3300031616 Bacteria 150186
216 Ga0265314_10097582 3300031711 Bacteria 1898
217 Ga0265342_10034628 3300031712 Bacteria 3097
218 Ga0373959_0207253 3300034820 Bacteria 520
219 Ga0373934_0002896 3300035086 Bacteria 6277
220 Ga0373934_0050445 3300035086 Bacteria 1649
221 Ga0373923_0001863 3300035111 Bacteria 6271
222 Ga0373923_0410119 3300035111 Bacteria 653
223 Ga0373936_0085607 3300035113 Bacteria 1316
224 Ga0373941_0258581 3300035115 Bacteria 682
225 Ga0373945_0016555 3300035116 Bacteria 2488
226 Ga0373953_0000355 3300035117 Bacteria 12338
227 Ga0373953_0021092 3300035117 Bacteria 2441
228 Ga0373953_0112733 3300035117 Bacteria 1151
229 Ga0373954_0000035 3300035118 Bacteria 51266
230 Ga0373954_0045080 3300035118 Bacteria 2059
231 Ga0373954_0058327 3300035118 Bacteria 1819
232 Ga0373954_0462095 3300035118 Bacteria 628
233 Ga0373956_0000207 3300035119 Bacteria 22860
234 Ga0373956_0024144 3300035119 Bacteria 2617
235 Ga0373956_0042268 3300035119 Bacteria 2026
236 Ga0373956_0091823 3300035119 Bacteria 1401
237 Ga0373957_0001128 3300035120 Bacteria 7068
238 Ga0373957_0386607 3300035120 Bacteria 601
239 Ga0373943_0020410 3300035170 Bacteria 3054
240 Ga0373955_0001046 3300035172 Bacteria 11763
241 Ga0373955_0116169 3300035172 Bacteria 1551
242 Ga0373955_0169279 3300035172 Bacteria 1292
243 Ga0373924_0006045 3300035410 Bacteria 4320
244 Ga0373924_0093149 3300035410 Bacteria 1290
245 Ga0373924_0241886 3300035410 Bacteria 798
246 Ga0373935_0016609 3300035692 Bacteria 4454
247 Ga0373933_0000037 3300035724 Bacteria 81092
248 Ga0373933_0001661 3300035724 Bacteria 12935
249 Ga0373933_0095996 3300035724 Bacteria 1834
250 Ga0373947_0074635 3300035725 Bacteria 2087
251 Ga0373937_0000118 3300036401 Bacteria 75902
252 Ga0373937_0059371 3300036401 Bacteria 3515
253 Ga0373937_0169299 3300036401 Bacteria 2049
254 Ga0373925_0007203 3300037068 Bacteria 8129
255 Ga0373925_1266110 3300037068 Bacteria 605
256 Ga0395899_0056671 3300037312 Bacteria 2896
257 Ga0395900_0253020 3300037418 Bacteria 1762
258 Ga0395900_0523458 3300037418 Bacteria 1133
259 Ga0395898_0478877 3300037466 Bacteria 1184
260 Ga0395898_1815455 3300037466 Bacteria 531
261 Ga0395905_0008616 3300037471 Bacteria 10049
262 Ga0436364_0961545 3300037853 Bacteria 1880
263 Ga0395901_0058896 3300038443 Bacteria 3996
264 Ga0395901_1249859 3300038443 Bacteria 706
265 Ga0436365_0300606 3300039437 Bacteria 1681
266 Ga0436365_1073059 3300039437 Bacteria 3321
267 Ga0436360_0534705 3300039438 Bacteria 2505
268 Ga0436361_0563314 3300039447 Bacteria 3982
269 Ga0436361_0922696 3300039447 Bacteria 1896
270 Ga0436361_0997442 3300039447 Bacteria 5919
271 Ga0436363_0108701 3300039450 Bacteria 848
272 Ga0436362_0515042 3300039453 Bacteria 5571
273 Ga0466972_0013485 3300044658 Bacteria 4103
274 Ga0466966_0036888 3300044684 Bacteria 3155
275 Ga0466961_0304455 3300044693 Bacteria 973
276 Ga0466963_0124185 3300044694 Bacteria 1778
277 Ga0466968_0076460 3300044735 Bacteria 1465
278 Ga0466968_0077209 3300044735 Bacteria 1459
279 Ga0466970_0099750 3300044765 Bacteria 1581
280 Ga0466957_0313408 3300044842 Bacteria 1057
281 Ga0466957_0506702 3300044842 Bacteria 837
282 Ga0466960_0137710 3300044901 Bacteria 1294
283 Ga0466959_0095107 3300045049 Unclassified 2137
284 Ga0466967_0026843 3300045976 Bacteria 4779
285 Ga0466967_0270316 3300045976 Bacteria 1629
286 Ga0495592_0000649 3300046454 Bacteria 24123
287 Ga0495592_0103365 3300046454 Bacteria 2027
288 Ga0495592_0506788 3300046454 Bacteria 748
289 Ga0495603_0082745 3300046455 Bacteria 1880
290 Ga0495603_0385601 3300046455 Bacteria 803
291 Ga0495629_0018856 3300046459 Bacteria 4932
292 Ga0495629_0126231 3300046459 Bacteria 1782
293 Ga0495629_0187570 3300046459 Bacteria 1432
294 Ga0495651_0000412 3300046462 Bacteria 33198
295 Ga0495651_0033813 3300046462 Bacteria 3987
296 Ga0495651_0061969 3300046462 Bacteria 2863
297 Ga0495653_0000161 3300046463 Bacteria 55322
298 Ga0495653_0261309 3300046463 Bacteria 1144
299 Ga0495653_0283746 3300046463 Bacteria 1086
300 Ga0495580_0125475 3300046472 Bacteria 1781
301 Ga0495582_0013252 3300046473 Bacteria 4538
302 Ga0495605_0120554 3300046474 Bacteria 1189
303 Ga0495662_0199730 3300046476 Bacteria 986
304 Ga0495662_0285719 3300046476 Bacteria 812
305 Ga0495664_0005508 3300046477 Bacteria 6952
306 Ga0495664_0145031 3300046477 Bacteria 1439
307 Ga0495664_0253541 3300046477 Bacteria 1064
308 Ga0495584_0374295 3300046491 Bacteria 723
309 Ga0495594_0109915 3300046499 Bacteria 1554
310 Ga0495606_0034102 3300046507 Bacteria 3499
311 Ga0495608_0000403 3300046511 Bacteria 30220
312 Ga0495608_0036893 3300046511 Bacteria 3288
313 Ga0495608_0129551 3300046511 Bacteria 1615
314 Ga0495608_0398963 3300046511 Bacteria 841
315 Ga0495610_0149465 3300046512 Bacteria 998
316 Ga0495616_0263679 3300046513 Bacteria 736
317 Ga0495618_0010704 3300046514 Bacteria 5554
318 Ga0495618_0047100 3300046514 Bacteria 2722
319 Ga0495618_0056268 3300046514 Bacteria 2490
320 Ga0495628_0002406 3300046516 Bacteria 16872
321 Ga0495628_0359325 3300046516 Bacteria 1069
322 Ga0495630_0065783 3300046517 Bacteria 2724
323 Ga0495630_0074507 3300046517 Bacteria 2557
324 Ga0495643_0010360 3300046522 Bacteria 5740
325 Ga0495648_0007200 3300046524 Bacteria 8938
326 Ga0495666_0039086 3300046526 Bacteria 2305
327 Ga0495652_0000604 3300046529 Bacteria 42071
328 Ga0495652_0025308 3300046529 Bacteria 5252
329 Ga0495652_0881388 3300046529 Bacteria 591
330 Ga0495665_0010170 3300046531 Bacteria 5099
331 Ga0495665_0592841 3300046531 Bacteria 554
332 Ga0495640_0014844 3300046533 Bacteria 5878
333 Ga0495640_0056016 3300046533 Bacteria 2695
334 Ga0495586_0469523 3300046535 Bacteria 725
335 Ga0495587_0001226 3300046536 Bacteria 16984
336 Ga0495587_0028768 3300046536 Bacteria 3377
337 Ga0495587_0037222 3300046536 Bacteria 2922
338 Ga0495597_0046498 3300046542 Bacteria 1923
339 Ga0495645_0040041 3300046543 Bacteria 3418
340 Ga0495645_0138193 3300046543 Bacteria 1702
341 Ga0495645_0210478 3300046543 Bacteria 1313
342 Ga0495667_0000147 3300046559 Bacteria 47993
343 Ga0495667_0082999 3300046559 Bacteria 2081
344 Ga0495667_0238206 3300046559 Bacteria 1159
345 Ga0495667_0352743 3300046559 Bacteria 929
346 Ga0495668_0386015 3300046616 Bacteria 769
347 Ga0495634_0002287 3300046642 Bacteria 16031
348 Ga0495634_0062162 3300046642 Bacteria 2480
349 Ga0495634_0275343 3300046642 Bacteria 1023
350 Ga0495635_0000517 3300046663 Bacteria 24463
351 Ga0495635_0046233 3300046663 Bacteria 3003
352 Ga0495635_0187594 3300046663 Bacteria 1404
353 Ga0495657_0000995 3300046675 Bacteria 24963
354 Ga0495657_0044062 3300046675 Bacteria 3038
355 Ga0495657_0230500 3300046675 Bacteria 1120
356 Ga0495599_0000685 3300046678 Bacteria 19241
357 Ga0495599_0298892 3300046678 Bacteria 972
358 Ga0495599_0360007 3300046678 Bacteria 871
359 Ga0495623_0000549 3300046679 Bacteria 25012
360 Ga0495623_0092369 3300046679 Bacteria 1855
361 Ga0495623_0112169 3300046679 Bacteria 1651
362 Ga0495646_0033391 3300046680 Bacteria 3198
363 Ga0495646_0083409 3300046680 Bacteria 1858
364 Ga0495646_0280660 3300046680 Bacteria 885
365 Ga0495613_0020900 3300046689 Bacteria 4880
366 Ga0495613_0097906 3300046689 Bacteria 2120
367 Ga0495613_0323574 3300046689 Bacteria 1064
368 Ga0495624_0048532 3300046690 Bacteria 2694
369 Ga0495624_0117561 3300046690 Bacteria 1633
370 Ga0495649_0117152 3300046694 Bacteria 1410
371 Ga0495600_0000771 3300046809 Bacteria 16878
372 Ga0495600_0028491 3300046809 Bacteria 3614
373 Ga0495600_0117662 3300046809 Bacteria 1729
374 Ga0495581_0325660 3300047315 Bacteria 897
375 Ga0495604_0000253 3300047317 Bacteria 47392
376 Ga0495604_0052500 3300047317 Bacteria 3156
377 Ga0495604_0090815 3300047317 Bacteria 2267
378 Ga0495604_0482541 3300047317 Bacteria 806
379 Ga0495674_0023503 3300047319 Bacteria 5679
380 Ga0495674_0038974 3300047319 Bacteria 4261
381 Ga0495674_0247848 3300047319 Bacteria 1466
382 Ga0495674_0583220 3300047319 Bacteria 887
383 Ga0495674_1148908 3300047319 Bacteria 589
384 Ga0495676_0313523 3300047321 Bacteria 1055
385 Ga0495680_0000406 3300047322 Bacteria 48300
386 Ga0495680_0207310 3300047322 Bacteria 1404
387 Ga0495680_0465982 3300047322 Bacteria 862
388 Ga0495683_0075385 3300047323 Bacteria 1652
389 Ga0495687_022118 3300047443 Bacteria 3059
390 Ga0495675_0000285 3300047444 Bacteria 36643
391 Ga0495675_0021354 3300047444 Bacteria 4122
392 Ga0495675_0185588 3300047444 Bacteria 1271
393 Ga0495675_0327105 3300047444 Bacteria 906
394 Ga0495673_0058853 3300047469 Bacteria 1654
395 Ga0495684_0000184 3300047471 Bacteria 47730
396 Ga0495684_0006232 3300047471 Bacteria 9268
397 Ga0495684_0043020 3300047471 Bacteria 3458
398 Ga0495684_0056681 3300047471 Bacteria 2987
399 Ga0495593_0002781 3300047673 Bacteria 10535
400 Ga0495593_0152105 3300047673 Bacteria 1170
401 Ga0495593_0191096 3300047673 Bacteria 1030
402 Ga0495602_0002194 3300048088 Bacteria 19718
403 Ga0495602_0008157 3300048088 Bacteria 10937
404 Ga0495602_0116283 3300048088 Bacteria 2161
405 Ga0495602_0817577 3300048088 Bacteria 625
406 Ga0496102_0014591 3300048905 Bacteria 6828
407 Ga0496103_0046799 3300048906 Bacteria 2671
408 Ga0496104_0321798 3300048907 Bacteria 1459
409 Ga0496105_0076539 3300048908 Bacteria 2763
410 Ga0496106_0370983 3300048909 Bacteria 1150
411 Ga0496106_0375796 3300048909 Bacteria 1142
412 Ga0496108_0006521 3300048911 Bacteria 9464
413 Ga0496109_0283763 3300048912 Bacteria 1561
414 Ga0496109_0833764 3300048912 Unclassified 860
415 Ga0496111_0144857 3300048914 Bacteria 1761
416 Ga0496112_0124079 3300048915 Bacteria 2553
417 Ga0496112_1868308 3300048915 Bacteria 512
418 Ga0496113_0133941 3300048916 Bacteria 1946
419 Ga0496115_0164210 3300048918 Bacteria 1836
420 Ga0496116_0202834 3300048919 Unclassified 1036
421 Ga0496116_0329358 3300048919 Bacteria 710
422 Ga0496117_0084767 3300048920 Bacteria 2066
423 Ga0496118_0037443 3300048921 Bacteria 3903
424 Ga0496118_0058829 3300048921 Bacteria 2868
425 Ga0496119_0105505 3300048922 Bacteria 1574
426 Ga0496119_0247911 3300048922 Bacteria 899
427 Ga0496121_0013546 3300048924 Bacteria 8746
428 Ga0496121_0230703 3300048924 Bacteria 1297
429 Ga0496124_0352396 3300048927 Bacteria 1041
430 Ga0496125_0062619 3300048928 Bacteria 2973
431 Ga0496125_0093735 3300048928 Bacteria 2240
432 nmdc:mga03683_24564_c1 3300050489 Bacteria 2359
433 nmdc:mga03n38_9207_c1 3300050490 Bacteria 3580
434 nmdc:mga00v17_25933_c1 3300050491 Bacteria 3410
435 nmdc:mga0yw44_665354_c1 3300050492 Bacteria 708
436 nmdc:mga0k408_14411_c1 3300050493 Bacteria 4356
437 nmdc:mga06z11_66374_c1 3300050494 Bacteria 1897
438 nmdc:mga04h51_3717_c1 3300050495 Bacteria 3734
439 nmdc:mga07m45_567434_c1 3300050496 Bacteria 656
440 nmdc:mga07m45_58975_c1 3300050496 Bacteria 2172
441 nmdc:mga0n895_56570_c1 3300050512 Bacteria 3864
442 nmdc:mga08x19_89118_c1 3300050514 Bacteria 2034
443 nmdc:mga0sz30_30584_c1 3300050516 Bacteria 2225
444 Ga0495601_0004707 3300053077 Bacteria 7907
445 Ga0495601_0015786 3300053077 Bacteria 4570
446 Ga0495601_0302111 3300053077 Bacteria 1042
447 Ga0495601_0755804 3300053077 Bacteria 618
448 Ga0495612_0070799 3300053078 Bacteria 1454
449 Ga0495612_0190132 3300053078 Bacteria 903
450 Ga0495595_0000318 3300053084 Bacteria 18768
451 Ga0495595_0285777 3300053084 Bacteria 828
452 Ga0495595_0554197 3300053084 Bacteria 587
453 Ga0495619_0000209 3300053085 Bacteria 42507
454 Ga0495619_0030054 3300053085 Bacteria 3515
455 Ga0495619_0086509 3300053085 Bacteria 2118
456 Ga0495619_0663761 3300053085 Bacteria 710
457 Ga0500651_0593886 3300053093 Bacteria 601
458 Ga0500569_055824 3300053109 Bacteria 1206
459 Ga0500559_0000282 3300053136 Bacteria 39282
460 Ga0500588_0169188 3300053146 Bacteria 799
461 Ga0500576_066210 3300053725 Unclassified 1566
462 Ga0500609_019047 3300053731 Bacteria 935
463 Ga0500596_000219 3300053735 Bacteria 9684
464 Ga0466962_0221056 3300061719 Bacteria 928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_0583220 Ga0495674_0583220_89_391 100
2 3300053136 Ga0500559_0000282 Ga0500559_0000282_5316_5672 102
3 3300053725 Ga0500576_066210 Ga0500576_066210_590_946 102
4 3300053735 Ga0500596_000219 Ga0500596_000219_1788_2144 102
5 3300009545 Ga0105237_12425932 Ga0105237_124259321 104
6 3300048912 Ga0496109_0833764 Ga0496109_0833764_510_824 104
7 3300007076 Ga0075435_100402660 Ga0075435_1004026602 105
8 3300034820 Ga0373959_0207253 Ga0373959_0207253_144_506 105
9 3300035115 Ga0373941_0258581 Ga0373941_0258581_49_411 105
10 3300035118 Ga0373954_0058327 Ga0373954_0058327_368_685 105
11 3300035120 Ga0373957_0386607 Ga0373957_0386607_241_558 105
12 3300046454 Ga0495592_0506788 Ga0495592_0506788_139_456 105
13 3300046462 Ga0495651_0033813 Ga0495651_0033813_2736_3053 105
14 3300046463 Ga0495653_0261309 Ga0495653_0261309_454_771 105
15 3300046511 Ga0495608_0036893 Ga0495608_0036893_1708_2025 105
16 3300046529 Ga0495652_0025308 Ga0495652_0025308_184_501 105
17 3300046536 Ga0495587_0028768 Ga0495587_0028768_350_667 105
18 3300046559 Ga0495667_0082999 Ga0495667_0082999_1493_1810 105
19 3300046675 Ga0495657_0230500 Ga0495657_0230500_440_757 105
20 3300046679 Ga0495623_0092369 Ga0495623_0092369_197_514 105
21 3300046809 Ga0495600_0028491 Ga0495600_0028491_694_1011 105
22 3300047317 Ga0495604_0090815 Ga0495604_0090815_1726_2043 105
23 3300047322 Ga0495680_0465982 Ga0495680_0465982_212_529 105
24 3300047444 Ga0495675_0021354 Ga0495675_0021354_1815_2132 105
25 3300047471 Ga0495684_0056681 Ga0495684_0056681_2399_2716 105
26 3300048088 Ga0495602_0008157 Ga0495602_0008157_5254_5571 105
27 3300050514 nmdc:mga08x19_89118_c1 nmdc:mga08x19_89118_c1_1357_1719 105
28 3300053085 Ga0495619_0030054 Ga0495619_0030054_663_980 105
29 3300013105 Ga0157369_10140796 Ga0157369_101407963 106
30 3300035086 Ga0373934_0002896 Ga0373934_0002896_3432_3752 106
31 3300035111 Ga0373923_0001863 Ga0373923_0001863_3326_3646 106
32 3300035117 Ga0373953_0000355 Ga0373953_0000355_10393_10713 106
33 3300035118 Ga0373954_0000035 Ga0373954_0000035_26556_26876 106
34 3300035119 Ga0373956_0000207 Ga0373956_0000207_8811_9131 106
35 3300035119 Ga0373956_0042268 Ga0373956_0042268_1672_1992 106
36 3300035120 Ga0373957_0001128 Ga0373957_0001128_4131_4451 106
37 3300035172 Ga0373955_0001046 Ga0373955_0001046_3173_3493 106
38 3300035410 Ga0373924_0006045 Ga0373924_0006045_163_483 106
39 3300035724 Ga0373933_0000037 Ga0373933_0000037_50920_51240 106
40 3300036401 Ga0373937_0000118 Ga0373937_0000118_16529_16849 106
41 3300045976 Ga0466967_0270316 Ga0466967_0270316_1241_1561 106
42 3300046454 Ga0495592_0000649 Ga0495592_0000649_21720_22040 106
43 3300046459 Ga0495629_0018856 Ga0495629_0018856_1743_2063 106
44 3300046462 Ga0495651_0000412 Ga0495651_0000412_2085_2405 106
45 3300046463 Ga0495653_0000161 Ga0495653_0000161_35516_35836 106
46 3300046476 Ga0495662_0285719 Ga0495662_0285719_61_381 106
47 3300046511 Ga0495608_0000403 Ga0495608_0000403_27274_27594 106
48 3300046514 Ga0495618_0047100 Ga0495618_0047100_1504_1824 106
49 3300046516 Ga0495628_0002406 Ga0495628_0002406_1835_2155 106
50 3300046529 Ga0495652_0000604 Ga0495652_0000604_30777_31097 106
51 3300046531 Ga0495665_0592841 Ga0495665_0592841_28_348 106
52 3300046533 Ga0495640_0014844 Ga0495640_0014844_2486_2806 106
53 3300046536 Ga0495587_0001226 Ga0495587_0001226_3173_3493 106
54 3300046543 Ga0495645_0040041 Ga0495645_0040041_2429_2749 106
55 3300046559 Ga0495667_0000147 Ga0495667_0000147_35254_35574 106
56 3300046642 Ga0495634_0002287 Ga0495634_0002287_1881_2201 106
57 3300046663 Ga0495635_0000517 Ga0495635_0000517_15854_16174 106
58 3300046675 Ga0495657_0000995 Ga0495657_0000995_8290_8610 106
59 3300046678 Ga0495599_0000685 Ga0495599_0000685_3168_3488 106
60 3300046679 Ga0495623_0000549 Ga0495623_0000549_16403_16723 106
61 3300046680 Ga0495646_0033391 Ga0495646_0033391_2518_2838 106
62 3300046689 Ga0495613_0020900 Ga0495613_0020900_960_1280 106
63 3300046809 Ga0495600_0000771 Ga0495600_0000771_3173_3493 106
64 3300047317 Ga0495604_0000253 Ga0495604_0000253_11819_12139 106
65 3300047319 Ga0495674_0038974 Ga0495674_0038974_2555_2875 106
66 3300047322 Ga0495680_0000406 Ga0495680_0000406_35500_35820 106
67 3300047444 Ga0495675_0000285 Ga0495675_0000285_684_1004 106
68 3300047471 Ga0495684_0000184 Ga0495684_0000184_8719_9039 106
69 3300047673 Ga0495593_0002781 Ga0495593_0002781_7161_7481 106
70 3300048088 Ga0495602_0002194 Ga0495602_0002194_16403_16723 106
71 3300048915 Ga0496112_1868308 Ga0496112_1868308_142_462 106
72 3300048918 Ga0496115_0164210 Ga0496115_0164210_679_999 106
73 3300053077 Ga0495601_0004707 Ga0495601_0004707_6878_7198 106
74 3300053084 Ga0495595_0000318 Ga0495595_0000318_16064_16384 106
75 3300053085 Ga0495619_0000209 Ga0495619_0000209_6694_7014 106
76 iso_pu_bacteria 2876761206 2876770692 106
77 3300005364 Ga0070673_101177969 Ga0070673_1011779692 109
78 3300005367 Ga0070667_100155191 Ga0070667_1001551911 109
79 3300005543 Ga0070672_100912223 Ga0070672_1009122231 109
80 3300005614 Ga0068856_100173883 Ga0068856_1001738832 109
81 3300005842 Ga0068858_100061940 Ga0068858_1000619403 109
82 3300006042 Ga0075368_10012743 Ga0075368_100127434 109
83 3300006051 Ga0075364_10023572 Ga0075364_100235723 109
84 3300006177 Ga0075362_10031362 Ga0075362_100313624 109
85 3300009098 Ga0105245_10773771 Ga0105245_107737712 109
86 3300009101 Ga0105247_10029289 Ga0105247_100292892 109
87 3300009148 Ga0105243_10102181 Ga0105243_101021812 109
88 3300009174 Ga0105241_10223287 Ga0105241_102232871 109
89 3300009176 Ga0105242_10596550 Ga0105242_105965502 109
90 3300009177 Ga0105248_10075668 Ga0105248_100756683 109
91 3300009545 Ga0105237_10020327 Ga0105237_100203276 109
92 3300009551 Ga0105238_10104788 Ga0105238_101047882 109
93 3300009553 Ga0105249_10178229 Ga0105249_101782293 109
94 3300010375 Ga0105239_10078444 Ga0105239_100784443 109
95 3300011119 Ga0105246_10009456 Ga0105246_100094563 109
96 3300013296 Ga0157374_10071598 Ga0157374_100715983 109
97 3300013297 Ga0157378_10346369 Ga0157378_103463691 109
98 3300025903 Ga0207680_10463702 Ga0207680_104637022 109
99 3300025904 Ga0207647_10028187 Ga0207647_100281873 109
100 3300025924 Ga0207694_10375723 Ga0207694_103757232 109
101 3300026067 Ga0207678_10079067 Ga0207678_100790673 109
102 3300026078 Ga0207702_10120340 Ga0207702_101203402 109
103 3300027866 Ga0209813_10005322 Ga0209813_100053222 109
104 3300037418 Ga0395900_0523458 Ga0395900_0523458_206_535 109
105 3300037471 Ga0395905_0008616 Ga0395905_0008616_7476_7805 109
106 3300038443 Ga0395901_1249859 Ga0395901_1249859_365_694 109
107 3300046474 Ga0495605_0120554 Ga0495605_0120554_448_777 109
108 3300046507 Ga0495606_0034102 Ga0495606_0034102_454_783 109
109 3300046512 Ga0495610_0149465 Ga0495610_0149465_403_732 109
110 3300046513 Ga0495616_0263679 Ga0495616_0263679_271_600 109
111 3300046522 Ga0495643_0010360 Ga0495643_0010360_2051_2380 109
112 3300046542 Ga0495597_0046498 Ga0495597_0046498_548_877 109
113 3300046616 Ga0495668_0386015 Ga0495668_0386015_419_748 109
114 3300046694 Ga0495649_0117152 Ga0495649_0117152_340_669 109
115 3300047323 Ga0495683_0075385 Ga0495683_0075385_1147_1476 109
116 3300047443 Ga0495687_022118 Ga0495687_022118_2284_2613 109
117 3300048905 Ga0496102_0014591 Ga0496102_0014591_4167_4496 109
118 3300048906 Ga0496103_0046799 Ga0496103_0046799_1652_1981 109
119 3300048907 Ga0496104_0321798 Ga0496104_0321798_548_877 109
120 3300048908 Ga0496105_0076539 Ga0496105_0076539_1779_2108 109
121 3300048909 Ga0496106_0370983 Ga0496106_0370983_452_781 109
122 3300048911 Ga0496108_0006521 Ga0496108_0006521_8847_9176 109
123 3300048912 Ga0496109_0283763 Ga0496109_0283763_944_1273 109
124 3300048915 Ga0496112_0124079 Ga0496112_0124079_428_757 109
125 3300048916 Ga0496113_0133941 Ga0496113_0133941_344_673 109
126 3300048919 Ga0496116_0329358 Ga0496116_0329358_362_691 109
127 3300048920 Ga0496117_0084767 Ga0496117_0084767_1323_1652 109
128 3300048921 Ga0496118_0058829 Ga0496118_0058829_2083_2412 109
129 3300048922 Ga0496119_0247911 Ga0496119_0247911_248_577 109
130 3300048924 Ga0496121_0230703 Ga0496121_0230703_253_582 109
131 3300048927 Ga0496124_0352396 Ga0496124_0352396_113_442 109
132 3300048928 Ga0496125_0062619 Ga0496125_0062619_242_571 109
133 3300050489 nmdc:mga03683_24564_c1 nmdc:mga03683_24564_c1_1908_2237 109
134 3300050490 nmdc:mga03n38_9207_c1 nmdc:mga03n38_9207_c1_1938_2267 109
135 3300050491 nmdc:mga00v17_25933_c1 nmdc:mga00v17_25933_c1_411_740 109
136 3300050492 nmdc:mga0yw44_665354_c1 nmdc:mga0yw44_665354_c1_27_356 109
137 3300050493 nmdc:mga0k408_14411_c1 nmdc:mga0k408_14411_c1_1990_2319 109
138 3300050494 nmdc:mga06z11_66374_c1 nmdc:mga06z11_66374_c1_540_869 109
139 3300050495 nmdc:mga04h51_3717_c1 nmdc:mga04h51_3717_c1_1202_1531 109
140 3300050496 nmdc:mga07m45_58975_c1 nmdc:mga07m45_58975_c1_1302_1631 109
141 3300050516 nmdc:mga0sz30_30584_c1 nmdc:mga0sz30_30584_c1_1175_1504 109
142 iso_pu_bacteria 8019547302 8019547738 109
143 3300044658 Ga0466972_0013485 Ga0466972_0013485_2608_2940 110
144 3300044694 Ga0466963_0124185 Ga0466963_0124185_756_1088 110
145 3300044735 Ga0466968_0076460 Ga0466968_0076460_387_719 110
146 3300044901 Ga0466960_0137710 Ga0466960_0137710_587_919 110
147 3300045976 Ga0466967_0026843 Ga0466967_0026843_2377_2709 110
148 3300046491 Ga0495584_0374295 Ga0495584_0374295_180_512 110
149 3300046524 Ga0495648_0007200 Ga0495648_0007200_3457_3789 110
150 3300047673 Ga0495593_0191096 Ga0495593_0191096_78_410 110
151 3300053084 Ga0495595_0554197 Ga0495595_0554197_35_367 110
152 3300053093 Ga0500651_0593886 Ga0500651_0593886_24_356 110
153 3300053109 Ga0500569_055824 Ga0500569_055824_695_1027 110
154 3300053146 Ga0500588_0169188 Ga0500588_0169188_229_561 110
155 3300053731 Ga0500609_019047 Ga0500609_019047_212_544 110
156 iso_pu_bacteria 2885383462 2885386443 111
157 iso_pu_bacteria 2881665667 2881671973 112
158 iso_pu_bacteria 2922425934 2922429303 112
159 3300013307 Ga0157372_11207698 Ga0157372_112076981 113
160 3300039437 Ga0436365_0300606 Ga0436365_0300606_859_1200 113
161 3300044693 Ga0466961_0304455 Ga0466961_0304455_254_595 113
162 3300050496 nmdc:mga07m45_567434_c1 nmdc:mga07m45_567434_c1_116_457 113
163 iso_pu_bacteria 2935959822 2935960421 113
164 3300039447 Ga0436361_0922696 Ga0436361_0922696_1535_1882 114
165 iso_pu_bacteria 2513237141 2513892738 114
166 iso_pu_bacteria 2935648319 2935651054 114
167 iso_pu_bacteria 2935656913 2935659235 114
168 iso_pu_bacteria 2935769743 2935774333 114
169 iso_pu_bacteria 2935785616 2935793033 114
170 iso_pu_bacteria 2935793552 2935801054 114
171 iso_pu_bacteria 2936011229 2936013650 114
172 iso_pu_bacteria 2936019824 2936022223 114
173 iso_pu_bacteria 2936028420 2936030669 114
174 iso_pu_bacteria 2936046547 2936048482 114
175 iso_pu_bacteria 2936055302 2936058696 114
176 iso_pu_bacteria 3005594810 3005598512 114
177 iso_pu_bacteria 8016622563 8016628818 114
178 iso_pu_bacteria 8019648815 8019654682 114
179 iso_pu_bacteria 2513237104 2513718555 115
180 3300027357 Ga0209589_1029348 Ga0209589_10293483 116
181 3300027361 Ga0209489_100090 Ga0209489_100090144 116
182 iso_pu_bacteria 8019538911 8019541585 116
183 iso_pu_bacteria 8019668869 8019674852 116
184 iso_pu_bacteria 8019678201 8019681240 116
185 3300005436 Ga0070713_100824213 Ga0070713_1008242132 117
186 3300048919 Ga0496116_0202834 Ga0496116_0202834_133_486 117
187 3300048921 Ga0496118_0037443 Ga0496118_0037443_1938_2291 117
188 3300048922 Ga0496119_0105505 Ga0496119_0105505_129_482 117
189 3300048924 Ga0496121_0013546 Ga0496121_0013546_1136_1489 117
190 3300048928 Ga0496125_0093735 Ga0496125_0093735_802_1155 117
191 3300001990 JGI24737J22298_10168128 JGI24737J22298_101681282 118
192 3300002075 JGI24738J21930_10029356 JGI24738J21930_100293562 118
193 3300002075 JGI24738J21930_10112649 JGI24738J21930_101126492 118
194 3300003763 Ga0055529_1038046 Ga0055529_10380461 118
195 3300005331 Ga0070670_100248523 Ga0070670_1002485232 118
196 3300005335 Ga0070666_10506889 Ga0070666_105068891 118
197 3300005336 Ga0070680_100102489 Ga0070680_1001024892 118
198 3300005336 Ga0070680_100452923 Ga0070680_1004529232 118
199 3300005336 Ga0070680_101567719 Ga0070680_1015677191 118
200 3300005339 Ga0070660_101230844 Ga0070660_1012308441 118
201 3300005347 Ga0070668_100064213 Ga0070668_1000642133 118
202 3300005355 Ga0070671_100276322 Ga0070671_1002763222 118
203 3300005356 Ga0070674_100294756 Ga0070674_1002947562 118
204 3300005366 Ga0070659_100447239 Ga0070659_1004472392 118
205 3300005366 Ga0070659_101149906 Ga0070659_1011499062 118
206 3300005434 Ga0070709_10739725 Ga0070709_107397251 118
207 3300005434 Ga0070709_11537090 Ga0070709_115370901 118
208 3300005435 Ga0070714_100290241 Ga0070714_1002902411 118
209 3300005435 Ga0070714_102222339 Ga0070714_1022223391 118
210 3300005436 Ga0070713_100003086 Ga0070713_1000030863 118
211 3300005437 Ga0070710_10761718 Ga0070710_107617181 118
212 3300005439 Ga0070711_100603401 Ga0070711_1006034012 118
213 3300005439 Ga0070711_101570394 Ga0070711_1015703942 118
214 3300005455 Ga0070663_100053435 Ga0070663_1000534352 118
215 3300005455 Ga0070663_100071960 Ga0070663_1000719602 118
216 3300005455 Ga0070663_100114375 Ga0070663_1001143752 118
217 3300005457 Ga0070662_100766529 Ga0070662_1007665292 118
218 3300005458 Ga0070681_10369113 Ga0070681_103691132 118
219 3300005458 Ga0070681_11040489 Ga0070681_110404892 118
220 3300005468 Ga0070707_100125055 Ga0070707_1001250552 118
221 3300005471 Ga0070698_100462099 Ga0070698_1004620992 118
222 3300005530 Ga0070679_100386524 Ga0070679_1003865242 118
223 3300005536 Ga0070697_100017721 Ga0070697_1000177217 118
224 3300005536 Ga0070697_100338687 Ga0070697_1003386872 118
225 3300005539 Ga0068853_100012194 Ga0068853_1000121943 118
226 3300005539 Ga0068853_100099279 Ga0068853_1000992793 118
227 3300005539 Ga0068853_100154302 Ga0068853_1001543021 118
228 3300005563 Ga0068855_100071950 Ga0068855_1000719504 118
229 3300005563 Ga0068855_100280285 Ga0068855_1002802852 118
230 3300005563 Ga0068855_100563817 Ga0068855_1005638172 118
231 3300005563 Ga0068855_101053460 Ga0068855_1010534602 118
232 3300005577 Ga0068857_100002027 Ga0068857_10000202714 118
233 3300005577 Ga0068857_100072557 Ga0068857_1000725573 118
234 3300005577 Ga0068857_100597033 Ga0068857_1005970331 118
235 3300005577 Ga0068857_100817021 Ga0068857_1008170212 118
236 3300005578 Ga0068854_100001896 Ga0068854_1000018963 118
237 3300005578 Ga0068854_100029564 Ga0068854_1000295643 118
238 3300005578 Ga0068854_100248525 Ga0068854_1002485252 118
239 3300005578 Ga0068854_100494375 Ga0068854_1004943752 118
240 3300005614 Ga0068856_100021205 Ga0068856_1000212052 118
241 3300005614 Ga0068856_100094253 Ga0068856_1000942533 118
242 3300005614 Ga0068856_100610604 Ga0068856_1006106042 118
243 3300005616 Ga0068852_100005230 Ga0068852_1000052305 118
244 3300005616 Ga0068852_100038827 Ga0068852_1000388277 118
245 3300005616 Ga0068852_100051668 Ga0068852_1000516682 118
246 3300005617 Ga0068859_100365398 Ga0068859_1003653982 118
247 3300005618 Ga0068864_101375440 Ga0068864_1013754401 118
248 3300005834 Ga0068851_10019679 Ga0068851_100196793 118
249 3300005834 Ga0068851_10149606 Ga0068851_101496061 118
250 3300005834 Ga0068851_10352878 Ga0068851_103528781 118
251 3300005834 Ga0068851_10675386 Ga0068851_106753862 118
252 3300005844 Ga0068862_101352993 Ga0068862_1013529932 118
253 3300005983 Ga0081540_1083789 Ga0081540_10837892 118
254 3300006028 Ga0070717_10002657 Ga0070717_100026572 118
255 3300006028 Ga0070717_11716327 Ga0070717_117163271 118
256 3300006038 Ga0075365_10089353 Ga0075365_100893532 118
257 3300006048 Ga0075363_100013029 Ga0075363_1000130294 118
258 3300006173 Ga0070716_100413408 Ga0070716_1004134082 118
259 3300006173 Ga0070716_101358774 Ga0070716_1013587742 118
260 3300006175 Ga0070712_100257105 Ga0070712_1002571052 118
261 3300006178 Ga0075367_10101753 Ga0075367_101017532 118
262 3300006186 Ga0075369_10053139 Ga0075369_100531392 118
263 3300006195 Ga0075366_10001415 Ga0075366_100014154 118
264 3300006353 Ga0075370_10044518 Ga0075370_100445184 118
265 3300006871 Ga0075434_100007911 Ga0075434_1000079114 118
266 3300006931 Ga0097620_100365390 Ga0097620_1003653902 118
267 3300006943 Ga0099822_1000677 Ga0099822_10006774 118
268 3300007265 Ga0099794_10048045 Ga0099794_100480452 118
269 3300007788 Ga0099795_10000591 Ga0099795_100005919 118
270 3300007788 Ga0099795_10017104 Ga0099795_100171043 118
271 3300007788 Ga0099795_10202377 Ga0099795_102023772 118
272 3300009093 Ga0105240_10006632 Ga0105240_100066322 118
273 3300009093 Ga0105240_10009482 Ga0105240_1000948218 118
274 3300009093 Ga0105240_10011767 Ga0105240_100117672 118
275 3300009093 Ga0105240_10058977 Ga0105240_100589774 118
276 3300009093 Ga0105240_10157036 Ga0105240_101570364 118
277 3300009093 Ga0105240_10185381 Ga0105240_101853813 118
278 3300009174 Ga0105241_10001043 Ga0105241_1000104310 118
279 3300009545 Ga0105237_10101619 Ga0105237_101016194 118
280 3300009545 Ga0105237_10163834 Ga0105237_101638342 118
281 3300009551 Ga0105238_10027445 Ga0105238_100274454 118
282 3300009551 Ga0105238_10080474 Ga0105238_100804743 118
283 3300010159 Ga0099796_10005279 Ga0099796_100052793 118
284 3300010375 Ga0105239_10090548 Ga0105239_100905482 118
285 3300010375 Ga0105239_10137961 Ga0105239_101379612 118
286 3300013104 Ga0157370_10898715 Ga0157370_108987152 118
287 3300013105 Ga0157369_10002440 Ga0157369_1000244012 118
288 3300013306 Ga0163162_11959506 Ga0163162_119595062 118
289 3300013307 Ga0157372_10065649 Ga0157372_100656495 118
290 3300017792 Ga0163161_11150237 Ga0163161_111502371 118
291 3300020070 Ga0206356_10921192 Ga0206356_109211921 118
292 3300020081 Ga0206354_11155827 Ga0206354_111558271 118
293 3300021358 Ga0213873_10026525 Ga0213873_100265252 118
294 3300025253 Ga0209677_100984 Ga0209677_1009849 118
295 3300025272 Ga0209455_1004408 Ga0209455_10044085 118
296 3300025297 Ga0209758_1005279 Ga0209758_10052796 118
297 3300025297 Ga0209758_1118724 Ga0209758_11187242 118
298 3300025304 Ga0209257_1017460 Ga0209257_10174602 118
299 3300025321 Ga0207656_10071944 Ga0207656_100719442 118
300 3300025321 Ga0207656_10256457 Ga0207656_102564572 118
301 3300025900 Ga0207710_10293984 Ga0207710_102939842 118
302 3300025904 Ga0207647_10000668 Ga0207647_1000066811 118
303 3300025904 Ga0207647_10147576 Ga0207647_101475762 118
304 3300025906 Ga0207699_10160901 Ga0207699_101609012 118
305 3300025906 Ga0207699_10217565 Ga0207699_102175652 118
306 3300025911 Ga0207654_10000654 Ga0207654_100006549 118
307 3300025911 Ga0207654_10065872 Ga0207654_100658721 118
308 3300025912 Ga0207707_11492412 Ga0207707_114924122 118
309 3300025913 Ga0207695_10001204 Ga0207695_1000120415 118
310 3300025913 Ga0207695_10028122 Ga0207695_100281226 118
311 3300025913 Ga0207695_10079056 Ga0207695_100790562 118
312 3300025913 Ga0207695_10382081 Ga0207695_103820812 118
313 3300025913 Ga0207695_10636176 Ga0207695_106361762 118
314 3300025913 Ga0207695_11643125 Ga0207695_116431251 118
315 3300025914 Ga0207671_10150688 Ga0207671_101506882 118
316 3300025914 Ga0207671_10215998 Ga0207671_102159982 118
317 3300025914 Ga0207671_10404550 Ga0207671_104045502 118
318 3300025915 Ga0207693_10322536 Ga0207693_103225362 118
319 3300025916 Ga0207663_10111490 Ga0207663_101114903 118
320 3300025917 Ga0207660_10141926 Ga0207660_101419262 118
321 3300025917 Ga0207660_10357769 Ga0207660_103577692 118
322 3300025921 Ga0207652_10036740 Ga0207652_100367404 118
323 3300025922 Ga0207646_10230579 Ga0207646_102305792 118
324 3300025924 Ga0207694_10000270 Ga0207694_1000027030 118
325 3300025924 Ga0207694_10040563 Ga0207694_100405633 118
326 3300025928 Ga0207700_10004236 Ga0207700_100042369 118
327 3300025929 Ga0207664_10626312 Ga0207664_106263122 118
328 3300025929 Ga0207664_11905263 Ga0207664_119052631 118
329 3300025931 Ga0207644_10170836 Ga0207644_101708362 118
330 3300025932 Ga0207690_11428166 Ga0207690_114281662 118
331 3300025932 Ga0207690_11588884 Ga0207690_115888841 118
332 3300025933 Ga0207706_10188333 Ga0207706_101883332 118
333 3300025935 Ga0207709_10645793 Ga0207709_106457932 118
334 3300025939 Ga0207665_10664972 Ga0207665_106649722 118
335 3300025940 Ga0207691_10817079 Ga0207691_108170791 118
336 3300025941 Ga0207711_10255653 Ga0207711_102556532 118
337 3300025944 Ga0207661_10007575 Ga0207661_100075758 118
338 3300025944 Ga0207661_10520127 Ga0207661_105201272 118
339 3300025949 Ga0207667_10066639 Ga0207667_100666393 118
340 3300025949 Ga0207667_10066849 Ga0207667_100668493 118
341 3300025949 Ga0207667_10916219 Ga0207667_109162192 118
342 3300025960 Ga0207651_11055754 Ga0207651_110557542 118
343 3300025972 Ga0207668_10091795 Ga0207668_100917952 118
344 3300025972 Ga0207668_10412237 Ga0207668_104122372 118
345 3300025981 Ga0207640_10023983 Ga0207640_100239833 118
346 3300025986 Ga0207658_10144596 Ga0207658_101445962 118
347 3300026041 Ga0207639_10037736 Ga0207639_100377362 118
348 3300026041 Ga0207639_10125070 Ga0207639_101250703 118
349 3300026067 Ga0207678_10164638 Ga0207678_101646383 118
350 3300026078 Ga0207702_10000379 Ga0207702_1000037932 118
351 3300026078 Ga0207702_10122825 Ga0207702_101228253 118
352 3300026078 Ga0207702_10180931 Ga0207702_101809313 118
353 3300026078 Ga0207702_11522437 Ga0207702_115224372 118
354 3300026095 Ga0207676_11144722 Ga0207676_111447222 118
355 3300026116 Ga0207674_10004705 Ga0207674_100047056 118
356 3300026116 Ga0207674_10008086 Ga0207674_100080864 118
357 3300026116 Ga0207674_10488239 Ga0207674_104882392 118
358 3300026116 Ga0207674_11865029 Ga0207674_118650291 118
359 3300026142 Ga0207698_10216766 Ga0207698_102167662 118
360 3300026142 Ga0207698_10448726 Ga0207698_104487262 118
361 3300027357 Ga0209589_1000006 Ga0209589_1000006257 118
362 3300027361 Ga0209489_100007 Ga0209489_100007257 118
363 3300027363 Ga0209700_100008 Ga0209700_100008257 118
364 3300027512 Ga0209179_1001099 Ga0209179_10010993 118
365 3300027512 Ga0209179_1015480 Ga0209179_10154802 118
366 3300028786 Ga0307517_10295151 Ga0307517_102951512 118
367 3300031241 Ga0265325_10012511 Ga0265325_100125115 118
368 3300031249 Ga0265339_10119797 Ga0265339_101197972 118
369 3300031250 Ga0265331_10048630 Ga0265331_100486303 118
370 3300031344 Ga0265316_10102746 Ga0265316_101027462 118
371 3300031616 Ga0307508_10000038 Ga0307508_1000003823 118
372 3300031711 Ga0265314_10097582 Ga0265314_100975822 118
373 3300031712 Ga0265342_10034628 Ga0265342_100346284 118
374 3300035086 Ga0373934_0050445 Ga0373934_0050445_717_1073 118
375 3300035111 Ga0373923_0410119 Ga0373923_0410119_208_564 118
376 3300035113 Ga0373936_0085607 Ga0373936_0085607_879_1235 118
377 3300035116 Ga0373945_0016555 Ga0373945_0016555_1554_1910 118
378 3300035117 Ga0373953_0021092 Ga0373953_0021092_1596_1952 118
379 3300035117 Ga0373953_0112733 Ga0373953_0112733_335_691 118
380 3300035118 Ga0373954_0045080 Ga0373954_0045080_250_606 118
381 3300035118 Ga0373954_0462095 Ga0373954_0462095_255_611 118
382 3300035119 Ga0373956_0024144 Ga0373956_0024144_877_1233 118
383 3300035119 Ga0373956_0091823 Ga0373956_0091823_373_729 118
384 3300035170 Ga0373943_0020410 Ga0373943_0020410_2469_2825 118
385 3300035172 Ga0373955_0116169 Ga0373955_0116169_1143_1499 118
386 3300035172 Ga0373955_0169279 Ga0373955_0169279_840_1196 118
387 3300035410 Ga0373924_0093149 Ga0373924_0093149_687_1043 118
388 3300035410 Ga0373924_0241886 Ga0373924_0241886_73_429 118
389 3300035692 Ga0373935_0016609 Ga0373935_0016609_2329_2685 118
390 3300035724 Ga0373933_0001661 Ga0373933_0001661_300_656 118
391 3300035724 Ga0373933_0095996 Ga0373933_0095996_606_962 118
392 3300035725 Ga0373947_0074635 Ga0373947_0074635_1514_1870 118
393 3300036401 Ga0373937_0059371 Ga0373937_0059371_2904_3260 118
394 3300036401 Ga0373937_0169299 Ga0373937_0169299_1444_1800 118
395 3300037068 Ga0373925_0007203 Ga0373925_0007203_3166_3522 118
396 3300037068 Ga0373925_1266110 Ga0373925_1266110_229_585 118
397 3300037312 Ga0395899_0056671 Ga0395899_0056671_707_1063 118
398 3300037418 Ga0395900_0253020 Ga0395900_0253020_1168_1524 118
399 3300037466 Ga0395898_0478877 Ga0395898_0478877_722_1078 118
400 3300037466 Ga0395898_1815455 Ga0395898_1815455_128_484 118
401 3300037853 Ga0436364_0961545 Ga0436364_0961545_251_607 118
402 3300038443 Ga0395901_0058896 Ga0395901_0058896_846_1202 118
403 3300039437 Ga0436365_1073059 Ga0436365_1073059_701_1057 118
404 3300039438 Ga0436360_0534705 Ga0436360_0534705_852_1208 118
405 3300039447 Ga0436361_0563314 Ga0436361_0563314_1778_2134 118
406 3300039447 Ga0436361_0997442 Ga0436361_0997442_3787_4143 118
407 3300039450 Ga0436363_0108701 Ga0436363_0108701_190_546 118
408 3300039453 Ga0436362_0515042 Ga0436362_0515042_2286_2642 118
409 3300044684 Ga0466966_0036888 Ga0466966_0036888_1816_2172 118
410 3300044735 Ga0466968_0077209 Ga0466968_0077209_739_1095 118
411 3300044765 Ga0466970_0099750 Ga0466970_0099750_1140_1496 118
412 3300044842 Ga0466957_0313408 Ga0466957_0313408_97_453 118
413 3300044842 Ga0466957_0506702 Ga0466957_0506702_402_758 118
414 3300045049 Ga0466959_0095107 Ga0466959_0095107_15_371 118
415 3300046454 Ga0495592_0103365 Ga0495592_0103365_1366_1722 118
416 3300046455 Ga0495603_0082745 Ga0495603_0082745_316_672 118
417 3300046455 Ga0495603_0385601 Ga0495603_0385601_351_707 118
418 3300046459 Ga0495629_0126231 Ga0495629_0126231_1206_1562 118
419 3300046459 Ga0495629_0187570 Ga0495629_0187570_946_1302 118
420 3300046462 Ga0495651_0061969 Ga0495651_0061969_2050_2406 118
421 3300046463 Ga0495653_0283746 Ga0495653_0283746_126_482 118
422 3300046472 Ga0495580_0125475 Ga0495580_0125475_298_654 118
423 3300046473 Ga0495582_0013252 Ga0495582_0013252_2488_2844 118
424 3300046476 Ga0495662_0199730 Ga0495662_0199730_11_367 118
425 3300046477 Ga0495664_0005508 Ga0495664_0005508_72_428 118
426 3300046477 Ga0495664_0145031 Ga0495664_0145031_649_1005 118
427 3300046477 Ga0495664_0253541 Ga0495664_0253541_424_780 118
428 3300046499 Ga0495594_0109915 Ga0495594_0109915_229_585 118
429 3300046511 Ga0495608_0129551 Ga0495608_0129551_1200_1556 118
430 3300046511 Ga0495608_0398963 Ga0495608_0398963_263_619 118
431 3300046514 Ga0495618_0010704 Ga0495618_0010704_2469_2825 118
432 3300046514 Ga0495618_0056268 Ga0495618_0056268_1316_1672 118
433 3300046516 Ga0495628_0359325 Ga0495628_0359325_221_577 118
434 3300046517 Ga0495630_0065783 Ga0495630_0065783_2096_2452 118
435 3300046517 Ga0495630_0074507 Ga0495630_0074507_150_506 118
436 3300046526 Ga0495666_0039086 Ga0495666_0039086_1662_2018 118
437 3300046529 Ga0495652_0881388 Ga0495652_0881388_197_553 118
438 3300046531 Ga0495665_0010170 Ga0495665_0010170_3189_3545 118
439 3300046533 Ga0495640_0056016 Ga0495640_0056016_668_1024 118
440 3300046535 Ga0495586_0469523 Ga0495586_0469523_137_493 118
441 3300046536 Ga0495587_0037222 Ga0495587_0037222_1105_1461 118
442 3300046543 Ga0495645_0138193 Ga0495645_0138193_751_1107 118
443 3300046543 Ga0495645_0210478 Ga0495645_0210478_387_743 118
444 3300046559 Ga0495667_0238206 Ga0495667_0238206_260_616 118
445 3300046559 Ga0495667_0352743 Ga0495667_0352743_556_912 118
446 3300046642 Ga0495634_0062162 Ga0495634_0062162_664_1020 118
447 3300046642 Ga0495634_0275343 Ga0495634_0275343_511_867 118
448 3300046663 Ga0495635_0046233 Ga0495635_0046233_1466_1822 118
449 3300046663 Ga0495635_0187594 Ga0495635_0187594_551_907 118
450 3300046675 Ga0495657_0044062 Ga0495657_0044062_2097_2453 118
451 3300046678 Ga0495599_0298892 Ga0495599_0298892_439_795 118
452 3300046678 Ga0495599_0360007 Ga0495599_0360007_260_616 118
453 3300046679 Ga0495623_0112169 Ga0495623_0112169_861_1217 118
454 3300046680 Ga0495646_0083409 Ga0495646_0083409_243_599 118
455 3300046680 Ga0495646_0280660 Ga0495646_0280660_248_604 118
456 3300046689 Ga0495613_0097906 Ga0495613_0097906_1397_1753 118
457 3300046689 Ga0495613_0323574 Ga0495613_0323574_17_373 118
458 3300046690 Ga0495624_0048532 Ga0495624_0048532_1510_1866 118
459 3300046690 Ga0495624_0117561 Ga0495624_0117561_561_917 118
460 3300046809 Ga0495600_0117662 Ga0495600_0117662_361_717 118
461 3300047315 Ga0495581_0325660 Ga0495581_0325660_288_644 118
462 3300047317 Ga0495604_0052500 Ga0495604_0052500_1516_1872 118
463 3300047317 Ga0495604_0482541 Ga0495604_0482541_23_379 118
464 3300047319 Ga0495674_0023503 Ga0495674_0023503_4813_5169 118
465 3300047319 Ga0495674_0247848 Ga0495674_0247848_405_761 118
466 3300047319 Ga0495674_1148908 Ga0495674_1148908_33_389 118
467 3300047321 Ga0495676_0313523 Ga0495676_0313523_396_752 118
468 3300047322 Ga0495680_0207310 Ga0495680_0207310_230_586 118
469 3300047444 Ga0495675_0185588 Ga0495675_0185588_297_653 118
470 3300047444 Ga0495675_0327105 Ga0495675_0327105_289_645 118
471 3300047469 Ga0495673_0058853 Ga0495673_0058853_1024_1380 118
472 3300047471 Ga0495684_0006232 Ga0495684_0006232_6180_6536 118
473 3300047471 Ga0495684_0043020 Ga0495684_0043020_945_1301 118
474 3300047673 Ga0495593_0152105 Ga0495593_0152105_204_560 118
475 3300048088 Ga0495602_0116283 Ga0495602_0116283_1232_1588 118
476 3300048088 Ga0495602_0817577 Ga0495602_0817577_53_409 118
477 3300048909 Ga0496106_0375796 Ga0496106_0375796_366_722 118
478 3300048914 Ga0496111_0144857 Ga0496111_0144857_273_629 118
479 3300050512 nmdc:mga0n895_56570_c1 nmdc:mga0n895_56570_c1_2069_2425 118
480 3300053077 Ga0495601_0015786 Ga0495601_0015786_3664_4020 118
481 3300053077 Ga0495601_0302111 Ga0495601_0302111_56_412 118
482 3300053077 Ga0495601_0755804 Ga0495601_0755804_180_536 118
483 3300053078 Ga0495612_0070799 Ga0495612_0070799_553_909 118
484 3300053078 Ga0495612_0190132 Ga0495612_0190132_142_498 118
485 3300053084 Ga0495595_0285777 Ga0495595_0285777_435_791 118
486 3300053085 Ga0495619_0086509 Ga0495619_0086509_274_630 118
487 3300053085 Ga0495619_0663761 Ga0495619_0663761_173_529 118
488 3300061719 Ga0466962_0221056 Ga0466962_0221056_54_410 118
489 iso_pu_bacteria 2524023205 2524436600 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04234

CopC

CopC domain

23

103

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5icu-assembly1.cif.gz_A the crystal structure of copc from methylosinus trichosporium ob3b 0.8966 35 118
3bcf-assembly1.cif.gz_A alpha-amylase b from halothermothrix orenii 0.862 37 117
2c9r-assembly1.cif.gz_A apo-h91f copc 0.857 34 116
6nfq-assembly1.cif.gz_A copc from pseudomonas fluorescens 0.8457 34 116
7bk7-assembly2.cif.gz_BBB pfcopc mutant - d83n 0.8457 37 116
ID Description Score Start End Superfamily
af_P0AA57_27_124_2.60.40.1220 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9066 35 116 2.60.40.1220
5icuA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8966 35 118 2.60.40.1220
3bcfA01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.862 37 117 2.60.40.1220
2c9rA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.857 34 116 2.60.40.1220
6nfsA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8323 34 118 2.60.40.1220
ID Description Score Start End GO Terms
AF-A0A2I2L100-F1-model_v4 CopC domain-containing protein 0.9778 35 117 GO:0005507
GO:0005886
GO:0006825
GO:0030313
GO:0042597
GO:0046688
AF-A0A238DSQ0-F1-model_v4 CopC domain-containing protein 0.9767 37 118 GO:0005507
GO:0005886
GO:0006825
GO:0030313
GO:0042597
GO:0046688
AF-A0A846R5Y5-F1-model_v4 deleted 0.9745 35 118
AF-A0A2W0BHV7-F1-model_v4 Copper resistance protein CopC 0.9731 37 118 GO:0005507
GO:0005886
GO:0006825
GO:0030313
GO:0042597
GO:0046688
AF-A0A2U8W9D7-F1-model_v4 Copper resistance protein CopC 0.9706 35 118 GO:0005507
GO:0005886
GO:0006825
GO:0042597
GO:0046688

Feature Viewer

pLDDT pTM Quality
82.86 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map