F453776

General Info

Members Datasets Scaffolds Average Seq Length
489 294 488 196

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10468209|Ga0105239_104682093
Length 232
Sequence MAEDEKPAKAPKGGGDKAAKGQKGGPVARTPRPKDYKPRMKTHYEKVVRDEMAKQFGYENAMQIPRIEKVVLNMGVGEAVNDRKKVDAAAKDLAMIAGQRAVITRARKSVATYKVRDGMAIGCKVTLRGDRMYEFVDRLVTIALPRVKDFRGLNPKSFDGRGNFAMGLKEHIIFPEIDYDQVDQVRGLDIAITTTAHTDAEAFTLLDALGLPFARDGRPRQYESLRTDPVAA

Samples

Sample ID Description Type Environment
1 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.43
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 9.82
Rhizosphere 87.73
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10116086 3300001990 Bacteria 791
2 JGI25406J46586_10005035 3300003203 Bacteria 6138
3 Ga0065707_10160590 3300005295 Bacteria 1567
4 Ga0070676_10123132 3300005328 Bacteria 1630
5 Ga0070676_10238747 3300005328 Bacteria 1208
6 Ga0070670_100096525 3300005331 Bacteria 2543
7 Ga0068869_100310784 3300005334 Bacteria 1276
8 Ga0070680_100067827 3300005336 Bacteria 2927
9 Ga0070680_100400571 3300005336 Bacteria 1170
10 Ga0070682_100010869 3300005337 Bacteria 5182
11 Ga0068868_100005144 3300005338 Bacteria 9183
12 Ga0068868_100503975 3300005338 Bacteria 1061
13 Ga0070660_100003497 3300005339 Bacteria 10822
14 Ga0070660_100410266 3300005339 Bacteria 1121
15 Ga0070689_100058352 3300005340 Bacteria 2997
16 Ga0070689_100082449 3300005340 Bacteria 2526
17 Ga0070691_10024838 3300005341 Bacteria 2787
18 Ga0070687_100023941 3300005343 Bacteria 2908
19 Ga0070687_100048728 3300005343 Bacteria 2180
20 Ga0070687_100172134 3300005343 Bacteria 1290
21 Ga0070661_100326156 3300005344 Bacteria 1200
22 Ga0070669_100292684 3300005353 Bacteria 1308
23 Ga0070675_100055442 3300005354 Bacteria 3263
24 Ga0070671_100097555 3300005355 Bacteria 2465
25 Ga0070674_100622657 3300005356 Bacteria 914
26 Ga0070673_100088256 3300005364 Bacteria 2529
27 Ga0070688_100033916 3300005365 Bacteria 3088
28 Ga0070688_100250109 3300005365 Bacteria 1262
29 Ga0070659_100048566 3300005366 Bacteria 3334
30 Ga0070659_100089084 3300005366 Bacteria 2472
31 Ga0070659_100357061 3300005366 Bacteria 1227
32 Ga0070703_10000995 3300005406 Bacteria 8913
33 Ga0070709_10204644 3300005434 Bacteria 1400
34 Ga0070709_10693788 3300005434 Bacteria 792
35 Ga0070710_10234272 3300005437 Bacteria 1173
36 Ga0070701_10224178 3300005438 Bacteria 1123
37 Ga0070701_10230474 3300005438 Bacteria 1109
38 Ga0070711_100074674 3300005439 Bacteria 2398
39 Ga0070711_100415429 3300005439 Bacteria 1095
40 Ga0070705_100000459 3300005440 Bacteria 23431
41 Ga0070705_100017093 3300005440 Bacteria 3781
42 Ga0070700_100007227 3300005441 Bacteria 5984
43 Ga0070700_100094571 3300005441 Bacteria 1957
44 Ga0070694_100017112 3300005444 Bacteria 4575
45 Ga0070694_100043715 3300005444 Bacteria 2997
46 Ga0070694_100153684 3300005444 Bacteria 1683
47 Ga0070694_100175445 3300005444 Bacteria 1582
48 Ga0070708_100012904 3300005445 Bacteria 6826
49 Ga0070663_100001615 3300005455 Bacteria 12447
50 Ga0070663_100200315 3300005455 Bacteria 1558
51 Ga0070663_100420126 3300005455 Bacteria 1096
52 Ga0070663_100631524 3300005455 Bacteria 904
53 Ga0070678_100095377 3300005456 Bacteria 2292
54 Ga0070662_100020737 3300005457 Bacteria 4481
55 Ga0070662_100080740 3300005457 Bacteria 2421
56 Ga0070662_100095107 3300005457 Bacteria 2245
57 Ga0070681_10128861 3300005458 Bacteria 2463
58 Ga0068867_100345181 3300005459 Bacteria 1241
59 Ga0070685_10023496 3300005466 Bacteria 3376
60 Ga0070707_101313060 3300005468 Bacteria 690
61 Ga0070699_100000540 3300005518 Bacteria 35757
62 Ga0070679_100081388 3300005530 Bacteria 3227
63 Ga0070697_100051940 3300005536 Bacteria 3331
64 Ga0070672_100098675 3300005543 Bacteria 2366
65 Ga0070686_100051630 3300005544 Bacteria 2618
66 Ga0070686_100147379 3300005544 Bacteria 1645
67 Ga0070695_100019831 3300005545 Bacteria 4100
68 Ga0070695_100036224 3300005545 Bacteria 3103
69 Ga0070696_100000156 3300005546 Bacteria 38002
70 Ga0070696_100311884 3300005546 Bacteria 1208
71 Ga0070693_100005222 3300005547 Bacteria 6214
72 Ga0070693_100025683 3300005547 Bacteria 3172
73 Ga0070665_100275712 3300005548 Bacteria 1684
74 Ga0070665_100572955 3300005548 Bacteria 1142
75 Ga0070704_100001256 3300005549 Bacteria 13362
76 Ga0070704_100091316 3300005549 Bacteria 2270
77 Ga0068855_100047827 3300005563 Bacteria 5052
78 Ga0070664_100419411 3300005564 Bacteria 1226
79 Ga0068857_100080349 3300005577 Bacteria 2911
80 Ga0068857_100399460 3300005577 Bacteria 1279
81 Ga0068857_101143717 3300005577 Bacteria 752
82 Ga0068854_100207540 3300005578 Bacteria 1544
83 Ga0068856_100032988 3300005614 Bacteria 5071
84 Ga0068856_100058414 3300005614 Bacteria 3809
85 Ga0068856_100512341 3300005614 Bacteria 1221
86 Ga0070702_100010103 3300005615 Bacteria 4639
87 Ga0070702_100025867 3300005615 Bacteria 3149
88 Ga0070702_100037683 3300005615 Bacteria 2686
89 Ga0070702_100775919 3300005615 Bacteria 739
90 Ga0068859_100006865 3300005617 Bacteria 11559
91 Ga0068859_100143429 3300005617 Bacteria 2462
92 Ga0068864_100012107 3300005618 Bacteria 7127
93 Ga0068864_100039730 3300005618 Bacteria 4021
94 Ga0068864_100082274 3300005618 Bacteria 2825
95 Ga0068866_10302262 3300005718 Bacteria 1000
96 Ga0068861_100224083 3300005719 Bacteria 1591
97 Ga0068858_100329172 3300005842 Bacteria 1461
98 Ga0068860_100006701 3300005843 Bacteria 11559
99 Ga0068860_100061069 3300005843 Bacteria 3581
100 Ga0068860_100170943 3300005843 Bacteria 2099
101 Ga0068860_100318695 3300005843 Bacteria 1526
102 Ga0068860_100385142 3300005843 Bacteria 1385
103 Ga0068862_100014559 3300005844 Bacteria 6530
104 Ga0068862_100538230 3300005844 Bacteria 1114
105 Ga0081538_10012937 3300005981 Bacteria 6648
106 Ga0081538_10018887 3300005981 Bacteria 5153
107 Ga0081539_10001787 3300005985 Bacteria 34104
108 Ga0070717_10333283 3300006028 Bacteria 1354
109 Ga0075365_10034476 3300006038 Bacteria 3269
110 Ga0075365_10432396 3300006038 Bacteria 929
111 Ga0075368_10011859 3300006042 Bacteria 3180
112 Ga0075363_100005506 3300006048 Bacteria 5643
113 Ga0070715_10002284 3300006163 Bacteria 5834
114 Ga0070716_100146687 3300006173 Bacteria 1512
115 Ga0070712_100088319 3300006175 Bacteria 2265
116 Ga0070712_100148350 3300006175 Bacteria 1798
117 Ga0075367_10026508 3300006178 Bacteria 3288
118 Ga0075366_10291344 3300006195 Bacteria 998
119 Ga0097621_100078215 3300006237 Bacteria 2748
120 Ga0097621_100516204 3300006237 Bacteria 1084
121 Ga0068871_100016147 3300006358 Bacteria 5612
122 Ga0075428_100086212 3300006844 Bacteria 3425
123 Ga0075428_100254576 3300006844 Bacteria 1891
124 Ga0075430_100012358 3300006846 Bacteria 7262
125 Ga0075430_100259078 3300006846 Bacteria 1441
126 Ga0075431_100117861 3300006847 Bacteria 2740
127 Ga0075433_10476306 3300006852 Bacteria 1100
128 Ga0075434_100007021 3300006871 Bacteria 10385
129 Ga0075434_100040672 3300006871 Bacteria 4604
130 Ga0075434_100098535 3300006871 Bacteria 2928
131 Ga0075429_100031579 3300006880 Bacteria 4602
132 Ga0075429_100347473 3300006880 Bacteria 1298
133 Ga0075429_100406313 3300006880 Bacteria 1193
134 Ga0068865_100047901 3300006881 Bacteria 2939
135 Ga0068865_100386590 3300006881 Bacteria 1143
136 Ga0068865_100702077 3300006881 Bacteria 864
137 Ga0097620_100006865 3300006931 Bacteria 11559
138 Ga0097620_100143436 3300006931 Bacteria 2462
139 Ga0075435_100011052 3300007076 Bacteria 6623
140 Ga0075435_100045094 3300007076 Bacteria 3533
141 Ga0075435_100328309 3300007076 Bacteria 1310
142 Ga0105250_10122928 3300009092 Bacteria 1068
143 Ga0105240_10411063 3300009093 Bacteria 1522
144 Ga0111539_10009902 3300009094 Bacteria 12026
145 Ga0111539_10069995 3300009094 Bacteria 4142
146 Ga0111539_10081775 3300009094 Bacteria 3799
147 Ga0111539_10140413 3300009094 Bacteria 2828
148 Ga0111539_10155061 3300009094 Bacteria 2680
149 Ga0111539_10438442 3300009094 Bacteria 1521
150 Ga0105245_10011993 3300009098 Bacteria 7535
151 Ga0105245_10051809 3300009098 Bacteria 3680
152 Ga0105245_10434120 3300009098 Bacteria 1319
153 Ga0105247_10133112 3300009101 Bacteria 1622
154 Ga0114129_10537942 3300009147 Bacteria 1521
155 Ga0114129_10584105 3300009147 Bacteria 1449
156 Ga0105243_10147736 3300009148 Bacteria 2013
157 Ga0105241_10133233 3300009174 Bacteria 2014
158 Ga0105248_10065805 3300009177 Bacteria 4070
159 Ga0105248_10100212 3300009177 Bacteria 3264
160 Ga0105248_10782251 3300009177 Bacteria 1077
161 Ga0105237_10133147 3300009545 Bacteria 2481
162 Ga0105238_10067131 3300009551 Bacteria 3588
163 Ga0105238_11720714 3300009551 Bacteria 658
164 Ga0105249_10014071 3300009553 Bacteria 7073
165 Ga0105249_10020972 3300009553 Bacteria 5846
166 Ga0105239_10350895 3300010375 Bacteria 1666
167 Ga0105239_10468209 3300010375 Bacteria 1431
168 Ga0105246_10017803 3300011119 Bacteria 4518
169 Ga0105246_10027178 3300011119 Bacteria 3746
170 Ga0105246_10036447 3300011119 Bacteria 3295
171 Ga0157371_10205916 3300013102 Bacteria 1411
172 Ga0157369_10155965 3300013105 Bacteria 2411
173 Ga0157369_10223079 3300013105 Bacteria 1972
174 Ga0157374_10066610 3300013296 Bacteria 3384
175 Ga0157374_10348888 3300013296 Bacteria 1470
176 Ga0157378_10036743 3300013297 Bacteria 4335
177 Ga0157378_10508505 3300013297 Bacteria 1204
178 Ga0163162_10159627 3300013306 Bacteria 2376
179 Ga0163162_10170234 3300013306 Bacteria 2303
180 Ga0163162_10368305 3300013306 Bacteria 1570
181 Ga0157372_10043850 3300013307 Bacteria 4955
182 Ga0157372_10189935 3300013307 Bacteria 2379
183 Ga0157375_10035178 3300013308 Bacteria 4779
184 Ga0157375_10225396 3300013308 Bacteria 2033
185 Ga0163163_10017289 3300014325 Bacteria 6723
186 Ga0163163_10338021 3300014325 Bacteria 1561
187 Ga0157380_10143061 3300014326 Bacteria 2057
188 Ga0157380_10549694 3300014326 Bacteria 1132
189 Ga0157377_10005570 3300014745 Bacteria 5930
190 Ga0157379_10036674 3300014968 Bacteria 4371
191 Ga0157376_10165906 3300014969 Bacteria 2006
192 Ga0207653_10000812 3300025885 Bacteria 10501
193 Ga0207692_10299329 3300025898 Bacteria 978
194 Ga0207710_10039519 3300025900 Bacteria 2088
195 Ga0207710_10383373 3300025900 Bacteria 720
196 Ga0207688_10003165 3300025901 Bacteria 8975
197 Ga0207688_10185719 3300025901 Bacteria 1241
198 Ga0207680_10139405 3300025903 Bacteria 1606
199 Ga0207647_10087669 3300025904 Bacteria 1859
200 Ga0207685_10036952 3300025905 Bacteria 1794
201 Ga0207645_10243643 3300025907 Bacteria 1188
202 Ga0207654_10115218 3300025911 Bacteria 1679
203 Ga0207654_10295085 3300025911 Bacteria 1101
204 Ga0207707_10037537 3300025912 Bacteria 4234
205 Ga0207695_10593310 3300025913 Bacteria 989
206 Ga0207693_10012090 3300025915 Bacteria 6979
207 Ga0207660_10009664 3300025917 Bacteria 6242
208 Ga0207660_10225922 3300025917 Bacteria 1471
209 Ga0207662_10034770 3300025918 Bacteria 2941
210 Ga0207662_10065552 3300025918 Bacteria 2187
211 Ga0207657_10001826 3300025919 Bacteria 22969
212 Ga0207657_10057557 3300025919 Bacteria 3350
213 Ga0207652_10201191 3300025921 Bacteria 1792
214 Ga0207694_10140636 3300025924 Bacteria 1941
215 Ga0207687_10000332 3300025927 Bacteria 31692
216 Ga0207687_10017439 3300025927 Bacteria 4728
217 Ga0207687_10092834 3300025927 Bacteria 2205
218 Ga0207687_10522099 3300025927 Bacteria 993
219 Ga0207644_10138232 3300025931 Bacteria 1873
220 Ga0207690_10009696 3300025932 Bacteria 5719
221 Ga0207706_10061710 3300025933 Bacteria 3301
222 Ga0207706_10716442 3300025933 Bacteria 854
223 Ga0207686_10033231 3300025934 Bacteria 3077
224 Ga0207709_10080214 3300025935 Bacteria 2101
225 Ga0207709_10133493 3300025935 Bacteria 1695
226 Ga0207669_10058444 3300025937 Bacteria 2353
227 Ga0207669_10291882 3300025937 Bacteria 1235
228 Ga0207704_10093897 3300025938 Bacteria 1979
229 Ga0207665_10006238 3300025939 Bacteria 7917
230 Ga0207691_10051899 3300025940 Bacteria 3747
231 Ga0207691_10142226 3300025940 Bacteria 2114
232 Ga0207711_10035265 3300025941 Bacteria 4240
233 Ga0207689_10088909 3300025942 Bacteria 2537
234 Ga0207689_10436678 3300025942 Bacteria 1093
235 Ga0207661_10265016 3300025944 Bacteria 1531
236 Ga0207679_10417663 3300025945 Bacteria 1183
237 Ga0207667_10205855 3300025949 Bacteria 2017
238 Ga0207651_10229071 3300025960 Bacteria 1507
239 Ga0207712_10012990 3300025961 Bacteria 5333
240 Ga0207712_10203372 3300025961 Bacteria 1572
241 Ga0207640_10851979 3300025981 Bacteria 793
242 Ga0207677_10006465 3300026023 Bacteria 6435
243 Ga0207703_10180568 3300026035 Bacteria 1862
244 Ga0207703_10376783 3300026035 Bacteria 1312
245 Ga0207639_10038539 3300026041 Bacteria 3556
246 Ga0207639_11199436 3300026041 Bacteria 712
247 Ga0207678_10001998 3300026067 Bacteria 18570
248 Ga0207678_10108230 3300026067 Bacteria 2371
249 Ga0207678_10118309 3300026067 Bacteria 2261
250 Ga0207678_10696064 3300026067 Bacteria 894
251 Ga0207708_10001023 3300026075 Bacteria 20938
252 Ga0207708_10060144 3300026075 Bacteria 2900
253 Ga0207708_10081269 3300026075 Bacteria 2491
254 Ga0207708_10192104 3300026075 Bacteria 1626
255 Ga0207702_10046943 3300026078 Bacteria 3638
256 Ga0207702_10229736 3300026078 Bacteria 1733
257 Ga0207648_10159945 3300026089 Bacteria 1989
258 Ga0207648_10326962 3300026089 Bacteria 1379
259 Ga0207648_10355622 3300026089 Bacteria 1321
260 Ga0207648_10537528 3300026089 Bacteria 1072
261 Ga0207676_10013834 3300026095 Bacteria 5792
262 Ga0207676_10170380 3300026095 Bacteria 1896
263 Ga0207674_10085949 3300026116 Bacteria 3140
264 Ga0207674_10494041 3300026116 Bacteria 1182
265 Ga0207675_100332673 3300026118 Bacteria 1485
266 Ga0207683_10042517 3300026121 Bacteria 3969
267 Ga0207683_10096185 3300026121 Bacteria 2641
268 Ga0207698_10121917 3300026142 Bacteria 2209
269 Ga0207698_11255441 3300026142 Bacteria 755
270 Ga0209813_10003980 3300027866 Bacteria 3502
271 Ga0207428_10030750 3300027907 Bacteria 4437
272 Ga0268266_10340818 3300028379 Bacteria 1407
273 Ga0268265_10004169 3300028380 Bacteria 10121
274 Ga0268265_10035663 3300028380 Bacteria 3637
275 Ga0268265_10846940 3300028380 Bacteria 894
276 Ga0268264_10005719 3300028381 Bacteria 10538
277 Ga0268264_10111100 3300028381 Bacteria 2401
278 Ga0268264_10201802 3300028381 Bacteria 1820
279 Ga0307408_100656320 3300031548 Bacteria 938
280 Ga0307405_10033428 3300031731 Bacteria 3050
281 Ga0307405_10252139 3300031731 Bacteria 1314
282 Ga0307405_10436600 3300031731 Bacteria 1034
283 Ga0307413_10068491 3300031824 Bacteria 2223
284 Ga0307413_10082713 3300031824 Bacteria 2063
285 Ga0307410_10044469 3300031852 Bacteria 2950
286 Ga0307410_10351325 3300031852 Bacteria 1178
287 Ga0307406_10139417 3300031901 Bacteria 1714
288 Ga0307406_10159532 3300031901 Bacteria 1619
289 Ga0307407_10039964 3300031903 Bacteria 2612
290 Ga0307407_10237293 3300031903 Bacteria 1242
291 Ga0307407_10388678 3300031903 Bacteria 998
292 Ga0307412_10030283 3300031911 Bacteria 3406
293 Ga0307409_100128659 3300031995 Bacteria 2159
294 Ga0307409_100179831 3300031995 Bacteria 1871
295 Ga0307409_100440130 3300031995 Bacteria 1255
296 Ga0307416_100028261 3300032002 Bacteria 4167
297 Ga0307416_100111845 3300032002 Bacteria 2409
298 Ga0307411_10047285 3300032005 Bacteria 2781
299 Ga0307415_100043477 3300032126 Bacteria 2997
300 Ga0307415_100069318 3300032126 Bacteria 2472
301 Ga0307415_100103043 3300032126 Bacteria 2098
302 Ga0373930_0084775 3300034816 Bacteria 737
303 Ga0373934_0016127 3300035086 Bacteria 2838
304 Ga0373936_0019812 3300035113 Bacteria 2609
305 Ga0373945_0004207 3300035116 Bacteria 4563
306 Ga0373954_0049735 3300035118 Bacteria 1966
307 Ga0373956_0020417 3300035119 Bacteria 2819
308 Ga0373943_0027652 3300035170 Bacteria 2666
309 Ga0373946_0244424 3300035171 Bacteria 873
310 Ga0373924_0015173 3300035410 Bacteria 2923
311 Ga0373927_0022164 3300035695 Bacteria 4161
312 Ga0373927_0601955 3300035695 Bacteria 727
313 Ga0373933_0088360 3300035724 Bacteria 1909
314 Ga0373933_0161970 3300035724 Bacteria 1421
315 Ga0373947_0109114 3300035725 Bacteria 1747
316 Ga0373947_0280011 3300035725 Bacteria 1108
317 Ga0373937_0045561 3300036401 Bacteria 4008
318 Ga0395898_1411627 3300037466 Bacteria 624
319 Ga0436365_0804265 3300039437 Bacteria 1575
320 Ga0439465_0013112 3300041413 Bacteria 2588
321 Ga0451802_0661664 3300041460 Bacteria 1295
322 Ga0453684_0241939 3300044712 Bacteria 2077
323 Ga0466957_0068004 3300044842 Bacteria 2198
324 Ga0466957_0382002 3300044842 Bacteria 961
325 Ga0466967_0299080 3300045976 Bacteria 1548
326 Ga0466967_0747498 3300045976 Bacteria 970
327 Ga0495603_0296592 3300046455 Bacteria 928
328 Ga0495629_0253828 3300046459 Bacteria 1209
329 Ga0495641_0030173 3300046461 Bacteria 2603
330 Ga0495651_0333669 3300046462 Bacteria 1007
331 Ga0495653_0029693 3300046463 Bacteria 4360
332 Ga0495650_0042254 3300046471 Bacteria 1942
333 Ga0495580_0022805 3300046472 Bacteria 4602
334 Ga0495582_0004746 3300046473 Bacteria 7640
335 Ga0495639_0014777 3300046475 Bacteria 3382
336 Ga0495662_0007474 3300046476 Bacteria 5403
337 Ga0495664_0236745 3300046477 Bacteria 1104
338 Ga0495594_0276695 3300046499 Bacteria 956
339 Ga0495608_0043315 3300046511 Bacteria 3007
340 Ga0495618_0111156 3300046514 Bacteria 1754
341 Ga0495666_0022628 3300046526 Bacteria 3112
342 Ga0495642_0006927 3300046528 Bacteria 4348
343 Ga0495652_0416605 3300046529 Bacteria 947
344 Ga0495665_0218900 3300046531 Bacteria 984
345 Ga0495640_0024081 3300046533 Bacteria 4429
346 Ga0495640_0238935 3300046533 Bacteria 1141
347 Ga0495586_0041894 3300046535 Bacteria 2466
348 Ga0495645_0643221 3300046543 Bacteria 648
349 Ga0495622_0291977 3300046557 Bacteria 711
350 Ga0495667_0039119 3300046559 Bacteria 3155
351 Ga0495634_0028786 3300046642 Bacteria 3852
352 Ga0495635_0390195 3300046663 Bacteria 926
353 Ga0495659_0093599 3300046664 Bacteria 1156
354 Ga0495657_0003110 3300046675 Bacteria 13700
355 Ga0495623_0030296 3300046679 Bacteria 3480
356 Ga0495647_0003117 3300046681 Bacteria 5301
357 Ga0495658_0001182 3300046683 Bacteria 13746
358 Ga0495613_0043476 3300046689 Bacteria 3323
359 Ga0495624_0287930 3300046690 Bacteria 991
360 Ga0495600_0056406 3300046809 Bacteria 2566
361 Ga0495604_0047307 3300047317 Bacteria 3350
362 Ga0495674_0545248 3300047319 Bacteria 924
363 Ga0495680_0029124 3300047322 Bacteria 4523
364 Ga0495675_0014758 3300047444 Bacteria 4938
365 Ga0495685_024734 3300047447 Bacteria 2067
366 Ga0495593_0016327 3300047673 Bacteria 4189
367 Ga0495614_0024070 3300048089 Bacteria 2628
368 Ga0496100_0134066 3300048903 Bacteria 1748
369 Ga0496102_0002642 3300048905 Bacteria 15222
370 Ga0496102_0187944 3300048905 Bacteria 1947
371 Ga0496102_0251795 3300048905 Bacteria 1665
372 Ga0496103_0037187 3300048906 Bacteria 2982
373 Ga0496103_0058751 3300048906 Bacteria 2389
374 Ga0496104_0000216 3300048907 Bacteria 50674
375 Ga0496104_0177112 3300048907 Bacteria 2043
376 Ga0496105_0423591 3300048908 Bacteria 1054
377 Ga0496105_0454568 3300048908 Bacteria 1010
378 Ga0496105_0856483 3300048908 Bacteria 687
379 Ga0496106_0002278 3300048909 Bacteria 14316
380 Ga0496106_0050277 3300048909 Bacteria 3141
381 Ga0496107_0013153 3300048910 Bacteria 5782
382 Ga0496107_0058400 3300048910 Bacteria 2789
383 Ga0496107_0510283 3300048910 Bacteria 892
384 Ga0496108_0000953 3300048911 Bacteria 22483
385 Ga0496108_0071526 3300048911 Bacteria 2927
386 Ga0496108_0214697 3300048911 Bacteria 1670
387 Ga0496108_0509098 3300048911 Bacteria 1051
388 Ga0496108_0819732 3300048911 Bacteria 802
389 Ga0496109_0003257 3300048912 Bacteria 13535
390 Ga0496109_0004775 3300048912 Bacteria 11319
391 Ga0496109_0087389 3300048912 Bacteria 2880
392 Ga0496109_0160935 3300048912 Bacteria 2103
393 Ga0496110_0003959 3300048913 Bacteria 11394
394 Ga0496110_0009986 3300048913 Bacteria 7700
395 Ga0496110_0131260 3300048913 Bacteria 2262
396 Ga0496110_0172016 3300048913 Bacteria 1965
397 Ga0496110_0379903 3300048913 Bacteria 1287
398 Ga0496110_1099129 3300048913 Bacteria 703
399 Ga0496111_0005234 3300048914 Bacteria 8270
400 Ga0496111_0044460 3300048914 Bacteria 3192
401 Ga0496111_0069285 3300048914 Bacteria 2565
402 Ga0496112_0008451 3300048915 Bacteria 9223
403 Ga0496112_0009188 3300048915 Bacteria 8882
404 Ga0496112_0143259 3300048915 Bacteria 2359
405 Ga0496113_0005548 3300048916 Bacteria 7881
406 Ga0496113_0007308 3300048916 Bacteria 7091
407 Ga0496113_0017877 3300048916 Bacteria 4929
408 Ga0496113_0161919 3300048916 Bacteria 1769
409 Ga0496113_0453901 3300048916 Bacteria 1030
410 Ga0496114_0090237 3300048917 Bacteria 2601
411 Ga0496114_0259936 3300048917 Bacteria 1528
412 Ga0496115_0052058 3300048918 Bacteria 3284
413 Ga0496115_0083342 3300048918 Bacteria 2606
414 Ga0496115_0295522 3300048918 Bacteria 1328
415 Ga0501308_018111 3300049128 Bacteria 859
416 Ga0501311_037495 3300049527 Bacteria 724
417 Ga0501316_008733 3300049532 Bacteria 1125
418 Ga0501324_013896 3300049540 Bacteria 767
419 Ga0501037_0464510 3300049573 Bacteria 862
420 Ga0501038_0227783 3300049574 Bacteria 1485
421 Ga0501039_0023770 3300049575 Bacteria 4704
422 Ga0501039_0210166 3300049575 Bacteria 1530
423 Ga0501043_0529402 3300049579 Bacteria 878
424 Ga0501067_0002332 3300049583 Bacteria 10497
425 Ga0501067_0194003 3300049583 Bacteria 1131
426 Ga0501068_0003192 3300049584 Bacteria 8777
427 Ga0501068_0091163 3300049584 Bacteria 1881
428 Ga0501069_0000453 3300049585 Bacteria 18732
429 Ga0501071_0138137 3300049587 Bacteria 1814
430 Ga0501072_0192315 3300049588 Bacteria 1627
431 Ga0501072_0228900 3300049588 Bacteria 1481
432 Ga0501074_0089775 3300049590 Bacteria 2201
433 Ga0501075_0029145 3300049591 Bacteria 4081
434 Ga0501075_0040984 3300049591 Bacteria 3470
435 Ga0501076_0008045 3300049592 Bacteria 7705
436 Ga0501076_0042981 3300049592 Bacteria 3560
437 Ga0501076_0178173 3300049592 Bacteria 1733
438 Ga0501076_0185295 3300049592 Bacteria 1697
439 Ga0501077_0170471 3300049593 Bacteria 1383
440 Ga0501079_0030428 3300049741 Bacteria 4147
441 Ga0501079_0082640 3300049741 Bacteria 2484
442 Ga0501080_0054944 3300049742 Bacteria 3708
443 Ga0501081_0028878 3300049743 Bacteria 3746
444 Ga0501081_0307076 3300049743 Bacteria 1164
445 Ga0501083_0034025 3300049744 Bacteria 3486
446 Ga0501035_1076476 3300049822 Bacteria 629
447 Ga0501045_0170872 3300049824 Bacteria 1619
448 Ga0501045_0267298 3300049824 Bacteria 1273
449 nmdc:mga03n38_3378_c1 3300050490 Bacteria 5116
450 nmdc:mga0yw44_62587_c1 3300050492 Bacteria 2286
451 nmdc:mga06z11_37207_c1 3300050494 Bacteria 2409
452 nmdc:mga04h51_15144_c1 3300050495 Bacteria 2218
453 nmdc:mga05p37_543913_c1 3300050507 Bacteria 1323
454 nmdc:mga05p37_89950_c1 3300050507 Bacteria 3783
455 nmdc:mga09592_297935_c1 3300050508 Bacteria 1398
456 nmdc:mga09592_37394_c1 3300050508 Bacteria 4072
457 nmdc:mga09592_379782_c1 3300050508 Bacteria 1222
458 nmdc:mga0qj67_4050_c1 3300050509 Bacteria 10619
459 nmdc:mga06r32_478153_c1 3300050510 Bacteria 1224
460 nmdc:mga06r32_660_c1 3300050510 Bacteria 30156
461 nmdc:mga06r32_8073_c1 3300050510 Bacteria 9471
462 nmdc:mga08y16_21803_c1 3300050511 Bacteria 6758
463 nmdc:mga08y16_239934_c1 3300050511 Bacteria 1874
464 nmdc:mga08y16_37233_c1 3300050511 Bacteria 5110
465 nmdc:mga08y16_408488_c1 3300050511 Bacteria 1389
466 nmdc:mga08y16_92688_c1 3300050511 Bacteria 3148
467 nmdc:mga0n895_10015_c1 3300050512 Bacteria 8344
468 nmdc:mga0n895_25936_c1 3300050512 Bacteria 5543
469 nmdc:mga0rr50_20072_c1 3300050513 Bacteria 4528
470 nmdc:mga0rr50_7174_c1 3300050513 Bacteria 5559
471 nmdc:mga0rr50_99694_c1 3300050513 Bacteria 2279
472 nmdc:mga08x19_95678_c1 3300050514 Bacteria 1965
473 nmdc:mga0a205_363672_c1 3300050515 Bacteria 1313
474 nmdc:mga0a205_91530_c1 3300050515 Bacteria 2939
475 nmdc:mga0a205_94896_c1 3300050515 Bacteria 2882
476 Ga0495601_0219582 3300053077 Bacteria 1241
477 Ga0495595_0111000 3300053084 Bacteria 1329
478 Ga0495619_0038703 3300053085 Bacteria 3111
479 Ga0495619_0162524 3300053085 Bacteria 1543
480 Ga0501084_0006267 3300054114 Bacteria 9778
481 Ga0501084_0047230 3300054114 Bacteria 3606
482 Ga0590075_042980 3300059424 Bacteria 1156
483 Ga0587066_071634 3300059490 Bacteria 731
484 Ga0587073_0092661 3300059492 Bacteria 771
485 Ga0587091_018153 3300059511 Bacteria 1193
486 Ga0501082_0008238 3300060353 Bacteria 8988
487 Ga0466962_0095353 3300061719 Bacteria 1426
488 Ga0530510_0046002 3300061734 Bacteria 3153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_1411627 Ga0395898_1411627_13_594 177
2 3300048918 Ga0496115_0295522 Ga0496115_0295522_24_593 178
3 iso_pu_bacteria 2885429604 2885431636 179
4 3300003203 JGI25406J46586_10005035 JGI25406J46586_100050358 180
5 3300005328 Ga0070676_10123132 Ga0070676_101231322 180
6 3300005353 Ga0070669_100292684 Ga0070669_1002926841 180
7 3300005356 Ga0070674_100622657 Ga0070674_1006226572 180
8 3300005455 Ga0070663_100420126 Ga0070663_1004201261 180
9 3300005457 Ga0070662_100020737 Ga0070662_1000207378 180
10 3300005459 Ga0068867_100345181 Ga0068867_1003451812 180
11 3300005577 Ga0068857_101143717 Ga0068857_1011437171 180
12 3300005614 Ga0068856_100512341 Ga0068856_1005123412 180
13 3300005615 Ga0070702_100775919 Ga0070702_1007759191 180
14 3300005981 Ga0081538_10012937 Ga0081538_1001293711 180
15 3300005981 Ga0081538_10018887 Ga0081538_100188874 180
16 3300005985 Ga0081539_10001787 Ga0081539_1000178726 180
17 3300006038 Ga0075365_10432396 Ga0075365_104323962 180
18 3300006844 Ga0075428_100254576 Ga0075428_1002545762 180
19 3300006880 Ga0075429_100347473 Ga0075429_1003474733 180
20 3300006881 Ga0068865_100386590 Ga0068865_1003865901 180
21 3300009094 Ga0111539_10081775 Ga0111539_100817757 180
22 3300009147 Ga0114129_10584105 Ga0114129_105841053 180
23 3300013296 Ga0157374_10348888 Ga0157374_103488883 180
24 3300014325 Ga0163163_10338021 Ga0163163_103380212 180
25 3300014326 Ga0157380_10549694 Ga0157380_105496942 180
26 3300025901 Ga0207688_10185719 Ga0207688_101857191 180
27 3300025927 Ga0207687_10522099 Ga0207687_105220991 180
28 3300025937 Ga0207669_10291882 Ga0207669_102918823 180
29 3300025940 Ga0207691_10142226 Ga0207691_101422263 180
30 3300026067 Ga0207678_10108230 Ga0207678_101082306 180
31 3300026075 Ga0207708_10192104 Ga0207708_101921043 180
32 3300026089 Ga0207648_10159945 Ga0207648_101599452 180
33 3300026089 Ga0207648_10537528 Ga0207648_105375281 180
34 3300031548 Ga0307408_100656320 Ga0307408_1006563202 180
35 3300031731 Ga0307405_10033428 Ga0307405_100334286 180
36 3300031731 Ga0307405_10436600 Ga0307405_104366002 180
37 3300031824 Ga0307413_10082713 Ga0307413_100827134 180
38 3300031852 Ga0307410_10044469 Ga0307410_100444692 180
39 3300031852 Ga0307410_10351325 Ga0307410_103513252 180
40 3300031901 Ga0307406_10139417 Ga0307406_101394174 180
41 3300031901 Ga0307406_10159532 Ga0307406_101595324 180
42 3300031903 Ga0307407_10039964 Ga0307407_100399644 180
43 3300031903 Ga0307407_10237293 Ga0307407_102372933 180
44 3300031903 Ga0307407_10388678 Ga0307407_103886781 180
45 3300031995 Ga0307409_100128659 Ga0307409_1001286592 180
46 3300031995 Ga0307409_100179831 Ga0307409_1001798313 180
47 3300031995 Ga0307409_100440130 Ga0307409_1004401302 180
48 3300032002 Ga0307416_100028261 Ga0307416_1000282618 180
49 3300032005 Ga0307411_10047285 Ga0307411_100472855 180
50 3300032126 Ga0307415_100043477 Ga0307415_1000434773 180
51 3300032126 Ga0307415_100069318 Ga0307415_1000693186 180
52 3300032126 Ga0307415_100103043 Ga0307415_1001030433 180
53 3300041460 Ga0451802_0661664 Ga0451802_0661664_105_701 180
54 3300044842 Ga0466957_0068004 Ga0466957_0068004_584_1174 180
55 3300044842 Ga0466957_0382002 Ga0466957_0382002_152_742 180
56 3300045976 Ga0466967_0299080 Ga0466967_0299080_895_1485 180
57 3300045976 Ga0466967_0747498 Ga0466967_0747498_23_613 180
58 3300046533 Ga0495640_0238935 Ga0495640_0238935_77_646 180
59 3300048912 Ga0496109_0087389 Ga0496109_0087389_1926_2516 180
60 3300048913 Ga0496110_0379903 Ga0496110_0379903_112_702 180
61 3300048913 Ga0496110_1099129 Ga0496110_1099129_19_609 180
62 3300049128 Ga0501308_018111 Ga0501308_018111_84_674 180
63 3300049527 Ga0501311_037495 Ga0501311_037495_22_615 180
64 3300049532 Ga0501316_008733 Ga0501316_008733_41_631 180
65 3300049540 Ga0501324_013896 Ga0501324_013896_151_741 180
66 3300049592 Ga0501076_0185295 Ga0501076_0185295_271_852 180
67 3300050508 nmdc:mga09592_379782_c1 nmdc:mga09592_379782_c1_200_790 180
68 3300050510 nmdc:mga06r32_478153_c1 nmdc:mga06r32_478153_c1_333_923 180
69 3300050511 nmdc:mga08y16_92688_c1 nmdc:mga08y16_92688_c1_243_833 180
70 3300059424 Ga0590075_042980 Ga0590075_042980_135_716 180
71 3300061719 Ga0466962_0095353 Ga0466962_0095353_218_808 180
72 3300048911 Ga0496108_0819732 Ga0496108_0819732_85_678 181
73 3300048912 Ga0496109_0160935 Ga0496109_0160935_300_893 181
74 3300048915 Ga0496112_0143259 Ga0496112_0143259_1298_1891 181
75 3300048916 Ga0496113_0453901 Ga0496113_0453901_235_828 181
76 3300005456 Ga0070678_100095377 Ga0070678_1000953775 182
77 3300039437 Ga0436365_0804265 Ga0436365_0804265_120_695 182
78 3300050507 nmdc:mga05p37_89950_c1 nmdc:mga05p37_89950_c1_257_1036 182
79 3300005295 Ga0065707_10160590 Ga0065707_101605903 183
80 3300005618 Ga0068864_100039730 Ga0068864_1000397303 183
81 3300005444 Ga0070694_100175445 Ga0070694_1001754453 184
82 3300009094 Ga0111539_10069995 Ga0111539_100699957 184
83 3300049822 Ga0501035_1076476 Ga0501035_1076476_29_613 184
84 3300050511 nmdc:mga08y16_239934_c1 nmdc:mga08y16_239934_c1_364_1134 184
85 3300046471 Ga0495650_0042254 Ga0495650_0042254_1193_1786 185
86 3300046528 Ga0495642_0006927 Ga0495642_0006927_436_1026 185
87 3300049592 Ga0501076_0178173 Ga0501076_0178173_774_1478 185
88 3300005338 Ga0068868_100503975 Ga0068868_1005039751 186
89 3300005343 Ga0070687_100048728 Ga0070687_1000487284 186
90 3300005343 Ga0070687_100172134 Ga0070687_1001721342 186
91 3300005434 Ga0070709_10693788 Ga0070709_106937881 186
92 3300005439 Ga0070711_100074674 Ga0070711_1000746745 186
93 3300005439 Ga0070711_100415429 Ga0070711_1004154292 186
94 3300005444 Ga0070694_100043715 Ga0070694_1000437152 186
95 3300005455 Ga0070663_100631524 Ga0070663_1006315241 186
96 3300005457 Ga0070662_100095107 Ga0070662_1000951076 186
97 3300005546 Ga0070696_100311884 Ga0070696_1003118843 186
98 3300005578 Ga0068854_100207540 Ga0068854_1002075403 186
99 3300005719 Ga0068861_100224083 Ga0068861_1002240832 186
100 3300005843 Ga0068860_100061069 Ga0068860_1000610693 186
101 3300005843 Ga0068860_100318695 Ga0068860_1003186953 186
102 3300005844 Ga0068862_100538230 Ga0068862_1005382302 186
103 3300006028 Ga0070717_10333283 Ga0070717_103332832 186
104 3300006038 Ga0075365_10034476 Ga0075365_100344767 186
105 3300006042 Ga0075368_10011859 Ga0075368_100118594 186
106 3300006048 Ga0075363_100005506 Ga0075363_1000055062 186
107 3300006163 Ga0070715_10002284 Ga0070715_1000228412 186
108 3300006175 Ga0070712_100088319 Ga0070712_1000883196 186
109 3300006175 Ga0070712_100148350 Ga0070712_1001483503 186
110 3300006178 Ga0075367_10026508 Ga0075367_100265085 186
111 3300006195 Ga0075366_10291344 Ga0075366_102913441 186
112 3300006237 Ga0097621_100516204 Ga0097621_1005162042 186
113 3300006846 Ga0075430_100259078 Ga0075430_1002590782 186
114 3300006847 Ga0075431_100117861 Ga0075431_1001178612 186
115 3300006852 Ga0075433_10476306 Ga0075433_104763062 186
116 3300006871 Ga0075434_100098535 Ga0075434_1000985351 186
117 3300006880 Ga0075429_100406313 Ga0075429_1004063132 186
118 3300007076 Ga0075435_100045094 Ga0075435_1000450944 186
119 3300007076 Ga0075435_100328309 Ga0075435_1003283092 186
120 3300009094 Ga0111539_10009902 Ga0111539_100099029 186
121 3300009094 Ga0111539_10140413 Ga0111539_101404132 186
122 3300009094 Ga0111539_10438442 Ga0111539_104384422 186
123 3300009098 Ga0105245_10434120 Ga0105245_104341202 186
124 3300009147 Ga0114129_10537942 Ga0114129_105379422 186
125 3300009177 Ga0105248_10782251 Ga0105248_107822512 186
126 3300009551 Ga0105238_11720714 Ga0105238_117207142 186
127 3300013306 Ga0163162_10159627 Ga0163162_101596274 186
128 3300013306 Ga0163162_10368305 Ga0163162_103683051 186
129 3300014326 Ga0157380_10143061 Ga0157380_101430614 186
130 3300025905 Ga0207685_10036952 Ga0207685_100369522 186
131 3300025917 Ga0207660_10225922 Ga0207660_102259223 186
132 3300025918 Ga0207662_10065552 Ga0207662_100655524 186
133 3300025927 Ga0207687_10092834 Ga0207687_100928346 186
134 3300025933 Ga0207706_10716442 Ga0207706_107164421 186
135 3300025935 Ga0207709_10133493 Ga0207709_101334933 186
136 3300025942 Ga0207689_10436678 Ga0207689_104366782 186
137 3300026075 Ga0207708_10060144 Ga0207708_100601443 186
138 3300026075 Ga0207708_10081269 Ga0207708_100812695 186
139 3300026089 Ga0207648_10326962 Ga0207648_103269622 186
140 3300026118 Ga0207675_100332673 Ga0207675_1003326732 186
141 3300027866 Ga0209813_10003980 Ga0209813_100039806 186
142 3300027907 Ga0207428_10030750 Ga0207428_100307503 186
143 3300028380 Ga0268265_10035663 Ga0268265_100356637 186
144 3300028380 Ga0268265_10846940 Ga0268265_108469401 186
145 3300028381 Ga0268264_10201802 Ga0268264_102018023 186
146 3300031731 Ga0307405_10252139 Ga0307405_102521393 186
147 3300031824 Ga0307413_10068491 Ga0307413_100684915 186
148 3300031911 Ga0307412_10030283 Ga0307412_100302838 186
149 3300032002 Ga0307416_100111845 Ga0307416_1001118454 186
150 3300035695 Ga0373927_0601955 Ga0373927_0601955_118_681 186
151 3300035724 Ga0373933_0161970 Ga0373933_0161970_229_792 186
152 3300035725 Ga0373947_0109114 Ga0373947_0109114_507_1262 186
153 3300041413 Ga0439465_0013112 Ga0439465_0013112_1521_2204 186
154 3300044712 Ga0453684_0241939 Ga0453684_0241939_391_960 186
155 3300046462 Ga0495651_0333669 Ga0495651_0333669_263_826 186
156 3300046663 Ga0495635_0390195 Ga0495635_0390195_299_862 186
157 3300046664 Ga0495659_0093599 Ga0495659_0093599_132_884 186
158 3300047319 Ga0495674_0545248 Ga0495674_0545248_256_819 186
159 3300047447 Ga0495685_024734 Ga0495685_024734_1048_1800 186
160 3300048903 Ga0496100_0134066 Ga0496100_0134066_582_1259 186
161 3300048905 Ga0496102_0187944 Ga0496102_0187944_760_1503 186
162 3300048907 Ga0496104_0000216 Ga0496104_0000216_26745_27476 186
163 3300048907 Ga0496104_0177112 Ga0496104_0177112_614_1291 186
164 3300048910 Ga0496107_0510283 Ga0496107_0510283_97_855 186
165 3300048911 Ga0496108_0000953 Ga0496108_0000953_4660_5391 186
166 3300048911 Ga0496108_0071526 Ga0496108_0071526_1569_2327 186
167 3300048911 Ga0496108_0509098 Ga0496108_0509098_217_894 186
168 3300048913 Ga0496110_0009986 Ga0496110_0009986_857_1588 186
169 3300048913 Ga0496110_0172016 Ga0496110_0172016_1194_1952 186
170 3300048914 Ga0496111_0044460 Ga0496111_0044460_545_1276 186
171 3300048914 Ga0496111_0069285 Ga0496111_0069285_913_1590 186
172 3300048915 Ga0496112_0009188 Ga0496112_0009188_7451_8182 186
173 3300048916 Ga0496113_0007308 Ga0496113_0007308_1533_2264 186
174 3300048916 Ga0496113_0017877 Ga0496113_0017877_2416_3159 186
175 3300048917 Ga0496114_0090237 Ga0496114_0090237_908_1585 186
176 3300048918 Ga0496115_0083342 Ga0496115_0083342_1824_2387 186
177 3300049584 Ga0501068_0091163 Ga0501068_0091163_899_1636 186
178 3300049741 Ga0501079_0082640 Ga0501079_0082640_1737_2474 186
179 3300049743 Ga0501081_0028878 Ga0501081_0028878_489_1226 186
180 3300050490 nmdc:mga03n38_3378_c1 nmdc:mga03n38_3378_c1_3865_4587 186
181 3300050492 nmdc:mga0yw44_62587_c1 nmdc:mga0yw44_62587_c1_430_1155 186
182 3300050494 nmdc:mga06z11_37207_c1 nmdc:mga06z11_37207_c1_1102_1824 186
183 3300050495 nmdc:mga04h51_15144_c1 nmdc:mga04h51_15144_c1_128_850 186
184 3300050507 nmdc:mga05p37_543913_c1 nmdc:mga05p37_543913_c1_28_711 186
185 3300050508 nmdc:mga09592_297935_c1 nmdc:mga09592_297935_c1_249_1001 186
186 3300050511 nmdc:mga08y16_21803_c1 nmdc:mga08y16_21803_c1_5347_6153 186
187 3300050511 nmdc:mga08y16_37233_c1 nmdc:mga08y16_37233_c1_2036_2788 186
188 3300050513 nmdc:mga0rr50_7174_c1 nmdc:mga0rr50_7174_c1_787_1539 186
189 3300050513 nmdc:mga0rr50_99694_c1 nmdc:mga0rr50_99694_c1_201_959 186
190 3300050515 nmdc:mga0a205_363672_c1 nmdc:mga0a205_363672_c1_320_1054 186
191 3300050515 nmdc:mga0a205_91530_c1 nmdc:mga0a205_91530_c1_1006_1764 186
192 3300053085 Ga0495619_0162524 Ga0495619_0162524_171_920 186
193 3300054114 Ga0501084_0047230 Ga0501084_0047230_2179_2916 186
194 3300001990 JGI24737J22298_10116086 JGI24737J22298_101160861 187
195 3300005328 Ga0070676_10238747 Ga0070676_102387473 187
196 3300005331 Ga0070670_100096525 Ga0070670_1000965251 187
197 3300005334 Ga0068869_100310784 Ga0068869_1003107841 187
198 3300005336 Ga0070680_100067827 Ga0070680_1000678273 187
199 3300005336 Ga0070680_100400571 Ga0070680_1004005712 187
200 3300005337 Ga0070682_100010869 Ga0070682_1000108696 187
201 3300005338 Ga0068868_100005144 Ga0068868_10000514413 187
202 3300005339 Ga0070660_100003497 Ga0070660_1000034975 187
203 3300005339 Ga0070660_100410266 Ga0070660_1004102662 187
204 3300005340 Ga0070689_100058352 Ga0070689_1000583522 187
205 3300005340 Ga0070689_100082449 Ga0070689_1000824492 187
206 3300005341 Ga0070691_10024838 Ga0070691_100248383 187
207 3300005343 Ga0070687_100023941 Ga0070687_1000239414 187
208 3300005344 Ga0070661_100326156 Ga0070661_1003261561 187
209 3300005354 Ga0070675_100055442 Ga0070675_1000554424 187
210 3300005355 Ga0070671_100097555 Ga0070671_1000975554 187
211 3300005364 Ga0070673_100088256 Ga0070673_1000882563 187
212 3300005365 Ga0070688_100033916 Ga0070688_1000339167 187
213 3300005365 Ga0070688_100250109 Ga0070688_1002501093 187
214 3300005366 Ga0070659_100048566 Ga0070659_1000485667 187
215 3300005366 Ga0070659_100089084 Ga0070659_1000890844 187
216 3300005366 Ga0070659_100357061 Ga0070659_1003570612 187
217 3300005406 Ga0070703_10000995 Ga0070703_1000099512 187
218 3300005434 Ga0070709_10204644 Ga0070709_102046442 187
219 3300005437 Ga0070710_10234272 Ga0070710_102342721 187
220 3300005438 Ga0070701_10224178 Ga0070701_102241782 187
221 3300005438 Ga0070701_10230474 Ga0070701_102304741 187
222 3300005440 Ga0070705_100000459 Ga0070705_10000045915 187
223 3300005440 Ga0070705_100017093 Ga0070705_1000170938 187
224 3300005441 Ga0070700_100007227 Ga0070700_10000722710 187
225 3300005441 Ga0070700_100094571 Ga0070700_1000945714 187
226 3300005444 Ga0070694_100017112 Ga0070694_1000171127 187
227 3300005444 Ga0070694_100153684 Ga0070694_1001536842 187
228 3300005445 Ga0070708_100012904 Ga0070708_1000129042 187
229 3300005455 Ga0070663_100001615 Ga0070663_1000016156 187
230 3300005455 Ga0070663_100200315 Ga0070663_1002003153 187
231 3300005457 Ga0070662_100080740 Ga0070662_1000807404 187
232 3300005458 Ga0070681_10128861 Ga0070681_101288612 187
233 3300005466 Ga0070685_10023496 Ga0070685_100234964 187
234 3300005468 Ga0070707_101313060 Ga0070707_1013130601 187
235 3300005518 Ga0070699_100000540 Ga0070699_1000005406 187
236 3300005530 Ga0070679_100081388 Ga0070679_1000813884 187
237 3300005536 Ga0070697_100051940 Ga0070697_1000519405 187
238 3300005543 Ga0070672_100098675 Ga0070672_1000986756 187
239 3300005544 Ga0070686_100051630 Ga0070686_1000516302 187
240 3300005544 Ga0070686_100147379 Ga0070686_1001473794 187
241 3300005545 Ga0070695_100019831 Ga0070695_1000198312 187
242 3300005545 Ga0070695_100036224 Ga0070695_1000362246 187
243 3300005546 Ga0070696_100000156 Ga0070696_10000015614 187
244 3300005547 Ga0070693_100005222 Ga0070693_1000052226 187
245 3300005547 Ga0070693_100025683 Ga0070693_1000256836 187
246 3300005548 Ga0070665_100275712 Ga0070665_1002757124 187
247 3300005548 Ga0070665_100572955 Ga0070665_1005729552 187
248 3300005549 Ga0070704_100001256 Ga0070704_1000012567 187
249 3300005549 Ga0070704_100091316 Ga0070704_1000913165 187
250 3300005563 Ga0068855_100047827 Ga0068855_1000478275 187
251 3300005564 Ga0070664_100419411 Ga0070664_1004194111 187
252 3300005577 Ga0068857_100080349 Ga0068857_1000803493 187
253 3300005577 Ga0068857_100399460 Ga0068857_1003994603 187
254 3300005614 Ga0068856_100032988 Ga0068856_1000329887 187
255 3300005614 Ga0068856_100058414 Ga0068856_1000584144 187
256 3300005615 Ga0070702_100010103 Ga0070702_1000101036 187
257 3300005615 Ga0070702_100025867 Ga0070702_1000258674 187
258 3300005615 Ga0070702_100037683 Ga0070702_1000376834 187
259 3300005617 Ga0068859_100006865 Ga0068859_10000686513 187
260 3300005617 Ga0068859_100143429 Ga0068859_1001434296 187
261 3300005618 Ga0068864_100012107 Ga0068864_1000121076 187
262 3300005618 Ga0068864_100082274 Ga0068864_1000822744 187
263 3300005718 Ga0068866_10302262 Ga0068866_103022622 187
264 3300005842 Ga0068858_100329172 Ga0068858_1003291723 187
265 3300005843 Ga0068860_100006701 Ga0068860_1000067019 187
266 3300005843 Ga0068860_100170943 Ga0068860_1001709436 187
267 3300005843 Ga0068860_100385142 Ga0068860_1003851424 187
268 3300005844 Ga0068862_100014559 Ga0068862_1000145597 187
269 3300006173 Ga0070716_100146687 Ga0070716_1001466874 187
270 3300006237 Ga0097621_100078215 Ga0097621_1000782157 187
271 3300006358 Ga0068871_100016147 Ga0068871_1000161472 187
272 3300006844 Ga0075428_100086212 Ga0075428_1000862126 187
273 3300006846 Ga0075430_100012358 Ga0075430_10001235812 187
274 3300006871 Ga0075434_100007021 Ga0075434_1000070217 187
275 3300006871 Ga0075434_100040672 Ga0075434_1000406726 187
276 3300006880 Ga0075429_100031579 Ga0075429_1000315798 187
277 3300006881 Ga0068865_100047901 Ga0068865_1000479016 187
278 3300006881 Ga0068865_100702077 Ga0068865_1007020772 187
279 3300006931 Ga0097620_100006865 Ga0097620_10000686510 187
280 3300006931 Ga0097620_100143436 Ga0097620_1001434363 187
281 3300007076 Ga0075435_100011052 Ga0075435_1000110527 187
282 3300009092 Ga0105250_10122928 Ga0105250_101229282 187
283 3300009093 Ga0105240_10411063 Ga0105240_104110634 187
284 3300009094 Ga0111539_10155061 Ga0111539_101550614 187
285 3300009098 Ga0105245_10011993 Ga0105245_100119935 187
286 3300009098 Ga0105245_10051809 Ga0105245_100518097 187
287 3300009101 Ga0105247_10133112 Ga0105247_101331124 187
288 3300009148 Ga0105243_10147736 Ga0105243_101477363 187
289 3300009174 Ga0105241_10133233 Ga0105241_101332333 187
290 3300009177 Ga0105248_10065805 Ga0105248_100658055 187
291 3300009177 Ga0105248_10100212 Ga0105248_101002126 187
292 3300009545 Ga0105237_10133147 Ga0105237_101331473 187
293 3300009551 Ga0105238_10067131 Ga0105238_100671313 187
294 3300009553 Ga0105249_10014071 Ga0105249_1001407115 187
295 3300009553 Ga0105249_10020972 Ga0105249_100209724 187
296 3300010375 Ga0105239_10350895 Ga0105239_103508953 187
297 3300010375 Ga0105239_10468209 Ga0105239_104682093 187
298 3300011119 Ga0105246_10017803 Ga0105246_100178034 187
299 3300011119 Ga0105246_10027178 Ga0105246_100271788 187
300 3300011119 Ga0105246_10036447 Ga0105246_100364472 187
301 3300013102 Ga0157371_10205916 Ga0157371_102059163 187
302 3300013105 Ga0157369_10155965 Ga0157369_101559654 187
303 3300013105 Ga0157369_10223079 Ga0157369_102230792 187
304 3300013296 Ga0157374_10066610 Ga0157374_100666104 187
305 3300013297 Ga0157378_10036743 Ga0157378_100367436 187
306 3300013297 Ga0157378_10508505 Ga0157378_105085052 187
307 3300013306 Ga0163162_10170234 Ga0163162_101702344 187
308 3300013307 Ga0157372_10043850 Ga0157372_100438507 187
309 3300013307 Ga0157372_10189935 Ga0157372_101899355 187
310 3300013308 Ga0157375_10035178 Ga0157375_100351788 187
311 3300013308 Ga0157375_10225396 Ga0157375_102253964 187
312 3300014325 Ga0163163_10017289 Ga0163163_1001728912 187
313 3300014745 Ga0157377_10005570 Ga0157377_100055707 187
314 3300014968 Ga0157379_10036674 Ga0157379_100366746 187
315 3300014969 Ga0157376_10165906 Ga0157376_101659063 187
316 3300025885 Ga0207653_10000812 Ga0207653_1000081210 187
317 3300025898 Ga0207692_10299329 Ga0207692_102993291 187
318 3300025900 Ga0207710_10039519 Ga0207710_100395194 187
319 3300025900 Ga0207710_10383373 Ga0207710_103833731 187
320 3300025901 Ga0207688_10003165 Ga0207688_1000316514 187
321 3300025903 Ga0207680_10139405 Ga0207680_101394053 187
322 3300025904 Ga0207647_10087669 Ga0207647_100876693 187
323 3300025907 Ga0207645_10243643 Ga0207645_102436433 187
324 3300025911 Ga0207654_10115218 Ga0207654_101152182 187
325 3300025911 Ga0207654_10295085 Ga0207654_102950853 187
326 3300025912 Ga0207707_10037537 Ga0207707_100375377 187
327 3300025913 Ga0207695_10593310 Ga0207695_105933102 187
328 3300025915 Ga0207693_10012090 Ga0207693_1001209010 187
329 3300025917 Ga0207660_10009664 Ga0207660_1000966410 187
330 3300025918 Ga0207662_10034770 Ga0207662_100347703 187
331 3300025919 Ga0207657_10001826 Ga0207657_100018268 187
332 3300025919 Ga0207657_10057557 Ga0207657_100575576 187
333 3300025921 Ga0207652_10201191 Ga0207652_102011914 187
334 3300025924 Ga0207694_10140636 Ga0207694_101406365 187
335 3300025927 Ga0207687_10000332 Ga0207687_1000033221 187
336 3300025927 Ga0207687_10017439 Ga0207687_100174397 187
337 3300025931 Ga0207644_10138232 Ga0207644_101382323 187
338 3300025932 Ga0207690_10009696 Ga0207690_100096961 187
339 3300025933 Ga0207706_10061710 Ga0207706_100617104 187
340 3300025934 Ga0207686_10033231 Ga0207686_100332311 187
341 3300025935 Ga0207709_10080214 Ga0207709_100802142 187
342 3300025937 Ga0207669_10058444 Ga0207669_100584444 187
343 3300025938 Ga0207704_10093897 Ga0207704_100938973 187
344 3300025939 Ga0207665_10006238 Ga0207665_100062389 187
345 3300025940 Ga0207691_10051899 Ga0207691_100518995 187
346 3300025941 Ga0207711_10035265 Ga0207711_100352653 187
347 3300025942 Ga0207689_10088909 Ga0207689_100889091 187
348 3300025944 Ga0207661_10265016 Ga0207661_102650162 187
349 3300025945 Ga0207679_10417663 Ga0207679_104176631 187
350 3300025949 Ga0207667_10205855 Ga0207667_102058553 187
351 3300025960 Ga0207651_10229071 Ga0207651_102290711 187
352 3300025961 Ga0207712_10012990 Ga0207712_100129907 187
353 3300025961 Ga0207712_10203372 Ga0207712_102033721 187
354 3300025981 Ga0207640_10851979 Ga0207640_108519791 187
355 3300026023 Ga0207677_10006465 Ga0207677_100064658 187
356 3300026035 Ga0207703_10180568 Ga0207703_101805681 187
357 3300026035 Ga0207703_10376783 Ga0207703_103767831 187
358 3300026041 Ga0207639_10038539 Ga0207639_100385395 187
359 3300026041 Ga0207639_11199436 Ga0207639_111994361 187
360 3300026067 Ga0207678_10001998 Ga0207678_1000199819 187
361 3300026067 Ga0207678_10118309 Ga0207678_101183096 187
362 3300026067 Ga0207678_10696064 Ga0207678_106960641 187
363 3300026075 Ga0207708_10001023 Ga0207708_1000102315 187
364 3300026078 Ga0207702_10046943 Ga0207702_100469434 187
365 3300026078 Ga0207702_10229736 Ga0207702_102297363 187
366 3300026089 Ga0207648_10355622 Ga0207648_103556223 187
367 3300026095 Ga0207676_10013834 Ga0207676_100138349 187
368 3300026095 Ga0207676_10170380 Ga0207676_101703803 187
369 3300026116 Ga0207674_10085949 Ga0207674_100859495 187
370 3300026116 Ga0207674_10494041 Ga0207674_104940412 187
371 3300026121 Ga0207683_10042517 Ga0207683_100425176 187
372 3300026121 Ga0207683_10096185 Ga0207683_100961854 187
373 3300026142 Ga0207698_10121917 Ga0207698_101219174 187
374 3300026142 Ga0207698_11255441 Ga0207698_112554411 187
375 3300028379 Ga0268266_10340818 Ga0268266_103408183 187
376 3300028380 Ga0268265_10004169 Ga0268265_100041696 187
377 3300028381 Ga0268264_10005719 Ga0268264_100057197 187
378 3300028381 Ga0268264_10111100 Ga0268264_101111003 187
379 3300034816 Ga0373930_0084775 Ga0373930_0084775_26_601 187
380 3300035086 Ga0373934_0016127 Ga0373934_0016127_638_1213 187
381 3300035113 Ga0373936_0019812 Ga0373936_0019812_527_1102 187
382 3300035116 Ga0373945_0004207 Ga0373945_0004207_2905_3480 187
383 3300035118 Ga0373954_0049735 Ga0373954_0049735_1250_1825 187
384 3300035119 Ga0373956_0020417 Ga0373956_0020417_101_676 187
385 3300035170 Ga0373943_0027652 Ga0373943_0027652_1378_1953 187
386 3300035171 Ga0373946_0244424 Ga0373946_0244424_244_819 187
387 3300035410 Ga0373924_0015173 Ga0373924_0015173_1188_1763 187
388 3300035695 Ga0373927_0022164 Ga0373927_0022164_1873_2448 187
389 3300035724 Ga0373933_0088360 Ga0373933_0088360_568_1143 187
390 3300035725 Ga0373947_0280011 Ga0373947_0280011_491_1066 187
391 3300036401 Ga0373937_0045561 Ga0373937_0045561_1161_1736 187
392 3300046455 Ga0495603_0296592 Ga0495603_0296592_281_862 187
393 3300046459 Ga0495629_0253828 Ga0495629_0253828_491_1066 187
394 3300046461 Ga0495641_0030173 Ga0495641_0030173_1198_1773 187
395 3300046463 Ga0495653_0029693 Ga0495653_0029693_249_824 187
396 3300046472 Ga0495580_0022805 Ga0495580_0022805_2686_3261 187
397 3300046473 Ga0495582_0004746 Ga0495582_0004746_861_1436 187
398 3300046475 Ga0495639_0014777 Ga0495639_0014777_2165_2740 187
399 3300046476 Ga0495662_0007474 Ga0495662_0007474_3018_3593 187
400 3300046477 Ga0495664_0236745 Ga0495664_0236745_333_914 187
401 3300046499 Ga0495594_0276695 Ga0495594_0276695_144_725 187
402 3300046511 Ga0495608_0043315 Ga0495608_0043315_75_650 187
403 3300046514 Ga0495618_0111156 Ga0495618_0111156_126_701 187
404 3300046526 Ga0495666_0022628 Ga0495666_0022628_733_1308 187
405 3300046529 Ga0495652_0416605 Ga0495652_0416605_299_874 187
406 3300046531 Ga0495665_0218900 Ga0495665_0218900_122_697 187
407 3300046533 Ga0495640_0024081 Ga0495640_0024081_2613_3188 187
408 3300046535 Ga0495586_0041894 Ga0495586_0041894_331_906 187
409 3300046543 Ga0495645_0643221 Ga0495645_0643221_42_623 187
410 3300046557 Ga0495622_0291977 Ga0495622_0291977_34_609 187
411 3300046559 Ga0495667_0039119 Ga0495667_0039119_1383_1958 187
412 3300046642 Ga0495634_0028786 Ga0495634_0028786_858_1433 187
413 3300046675 Ga0495657_0003110 Ga0495657_0003110_11335_11910 187
414 3300046679 Ga0495623_0030296 Ga0495623_0030296_1852_2427 187
415 3300046681 Ga0495647_0003117 Ga0495647_0003117_3306_3881 187
416 3300046683 Ga0495658_0001182 Ga0495658_0001182_10776_11351 187
417 3300046689 Ga0495613_0043476 Ga0495613_0043476_1198_1773 187
418 3300046690 Ga0495624_0287930 Ga0495624_0287930_74_649 187
419 3300046809 Ga0495600_0056406 Ga0495600_0056406_181_756 187
420 3300047317 Ga0495604_0047307 Ga0495604_0047307_936_1511 187
421 3300047322 Ga0495680_0029124 Ga0495680_0029124_2138_2713 187
422 3300047444 Ga0495675_0014758 Ga0495675_0014758_2776_3351 187
423 3300047673 Ga0495593_0016327 Ga0495593_0016327_2028_2603 187
424 3300048089 Ga0495614_0024070 Ga0495614_0024070_1783_2358 187
425 3300048905 Ga0496102_0002642 Ga0496102_0002642_7532_8275 187
426 3300048905 Ga0496102_0251795 Ga0496102_0251795_212_787 187
427 3300048906 Ga0496103_0037187 Ga0496103_0037187_2039_2614 187
428 3300048906 Ga0496103_0058751 Ga0496103_0058751_1046_1789 187
429 3300048908 Ga0496105_0423591 Ga0496105_0423591_224_799 187
430 3300048908 Ga0496105_0454568 Ga0496105_0454568_143_886 187
431 3300048908 Ga0496105_0856483 Ga0496105_0856483_22_597 187
432 3300048909 Ga0496106_0002278 Ga0496106_0002278_7359_8102 187
433 3300048909 Ga0496106_0050277 Ga0496106_0050277_843_1418 187
434 3300048910 Ga0496107_0013153 Ga0496107_0013153_1433_2176 187
435 3300048910 Ga0496107_0058400 Ga0496107_0058400_1497_2072 187
436 3300048911 Ga0496108_0214697 Ga0496108_0214697_681_1256 187
437 3300048912 Ga0496109_0003257 Ga0496109_0003257_6553_7128 187
438 3300048912 Ga0496109_0004775 Ga0496109_0004775_1026_1589 187
439 3300048913 Ga0496110_0003959 Ga0496110_0003959_6357_6932 187
440 3300048913 Ga0496110_0131260 Ga0496110_0131260_791_1354 187
441 3300048914 Ga0496111_0005234 Ga0496111_0005234_3490_4065 187
442 3300048915 Ga0496112_0008451 Ga0496112_0008451_2003_2578 187
443 3300048916 Ga0496113_0005548 Ga0496113_0005548_41_616 187
444 3300048916 Ga0496113_0161919 Ga0496113_0161919_228_791 187
445 3300048917 Ga0496114_0259936 Ga0496114_0259936_722_1297 187
446 3300048918 Ga0496115_0052058 Ga0496115_0052058_1473_2048 187
447 3300049573 Ga0501037_0464510 Ga0501037_0464510_30_749 187
448 3300049574 Ga0501038_0227783 Ga0501038_0227783_478_1197 187
449 3300049575 Ga0501039_0023770 Ga0501039_0023770_1900_2667 187
450 3300049575 Ga0501039_0210166 Ga0501039_0210166_483_1226 187
451 3300049579 Ga0501043_0529402 Ga0501043_0529402_50_793 187
452 3300049583 Ga0501067_0002332 Ga0501067_0002332_4291_4854 187
453 3300049583 Ga0501067_0194003 Ga0501067_0194003_43_606 187
454 3300049584 Ga0501068_0003192 Ga0501068_0003192_2492_3055 187
455 3300049585 Ga0501069_0000453 Ga0501069_0000453_6608_7171 187
456 3300049587 Ga0501071_0138137 Ga0501071_0138137_550_1293 187
457 3300049588 Ga0501072_0192315 Ga0501072_0192315_261_980 187
458 3300049588 Ga0501072_0228900 Ga0501072_0228900_229_972 187
459 3300049590 Ga0501074_0089775 Ga0501074_0089775_393_1136 187
460 3300049591 Ga0501075_0029145 Ga0501075_0029145_709_1452 187
461 3300049591 Ga0501075_0040984 Ga0501075_0040984_2209_2967 187
462 3300049592 Ga0501076_0008045 Ga0501076_0008045_6183_6926 187
463 3300049592 Ga0501076_0042981 Ga0501076_0042981_894_1661 187
464 3300049593 Ga0501077_0170471 Ga0501077_0170471_413_1132 187
465 3300049741 Ga0501079_0030428 Ga0501079_0030428_783_1526 187
466 3300049742 Ga0501080_0054944 Ga0501080_0054944_2542_3285 187
467 3300049743 Ga0501081_0307076 Ga0501081_0307076_79_807 187
468 3300049744 Ga0501083_0034025 Ga0501083_0034025_1430_2173 187
469 3300049824 Ga0501045_0170872 Ga0501045_0170872_776_1495 187
470 3300049824 Ga0501045_0267298 Ga0501045_0267298_391_1149 187
471 3300050508 nmdc:mga09592_37394_c1 nmdc:mga09592_37394_c1_2205_2963 187
472 3300050509 nmdc:mga0qj67_4050_c1 nmdc:mga0qj67_4050_c1_952_1689 187
473 3300050510 nmdc:mga06r32_660_c1 nmdc:mga06r32_660_c1_6189_6947 187
474 3300050510 nmdc:mga06r32_8073_c1 nmdc:mga06r32_8073_c1_5013_5750 187
475 3300050511 nmdc:mga08y16_408488_c1 nmdc:mga08y16_408488_c1_541_1104 187
476 3300050512 nmdc:mga0n895_10015_c1 nmdc:mga0n895_10015_c1_1027_1590 187
477 3300050512 nmdc:mga0n895_25936_c1 nmdc:mga0n895_25936_c1_3020_3595 187
478 3300050513 nmdc:mga0rr50_20072_c1 nmdc:mga0rr50_20072_c1_998_1573 187
479 3300050514 nmdc:mga08x19_95678_c1 nmdc:mga08x19_95678_c1_511_1086 187
480 3300050515 nmdc:mga0a205_94896_c1 nmdc:mga0a205_94896_c1_503_1066 187
481 3300053077 Ga0495601_0219582 Ga0495601_0219582_529_1104 187
482 3300053084 Ga0495595_0111000 Ga0495595_0111000_380_955 187
483 3300053085 Ga0495619_0038703 Ga0495619_0038703_117_692 187
484 3300054114 Ga0501084_0006267 Ga0501084_0006267_2124_2867 187
485 3300059490 Ga0587066_071634 Ga0587066_071634_82_645 187
486 3300059492 Ga0587073_0092661 Ga0587073_0092661_151_735 187
487 3300059511 Ga0587091_018153 Ga0587091_018153_416_979 187
488 3300060353 Ga0501082_0008238 Ga0501082_0008238_2572_3315 187
489 3300061734 Ga0530510_0046002 Ga0530510_0046002_1738_2505 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

60

116

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

120

213

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9638 11 184
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9469 11 184
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9381 11 184
5ns3-assembly1.cif.gz_A crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9257 11 184
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9227 11 184
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9015 10 184 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8869 10 184 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8699 29 184 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8644 29 184 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.857 29 186 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A538J4T4-F1-model_v4 50S ribosomal protein L5 0.9315 3 187 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A661XKI5-F1-model_v4 Large ribosomal subunit protein uL5 0.9221 8 187 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A521VJK7-F1-model_v4 Large ribosomal subunit protein uL5 0.9221 6 186 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-D5MKI0-F1-model_v4 Large ribosomal subunit protein uL5 0.9215 2 187 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E8AVB6-F1-model_v4 Large ribosomal subunit protein uL5 0.9215 6 187 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
66.65 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map