F453740

General Info

Members Datasets Scaffolds Average Seq Length
489 250 978 197

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100060301|Ga0070714_1000603013
Length 211
Sequence MAPQRKTFPRLFLSRADPYRLIGDRVFLRPPERGDYEAWASLRAGSRDFLSPWEPSWPPDALSRANFRARVARYAEDWRTDQAYNFFIFARDETLIGGIGLSNIRRGVSETASLGYWVGEPFARQRYMTSALPLVVDFAFERLGLHRLEAACLPSNAPSRSLLARAGFQQEGYAREYLCIAGKWQDHLLFGVLRGDRSAPQIKVGELKPEN

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
121 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
122 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
126 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
247 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
248 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
249 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
250 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0.61
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0.41
Rhizoplane 2.66
Rhizosphere 91.21
Stem 0
Stem Tuber 0
Unclassified 3.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100060301 3300005435 Bacteria 3256
2 Ga0070690_100148400 3300005330 Bacteria 1598
3 Ga0070690_100254534 3300005330 Bacteria 1243
4 Ga0070670_100006413 3300005331 Bacteria 9957
5 Ga0070670_100051249 3300005331 Bacteria 3545
6 Ga0070666_10059068 3300005335 Bacteria 2593
7 Ga0070680_100034694 3300005336 Bacteria 4068
8 Ga0070689_100939740 3300005340 Bacteria 767
9 Ga0070675_100029164 3300005354 Bacteria 4448
10 Ga0070675_100494851 3300005354 Bacteria 1101
11 Ga0070671_100000616 3300005355 Bacteria 25441
12 Ga0070671_100132730 3300005355 Bacteria 2098
13 Ga0070671_100485211 3300005355 Bacteria 1062
14 Ga0070674_100695739 3300005356 Bacteria 868
15 Ga0070673_100145997 3300005364 Bacteria 2000
16 Ga0070688_100083373 3300005365 Bacteria 2074
17 Ga0070659_100310422 3300005366 Bacteria 1317
18 Ga0070709_10048746 3300005434 Bacteria 2644
19 Ga0070709_10144274 3300005434 Bacteria 1639
20 Ga0070714_100008196 3300005435 Bacteria 8145
21 Ga0070714_100066413 3300005435 Bacteria 3109
22 Ga0070714_100193628 3300005435 Bacteria 1856
23 Ga0070714_100540192 3300005435 Bacteria 1115
24 Ga0070713_100005641 3300005436 Bacteria 8583
25 Ga0070713_100082161 3300005436 Bacteria 2750
26 Ga0070713_100087250 3300005436 Bacteria 2676
27 Ga0070713_100274900 3300005436 Bacteria 1544
28 Ga0070710_10116037 3300005437 Bacteria 1614
29 Ga0070710_10132373 3300005437 Bacteria 1522
30 Ga0070710_10241278 3300005437 Bacteria 1158
31 Ga0070710_10264839 3300005437 Bacteria 1109
32 Ga0070711_100030259 3300005439 Bacteria 3582
33 Ga0070711_100063788 3300005439 Bacteria 2572
34 Ga0070711_100123357 3300005439 Bacteria 1919
35 Ga0070711_100153370 3300005439 Bacteria 1739
36 Ga0070711_100206794 3300005439 Bacteria 1518
37 Ga0070711_100211708 3300005439 Unclassified 1502
38 Ga0070694_100173861 3300005444 Bacteria 1588
39 Ga0070708_100451413 3300005445 Bacteria 1213
40 Ga0070663_100025316 3300005455 Bacteria 4004
41 Ga0070681_10011691 3300005458 Bacteria 8695
42 Ga0070681_10166684 3300005458 Bacteria 2125
43 Ga0070681_10313854 3300005458 Unclassified 1477
44 Ga0070681_10722776 3300005458 Bacteria 912
45 Ga0070706_100273650 3300005467 Unclassified 1576
46 Ga0070706_100306027 3300005467 Bacteria 1483
47 Ga0070707_100009252 3300005468 Bacteria 9141
48 Ga0070707_100402061 3300005468 Bacteria 1330
49 Ga0070707_100820806 3300005468 Bacteria 894
50 Ga0070698_100007175 3300005471 Bacteria 12072
51 Ga0070699_100005426 3300005518 Bacteria 11181
52 Ga0070699_100143330 3300005518 Bacteria 2111
53 Ga0070679_100021727 3300005530 Bacteria 6267
54 Ga0070679_100167436 3300005530 Bacteria 2170
55 Ga0070679_100952507 3300005530 Bacteria 802
56 Ga0070684_100927595 3300005535 Bacteria 816
57 Ga0070684_101114483 3300005535 Bacteria 742
58 Ga0070697_100046331 3300005536 Bacteria 3524
59 Ga0070697_100057230 3300005536 Bacteria 3173
60 Ga0070697_100181958 3300005536 Bacteria 1782
61 Ga0070696_100014897 3300005546 Bacteria 5220
62 Ga0070693_100066083 3300005547 Bacteria 2116
63 Ga0070665_100015358 3300005548 Bacteria 7690
64 Ga0070665_100056305 3300005548 Bacteria 3942
65 Ga0070665_100201908 3300005548 Bacteria 1989
66 Ga0070665_100835555 3300005548 Bacteria 934
67 Ga0070664_100429717 3300005564 Bacteria 1211
68 Ga0070664_100490820 3300005564 Bacteria 1131
69 Ga0068856_100123187 3300005614 Bacteria 2595
70 Ga0068863_101000440 3300005841 Bacteria 839
71 Ga0068863_101159572 3300005841 Bacteria 778
72 Ga0068858_100101135 3300005842 Bacteria 2688
73 Ga0081540_1014562 3300005983 Bacteria 5029
74 Ga0070717_10002318 3300006028 Bacteria 13374
75 Ga0070717_10018487 3300006028 Bacteria 5442
76 Ga0070717_10118623 3300006028 Bacteria 2264
77 Ga0070717_10196011 3300006028 Bacteria 1767
78 Ga0070717_10262572 3300006028 Bacteria 1528
79 Ga0070717_10263998 3300006028 Bacteria 1524
80 Ga0070717_10355053 3300006028 Unclassified 1311
81 Ga0070716_100038583 3300006173 Bacteria 2646
82 Ga0070712_100016002 3300006175 Bacteria 4838
83 Ga0070712_100021105 3300006175 Bacteria 4271
84 Ga0070712_100070480 3300006175 Bacteria 2498
85 Ga0070712_100227466 3300006175 Bacteria 1479
86 Ga0070712_100335489 3300006175 Bacteria 1233
87 Ga0070712_100609037 3300006175 Bacteria 925
88 Ga0068871_100023984 3300006358 Bacteria 4727
89 Ga0075428_100001793 3300006844 Bacteria 22956
90 Ga0075428_100329593 3300006844 Bacteria 1640
91 Ga0075430_100014121 3300006846 Bacteria 6811
92 Ga0075431_100000136 3300006847 Bacteria 49311
93 Ga0075431_100147913 3300006847 Bacteria 2420
94 Ga0075434_100462348 3300006871 Bacteria 1290
95 Ga0075429_100003755 3300006880 Bacteria 12949
96 Ga0075436_100023205 3300006914 Bacteria 4262
97 Ga0075435_100092730 3300007076 Bacteria 2494
98 Ga0099795_10005043 3300007788 Bacteria 3473
99 Ga0105240_10314164 3300009093 Bacteria 1788
100 Ga0105240_10324735 3300009093 Bacteria 1753
101 Ga0105240_11096466 3300009093 Bacteria 847
102 Ga0111539_10000405 3300009094 Bacteria 53738
103 Ga0105245_10059044 3300009098 Bacteria 3453
104 Ga0105245_10069575 3300009098 Bacteria 3192
105 Ga0105245_10933009 3300009098 Bacteria 910
106 Ga0105247_10034297 3300009101 Bacteria 3091
107 Ga0114129_10002465 3300009147 Bacteria 25697
108 Ga0114129_10056071 3300009147 Bacteria 5521
109 Ga0105241_10502876 3300009174 Bacteria 1081
110 Ga0105242_10340737 3300009176 Bacteria 1381
111 Ga0105248_10332794 3300009177 Bacteria 1710
112 Ga0105248_10371488 3300009177 Bacteria 1610
113 Ga0105237_10128164 3300009545 Bacteria 2532
114 Ga0105237_10195259 3300009545 Bacteria 2024
115 Ga0105238_10008782 3300009551 Bacteria 10110
116 Ga0105238_10463377 3300009551 Bacteria 1265
117 Ga0105249_10400955 3300009553 Bacteria 1402
118 Ga0099796_10001195 3300010159 Bacteria 5048
119 Ga0099796_10010641 3300010159 Bacteria 2536
120 Ga0099796_10036901 3300010159 Bacteria 1630
121 Ga0099796_10049161 3300010159 Unclassified 1457
122 Ga0099796_10054898 3300010159 Bacteria 1394
123 Ga0099796_10150063 3300010159 Unclassified 917
124 Ga0099796_10227430 3300010159 Bacteria 767
125 Ga0105239_10254170 3300010375 Bacteria 1974
126 Ga0105246_10081449 3300011119 Bacteria 2307
127 Ga0105246_10395670 3300011119 Bacteria 1146
128 Ga0157370_10012644 3300013104 Bacteria 8743
129 Ga0157378_10096777 3300013297 Bacteria 2690
130 Ga0163162_10906128 3300013306 Bacteria 995
131 Ga0157372_10210417 3300013307 Bacteria 2254
132 Ga0157375_10293653 3300013308 Bacteria 1789
133 Ga0157375_10411143 3300013308 Bacteria 1519
134 Ga0157375_10755328 3300013308 Bacteria 1124
135 Ga0163163_10036308 3300014325 Bacteria 4787
136 Ga0182008_10057689 3300014497 Bacteria 1917
137 Ga0182008_10453532 3300014497 Bacteria 698
138 Ga0157376_10136183 3300014969 Bacteria 2198
139 Ga0163161_10145837 3300017792 Bacteria 1795
140 Ga0206352_10353453 3300020078 Bacteria 1401
141 Ga0206353_10030760 3300020082 Bacteria 1631
142 Ga0213872_10102219 3300021361 Bacteria 1277
143 Ga0213872_10105122 3300021361 Bacteria 1257
144 Ga0213874_10056085 3300021377 Bacteria 1222
145 Ga0213876_10080731 3300021384 Bacteria 1720
146 Ga0213875_10000718 3300021388 Bacteria 25307
147 Ga0213875_10000862 3300021388 Bacteria 22407
148 Ga0213875_10008550 3300021388 Bacteria 5234
149 Ga0213875_10047552 3300021388 Bacteria 2013
150 Ga0213875_10122698 3300021388 Bacteria 1214
151 Ga0224712_10291788 3300022467 Bacteria 761
152 Ga0228598_1028399 3300024227 Bacteria 1101
153 Ga0207692_10282950 3300025898 Unclassified 1004
154 Ga0207680_10061377 3300025903 Bacteria 2292
155 Ga0207699_10382795 3300025906 Bacteria 999
156 Ga0207684_10377148 3300025910 Unclassified 1220
157 Ga0207707_10011871 3300025912 Bacteria 7579
158 Ga0207695_10199093 3300025913 Bacteria 1918
159 Ga0207695_10226060 3300025913 Bacteria 1778
160 Ga0207693_10002603 3300025915 Bacteria 15674
161 Ga0207693_10005621 3300025915 Bacteria 10426
162 Ga0207693_10019672 3300025915 Bacteria 5369
163 Ga0207693_10030729 3300025915 Bacteria 4243
164 Ga0207663_10027141 3300025916 Bacteria 3333
165 Ga0207660_10058663 3300025917 Bacteria 2761
166 Ga0207660_10087547 3300025917 Bacteria 2302
167 Ga0207649_10082358 3300025920 Bacteria 2086
168 Ga0207652_10020263 3300025921 Bacteria 5475
169 Ga0207652_10121742 3300025921 Bacteria 2322
170 Ga0207646_10013906 3300025922 Bacteria 7675
171 Ga0207646_10298344 3300025922 Bacteria 1456
172 Ga0207646_10340265 3300025922 Bacteria 1356
173 Ga0207681_10659273 3300025923 Bacteria 868
174 Ga0207694_10000574 3300025924 Bacteria 33400
175 Ga0207650_10088910 3300025925 Bacteria 2357
176 Ga0207687_10042756 3300025927 Bacteria 3119
177 Ga0207687_10304930 3300025927 Bacteria 1284
178 Ga0207700_10006946 3300025928 Bacteria 6886
179 Ga0207700_10016810 3300025928 Bacteria 4871
180 Ga0207700_10057414 3300025928 Bacteria 2935
181 Ga0207700_10113043 3300025928 Bacteria 2189
182 Ga0207700_10344818 3300025928 Bacteria 1296
183 Ga0207664_10061469 3300025929 Bacteria 2997
184 Ga0207664_10074453 3300025929 Bacteria 2744
185 Ga0207644_10016446 3300025931 Bacteria 4977
186 Ga0207706_10094923 3300025933 Bacteria 2623
187 Ga0207670_10396061 3300025936 Bacteria 1103
188 Ga0207669_10284749 3300025937 Bacteria 1248
189 Ga0207704_10933902 3300025938 Bacteria 731
190 Ga0207665_10045049 3300025939 Bacteria 2953
191 Ga0207665_10790976 3300025939 Unclassified 749
192 Ga0207689_10200738 3300025942 Bacteria 1646
193 Ga0207667_10488770 3300025949 Bacteria 1249
194 Ga0207667_10946106 3300025949 Bacteria 851
195 Ga0207651_10124896 3300025960 Bacteria 1959
196 Ga0207678_10021037 3300026067 Bacteria 5718
197 Ga0207702_10011039 3300026078 Bacteria 7540
198 Ga0207641_10827846 3300026088 Bacteria 917
199 Ga0207683_10021920 3300026121 Bacteria 5480
200 Ga0207428_10000994 3300027907 Bacteria 31445
201 Ga0268266_10363267 3300028379 Bacteria 1362
202 Ga0268266_10826324 3300028379 Bacteria 895
203 Ga0265330_10040204 3300031235 Bacteria 2077
204 Ga0265330_10108475 3300031235 Bacteria 1187
205 Ga0265328_10105984 3300031239 Bacteria 1043
206 Ga0265327_10000620 3300031251 Bacteria 58447
207 Ga0265327_10047379 3300031251 Bacteria 2268
208 Ga0265316_10017316 3300031344 Bacteria 6236
209 Ga0265316_10158933 3300031344 Bacteria 1690
210 Ga0265316_10275782 3300031344 Bacteria 1230
211 Ga0265314_10007080 3300031711 Bacteria 9787
212 Ga0307406_10282439 3300031901 Bacteria 1267
213 Ga0307406_10369673 3300031901 Bacteria 1127
214 Ga0307409_100592556 3300031995 Bacteria 1094
215 Ga0307416_100367907 3300032002 Bacteria 1463
216 Ga0373930_0036385 3300034816 Bacteria 1033
217 Ga0373958_0042495 3300034819 Bacteria 934
218 Ga0373959_0075613 3300034820 Bacteria 768
219 Ga0373934_0006319 3300035086 Bacteria 4392
220 Ga0373934_0016202 3300035086 Bacteria 2833
221 Ga0373934_0119180 3300035086 Bacteria 1073
222 Ga0373944_0060388 3300035089 Bacteria 1215
223 Ga0373949_0044408 3300035090 Bacteria 1103
224 Ga0373951_0029526 3300035091 Bacteria 1288
225 Ga0373951_0030663 3300035091 Bacteria 1266
226 Ga0373923_0010823 3300035111 Bacteria 3330
227 Ga0373923_0088567 3300035111 Bacteria 1351
228 Ga0373923_0095777 3300035111 Bacteria 1303
229 Ga0373923_0272260 3300035111 Bacteria 796
230 Ga0373936_0015693 3300035113 Bacteria 2904
231 Ga0373936_0016316 3300035113 Bacteria 2856
232 Ga0373945_0011766 3300035116 Bacteria 2897
233 Ga0373953_0001354 3300035117 Bacteria 7049
234 Ga0373953_0043594 3300035117 Bacteria 1791
235 Ga0373954_0008431 3300035118 Bacteria 4522
236 Ga0373954_0019894 3300035118 Bacteria 3030
237 Ga0373956_0002487 3300035119 Bacteria 7500
238 Ga0373956_0037752 3300035119 Bacteria 2136
239 Ga0373957_0038274 3300035120 Bacteria 1795
240 Ga0373957_0132156 3300035120 Bacteria 1016
241 Ga0373943_0261496 3300035170 Bacteria 974
242 Ga0373943_0332677 3300035170 Bacteria 867
243 Ga0373946_0084263 3300035171 Bacteria 1397
244 Ga0373946_0170329 3300035171 Bacteria 1027
245 Ga0373955_0003996 3300035172 Bacteria 6511
246 Ga0373955_0020357 3300035172 Bacteria 3334
247 Ga0373955_0139140 3300035172 Bacteria 1422
248 Ga0373955_0158896 3300035172 Bacteria 1333
249 Ga0373955_0267760 3300035172 Bacteria 1027
250 Ga0373961_0020308 3300035241 Bacteria 1756
251 Ga0373924_0013436 3300035410 Bacteria 3077
252 Ga0373931_0142342 3300035691 Unclassified 1390
253 Ga0373931_0277318 3300035691 Bacteria 1028
254 Ga0373935_0122289 3300035692 Bacteria 1740
255 Ga0373935_0127813 3300035692 Bacteria 1704
256 Ga0373935_0188565 3300035692 Bacteria 1419
257 Ga0373935_0196438 3300035692 Bacteria 1392
258 Ga0373927_0010191 3300035695 Bacteria 6281
259 Ga0373927_0111523 3300035695 Bacteria 1782
260 Ga0373927_0152575 3300035695 Bacteria 1513
261 Ga0373927_0790936 3300035695 Bacteria 627
262 Ga0373933_0002243 3300035724 Bacteria 11028
263 Ga0373933_0002303 3300035724 Bacteria 10854
264 Ga0373933_0130022 3300035724 Bacteria 1583
265 Ga0373947_0543608 3300035725 Bacteria 790
266 Ga0373937_0000762 3300036401 Bacteria 27818
267 Ga0373937_0000924 3300036401 Bacteria 24924
268 Ga0373937_0005768 3300036401 Bacteria 10643
269 Ga0373937_0050535 3300036401 Bacteria 3808
270 Ga0373937_0139057 3300036401 Bacteria 2271
271 Ga0373937_0173578 3300036401 Bacteria 2023
272 Ga0373925_0022212 3300037068 Bacteria 4627
273 Ga0373925_0035803 3300037068 Bacteria 3664
274 Ga0373925_0100335 3300037068 Bacteria 2224
275 Ga0373925_0156707 3300037068 Bacteria 1791
276 Ga0373925_0180035 3300037068 Bacteria 1673
277 Ga0373925_0240122 3300037068 Bacteria 1451
278 Ga0395900_0218716 3300037418 Bacteria 1921
279 Ga0395905_0018303 3300037471 Bacteria 6650
280 Ga0436364_0353649 3300037853 Bacteria 72201
281 Ga0436364_0418834 3300037853 Bacteria 2584
282 Ga0436364_0633289 3300037853 Bacteria 36023
283 Ga0436364_0858825 3300037853 Bacteria 170378
284 Ga0436364_1107335 3300037853 Bacteria 1213
285 Ga0436364_1232718 3300037853 Bacteria 2625
286 Ga0436364_1253898 3300037853 Bacteria 947
287 Ga0436364_1458773 3300037853 Bacteria 2815
288 Ga0395901_0454273 3300038443 Bacteria 1310
289 Ga0436365_0051328 3300039437 Bacteria 1158
290 Ga0436365_0382379 3300039437 Bacteria 2329
291 Ga0436365_0513493 3300039437 Bacteria 2879
292 Ga0436365_1316481 3300039437 Bacteria 1123
293 Ga0436365_1422212 3300039437 Bacteria 3346
294 Ga0436360_0097345 3300039438 Bacteria 5103
295 Ga0436360_0476827 3300039438 Bacteria 1840
296 Ga0436360_1182100 3300039438 Unclassified 901
297 Ga0436361_0017284 3300039447 Bacteria 882
298 Ga0436361_0040634 3300039447 Bacteria 3540
299 Ga0436361_0065337 3300039447 Bacteria 4838
300 Ga0436361_0168536 3300039447 Bacteria 2473
301 Ga0436361_0277843 3300039447 Bacteria 2722
302 Ga0436361_0676184 3300039447 Bacteria 6962
303 Ga0436361_0787629 3300039447 Bacteria 1418
304 Ga0436361_0970186 3300039447 Unclassified 869
305 Ga0436361_1048292 3300039447 Bacteria 1019
306 Ga0436363_0790828 3300039450 Bacteria 2589
307 Ga0436363_0880485 3300039450 Bacteria 3938
308 Ga0436362_0038953 3300039453 Bacteria 3316
309 Ga0436362_0045182 3300039453 Bacteria 1541
310 Ga0436362_0046892 3300039453 Bacteria 1135
311 Ga0436362_0138512 3300039453 Bacteria 3632
312 Ga0436362_0570674 3300039453 Bacteria 2511
313 Ga0436362_1229665 3300039453 Bacteria 3116
314 Ga0466958_0268420 3300045836 Bacteria 1093
315 Ga0466967_0216760 3300045976 Bacteria 1817
316 Ga0495592_0011139 3300046454 Bacteria 6791
317 Ga0495592_0026343 3300046454 Bacteria 4408
318 Ga0495603_0046788 3300046455 Bacteria 2577
319 Ga0495629_0018339 3300046459 Bacteria 5009
320 Ga0495629_0099081 3300046459 Bacteria 2033
321 Ga0495629_0317887 3300046459 Bacteria 1064
322 Ga0495641_0057471 3300046461 Bacteria 1762
323 Ga0495651_0000214 3300046462 Bacteria 44308
324 Ga0495651_0001546 3300046462 Bacteria 17783
325 Ga0495653_0000751 3300046463 Bacteria 24812
326 Ga0495653_0002809 3300046463 Bacteria 13899
327 Ga0495653_0369431 3300046463 Bacteria 918
328 Ga0495580_0024294 3300046472 Bacteria 4441
329 Ga0495580_0051242 3300046472 Bacteria 2918
330 Ga0495580_0178403 3300046472 Bacteria 1467
331 Ga0495582_0565988 3300046473 Bacteria 657
332 Ga0495639_0023910 3300046475 Bacteria 2687
333 Ga0495639_0163079 3300046475 Bacteria 1079
334 Ga0495662_0039542 3300046476 Bacteria 2278
335 Ga0495664_0024005 3300046477 Bacteria 3541
336 Ga0495664_0054201 3300046477 Bacteria 2385
337 Ga0495664_0099157 3300046477 Bacteria 1754
338 Ga0495594_0022565 3300046499 Bacteria 3367
339 Ga0495608_0001175 3300046511 Bacteria 18562
340 Ga0495608_0002236 3300046511 Bacteria 13982
341 Ga0495608_0057338 3300046511 Bacteria 2571
342 Ga0495618_0000816 3300046514 Bacteria 21684
343 Ga0495618_0002115 3300046514 Bacteria 13007
344 Ga0495618_0402818 3300046514 Bacteria 836
345 Ga0495628_0016233 3300046516 Bacteria 6213
346 Ga0495628_0091535 3300046516 Bacteria 2353
347 Ga0495630_0010181 3300046517 Bacteria 6780
348 Ga0495630_0026699 3300046517 Bacteria 4278
349 Ga0495637_0058249 3300046520 Bacteria 1593
350 Ga0495666_0069440 3300046526 Bacteria 1676
351 Ga0495652_0004436 3300046529 Bacteria 13418
352 Ga0495652_0008524 3300046529 Bacteria 9349
353 Ga0495640_0002372 3300046533 Bacteria 15107
354 Ga0495640_0002953 3300046533 Bacteria 13699
355 Ga0495640_0068708 3300046533 Bacteria 2383
356 Ga0495640_0504200 3300046533 Unclassified 736
357 Ga0495586_0015678 3300046535 Bacteria 4032
358 Ga0495586_0312312 3300046535 Bacteria 901
359 Ga0495587_0001742 3300046536 Bacteria 14530
360 Ga0495587_0005973 3300046536 Bacteria 7939
361 Ga0495645_0013273 3300046543 Bacteria 5822
362 Ga0495645_0015527 3300046543 Bacteria 5416
363 Ga0495645_0448196 3300046543 Bacteria 814
364 Ga0495622_0326832 3300046557 Bacteria 666
365 Ga0495667_0001318 3300046559 Bacteria 16303
366 Ga0495667_0001891 3300046559 Bacteria 13903
367 Ga0495667_0019271 3300046559 Bacteria 4604
368 Ga0495667_0090065 3300046559 Bacteria 1988
369 Ga0495634_0033078 3300046642 Bacteria 3554
370 Ga0495634_0042867 3300046642 Bacteria 3068
371 Ga0495634_0118084 3300046642 Bacteria 1700
372 Ga0495635_0000562 3300046663 Bacteria 23704
373 Ga0495635_0004482 3300046663 Bacteria 9674
374 Ga0495635_0136163 3300046663 Bacteria 1674
375 Ga0495635_0215282 3300046663 Bacteria 1300
376 Ga0495657_0009153 3300046675 Bacteria 7523
377 Ga0495657_0014235 3300046675 Bacteria 5844
378 Ga0495599_0001324 3300046678 Bacteria 14120
379 Ga0495599_0001354 3300046678 Bacteria 13990
380 Ga0495623_0001408 3300046679 Bacteria 16335
381 Ga0495623_0029362 3300046679 Bacteria 3538
382 Ga0495646_0007185 3300046680 Bacteria 7072
383 Ga0495646_0007540 3300046680 Bacteria 6913
384 Ga0495647_0022390 3300046681 Bacteria 2282
385 Ga0495658_0059251 3300046683 Bacteria 2192
386 Ga0495669_0345753 3300046684 Bacteria 719
387 Ga0495613_0593558 3300046689 Bacteria 737
388 Ga0495624_0076971 3300046690 Bacteria 2069
389 Ga0495600_0001313 3300046809 Bacteria 13722
390 Ga0495600_0002979 3300046809 Bacteria 9881
391 Ga0495581_0047973 3300047315 Bacteria 2467
392 Ga0495581_0090953 3300047315 Bacteria 1770
393 Ga0495604_0000382 3300047317 Bacteria 40024
394 Ga0495604_0003532 3300047317 Bacteria 12463
395 Ga0495674_0011647 3300047319 Bacteria 8293
396 Ga0495674_0016741 3300047319 Bacteria 6839
397 Ga0495676_0076414 3300047321 Bacteria 2557
398 Ga0495676_0718878 3300047321 Bacteria 645
399 Ga0495680_0001240 3300047322 Bacteria 27994
400 Ga0495680_0004385 3300047322 Bacteria 13515
401 Ga0495680_0091498 3300047322 Bacteria 2280
402 Ga0495680_0371273 3300047322 Bacteria 992
403 Ga0495675_0001408 3300047444 Bacteria 14565
404 Ga0495675_0067668 3300047444 Bacteria 2256
405 Ga0495684_0013473 3300047471 Bacteria 6292
406 Ga0495684_0091977 3300047471 Bacteria 2297
407 Ga0495684_0391094 3300047471 Bacteria 978
408 Ga0495593_0255403 3300047673 Bacteria 877
409 Ga0495602_0005409 3300048088 Bacteria 13398
410 Ga0495602_0077170 3300048088 Bacteria 2820
411 Ga0496101_0314918 3300048904 Bacteria 1227
412 Ga0496103_0129934 3300048906 Bacteria 1608
413 Ga0496106_0083650 3300048909 Bacteria 2454
414 Ga0496107_0195428 3300048910 Bacteria 1503
415 Ga0496108_0771335 3300048911 Unclassified 831
416 Ga0496109_0064616 3300048912 Bacteria 3349
417 Ga0496109_0224570 3300048912 Bacteria 1767
418 Ga0496111_0094575 3300048914 Bacteria 2192
419 Ga0496111_0335527 3300048914 Unclassified 1119
420 Ga0496112_0032195 3300048915 Bacteria 5090
421 Ga0496113_0302308 3300048916 Bacteria 1281
422 Ga0496114_0065703 3300048917 Bacteria 3039
423 Ga0496115_0039419 3300048918 Bacteria 3751
424 Ga0496120_0090434 3300048923 Bacteria 1636
425 Ga0496126_0449955 3300048929 Bacteria 1037
426 Ga0501034_0032792 3300049571 Bacteria 5274
427 Ga0501038_0234270 3300049574 Bacteria 1460
428 Ga0501039_0414917 3300049575 Bacteria 1057
429 Ga0501040_0250848 3300049576 Bacteria 1262
430 Ga0501040_0360583 3300049576 Bacteria 1042
431 Ga0501047_0490270 3300049581 Bacteria 1056
432 Ga0501067_0022102 3300049583 Bacteria 3520
433 Ga0501070_0015296 3300049586 Bacteria 6456
434 Ga0501070_0063981 3300049586 Bacteria 3047
435 Ga0501070_0098691 3300049586 Bacteria 2416
436 Ga0501070_0875175 3300049586 Bacteria 702
437 Ga0501071_0248261 3300049587 Bacteria 1343
438 Ga0501073_0336977 3300049589 Bacteria 1041
439 Ga0501076_0259338 3300049592 Bacteria 1423
440 Ga0501076_0683534 3300049592 Bacteria 847
441 Ga0501080_0050364 3300049742 Bacteria 3876
442 Ga0501080_0449686 3300049742 Bacteria 1155
443 Ga0501080_0660852 3300049742 Unclassified 924
444 Ga0501081_0537820 3300049743 Bacteria 872
445 Ga0501083_0006679 3300049744 Bacteria 8183
446 Ga0501083_0007316 3300049744 Bacteria 7827
447 Ga0501035_0535041 3300049822 Bacteria 961
448 Ga0501044_0370367 3300049823 Bacteria 1349
449 nmdc:mga05p37_28516_c1 3300050507 Bacteria 6806
450 nmdc:mga05p37_74_c1 3300050507 Bacteria 87063
451 nmdc:mga09592_3887_c1 3300050508 Bacteria 12035
452 nmdc:mga0qj67_8855_c1 3300050509 Bacteria 7469
453 nmdc:mga06r32_2556_c1 3300050510 Bacteria 16281
454 nmdc:mga06r32_334929_c1 3300050510 Bacteria 1498
455 nmdc:mga08y16_149383_c1 3300050511 Bacteria 2429
456 nmdc:mga08y16_373_c1 3300050511 Bacteria 40656
457 nmdc:mga0rr50_552095_c1 3300050513 Unclassified 981
458 nmdc:mga0rr50_92973_c1 3300050513 Bacteria 2352
459 nmdc:mga08x19_245071_c1 3300050514 Bacteria 1236
460 nmdc:mga08x19_43421_c1 3300050514 Bacteria 2868
461 Ga0495601_0008097 3300053077 Bacteria 6195
462 Ga0495601_0014115 3300053077 Bacteria 4813
463 Ga0495601_0023451 3300053077 Bacteria 3791
464 Ga0495601_0086831 3300053077 Bacteria 2010
465 Ga0495601_0097332 3300053077 Bacteria 1898
466 Ga0495612_0003904 3300053078 Bacteria 6177
467 Ga0495612_0017824 3300053078 Bacteria 2842
468 Ga0495612_0037027 3300053078 Bacteria 1980
469 Ga0495595_0000739 3300053084 Bacteria 12404
470 Ga0495595_0001115 3300053084 Bacteria 10391
471 Ga0495595_0012424 3300053084 Bacteria 3580
472 Ga0495595_0016785 3300053084 Bacteria 3138
473 Ga0495619_0001660 3300053085 Bacteria 14690
474 Ga0495619_0002026 3300053085 Bacteria 13468
475 Ga0495619_0292921 3300053085 Bacteria 1127
476 Ga0495619_0301642 3300053085 Bacteria 1109
477 Ga0500595_017527 3300053119 Bacteria 2641
478 Ga0500573_0442364 3300053140 Bacteria 603
479 Ga0501084_0033650 3300054114 Bacteria 4287
480 Ga0501084_0403564 3300054114 Bacteria 1155
481 Ga0501082_0060359 3300060353 Bacteria 3265
482 Ga0501082_0062930 3300060353 Bacteria 3195
483 Ga0501082_0075274 3300060353 Bacteria 2908
484 Ga0501082_0188355 3300060353 Bacteria 1795
485 2671692009 2671180139 Bacteria 4196045
486 2715500952 2713897090 Bacteria 3353799
487 2834578656 2834578030 Bacteria 3530182
488 2842339501 2842333319 Bacteria 8899485
489 2899261777 2899259804 Bacteria 3320927
490 Ga0070714_100060301
491 Ga0070690_100148400
492 Ga0070690_100254534
493 Ga0070670_100006413
494 Ga0070670_100051249
495 Ga0070666_10059068
496 Ga0070680_100034694
497 Ga0070689_100939740
498 Ga0070675_100029164
499 Ga0070675_100494851
500 Ga0070671_100000616
501 Ga0070671_100132730
502 Ga0070671_100485211
503 Ga0070674_100695739
504 Ga0070673_100145997
505 Ga0070688_100083373
506 Ga0070659_100310422
507 Ga0070709_10048746
508 Ga0070709_10144274
509 Ga0070714_100008196
510 Ga0070714_100066413
511 Ga0070714_100193628
512 Ga0070714_100540192
513 Ga0070713_100005641
514 Ga0070713_100082161
515 Ga0070713_100087250
516 Ga0070713_100274900
517 Ga0070710_10116037
518 Ga0070710_10132373
519 Ga0070710_10241278
520 Ga0070710_10264839
521 Ga0070711_100030259
522 Ga0070711_100063788
523 Ga0070711_100123357
524 Ga0070711_100153370
525 Ga0070711_100206794
526 Ga0070711_100211708
527 Ga0070694_100173861
528 Ga0070708_100451413
529 Ga0070663_100025316
530 Ga0070681_10011691
531 Ga0070681_10166684
532 Ga0070681_10313854
533 Ga0070681_10722776
534 Ga0070706_100273650
535 Ga0070706_100306027
536 Ga0070707_100009252
537 Ga0070707_100402061
538 Ga0070707_100820806
539 Ga0070698_100007175
540 Ga0070699_100005426
541 Ga0070699_100143330
542 Ga0070679_100021727
543 Ga0070679_100167436
544 Ga0070679_100952507
545 Ga0070684_100927595
546 Ga0070684_101114483
547 Ga0070697_100046331
548 Ga0070697_100057230
549 Ga0070697_100181958
550 Ga0070696_100014897
551 Ga0070693_100066083
552 Ga0070665_100015358
553 Ga0070665_100056305
554 Ga0070665_100201908
555 Ga0070665_100835555
556 Ga0070664_100429717
557 Ga0070664_100490820
558 Ga0068856_100123187
559 Ga0068863_101000440
560 Ga0068863_101159572
561 Ga0068858_100101135
562 Ga0081540_1014562
563 Ga0070717_10002318
564 Ga0070717_10018487
565 Ga0070717_10118623
566 Ga0070717_10196011
567 Ga0070717_10262572
568 Ga0070717_10263998
569 Ga0070717_10355053
570 Ga0070716_100038583
571 Ga0070712_100016002
572 Ga0070712_100021105
573 Ga0070712_100070480
574 Ga0070712_100227466
575 Ga0070712_100335489
576 Ga0070712_100609037
577 Ga0068871_100023984
578 Ga0075428_100001793
579 Ga0075428_100329593
580 Ga0075430_100014121
581 Ga0075431_100000136
582 Ga0075431_100147913
583 Ga0075434_100462348
584 Ga0075429_100003755
585 Ga0075436_100023205
586 Ga0075435_100092730
587 Ga0099795_10005043
588 Ga0105240_10314164
589 Ga0105240_10324735
590 Ga0105240_11096466
591 Ga0111539_10000405
592 Ga0105245_10059044
593 Ga0105245_10069575
594 Ga0105245_10933009
595 Ga0105247_10034297
596 Ga0114129_10002465
597 Ga0114129_10056071
598 Ga0105241_10502876
599 Ga0105242_10340737
600 Ga0105248_10332794
601 Ga0105248_10371488
602 Ga0105237_10128164
603 Ga0105237_10195259
604 Ga0105238_10008782
605 Ga0105238_10463377
606 Ga0105249_10400955
607 Ga0099796_10001195
608 Ga0099796_10010641
609 Ga0099796_10036901
610 Ga0099796_10049161
611 Ga0099796_10054898
612 Ga0099796_10150063
613 Ga0099796_10227430
614 Ga0105239_10254170
615 Ga0105246_10081449
616 Ga0105246_10395670
617 Ga0157370_10012644
618 Ga0157378_10096777
619 Ga0163162_10906128
620 Ga0157372_10210417
621 Ga0157375_10293653
622 Ga0157375_10411143
623 Ga0157375_10755328
624 Ga0163163_10036308
625 Ga0182008_10057689
626 Ga0182008_10453532
627 Ga0157376_10136183
628 Ga0163161_10145837
629 Ga0206352_10353453
630 Ga0206353_10030760
631 Ga0213872_10102219
632 Ga0213872_10105122
633 Ga0213874_10056085
634 Ga0213876_10080731
635 Ga0213875_10000718
636 Ga0213875_10000862
637 Ga0213875_10008550
638 Ga0213875_10047552
639 Ga0213875_10122698
640 Ga0224712_10291788
641 Ga0228598_1028399
642 Ga0207692_10282950
643 Ga0207680_10061377
644 Ga0207699_10382795
645 Ga0207684_10377148
646 Ga0207707_10011871
647 Ga0207695_10199093
648 Ga0207695_10226060
649 Ga0207693_10002603
650 Ga0207693_10005621
651 Ga0207693_10019672
652 Ga0207693_10030729
653 Ga0207663_10027141
654 Ga0207660_10058663
655 Ga0207660_10087547
656 Ga0207649_10082358
657 Ga0207652_10020263
658 Ga0207652_10121742
659 Ga0207646_10013906
660 Ga0207646_10298344
661 Ga0207646_10340265
662 Ga0207681_10659273
663 Ga0207694_10000574
664 Ga0207650_10088910
665 Ga0207687_10042756
666 Ga0207687_10304930
667 Ga0207700_10006946
668 Ga0207700_10016810
669 Ga0207700_10057414
670 Ga0207700_10113043
671 Ga0207700_10344818
672 Ga0207664_10061469
673 Ga0207664_10074453
674 Ga0207644_10016446
675 Ga0207706_10094923
676 Ga0207670_10396061
677 Ga0207669_10284749
678 Ga0207704_10933902
679 Ga0207665_10045049
680 Ga0207665_10790976
681 Ga0207689_10200738
682 Ga0207667_10488770
683 Ga0207667_10946106
684 Ga0207651_10124896
685 Ga0207678_10021037
686 Ga0207702_10011039
687 Ga0207641_10827846
688 Ga0207683_10021920
689 Ga0207428_10000994
690 Ga0268266_10363267
691 Ga0268266_10826324
692 Ga0265330_10040204
693 Ga0265330_10108475
694 Ga0265328_10105984
695 Ga0265327_10000620
696 Ga0265327_10047379
697 Ga0265316_10017316
698 Ga0265316_10158933
699 Ga0265316_10275782
700 Ga0265314_10007080
701 Ga0307406_10282439
702 Ga0307406_10369673
703 Ga0307409_100592556
704 Ga0307416_100367907
705 Ga0373930_0036385
706 Ga0373958_0042495
707 Ga0373959_0075613
708 Ga0373934_0006319
709 Ga0373934_0016202
710 Ga0373934_0119180
711 Ga0373944_0060388
712 Ga0373949_0044408
713 Ga0373951_0029526
714 Ga0373951_0030663
715 Ga0373923_0010823
716 Ga0373923_0088567
717 Ga0373923_0095777
718 Ga0373923_0272260
719 Ga0373936_0015693
720 Ga0373936_0016316
721 Ga0373945_0011766
722 Ga0373953_0001354
723 Ga0373953_0043594
724 Ga0373954_0008431
725 Ga0373954_0019894
726 Ga0373956_0002487
727 Ga0373956_0037752
728 Ga0373957_0038274
729 Ga0373957_0132156
730 Ga0373943_0261496
731 Ga0373943_0332677
732 Ga0373946_0084263
733 Ga0373946_0170329
734 Ga0373955_0003996
735 Ga0373955_0020357
736 Ga0373955_0139140
737 Ga0373955_0158896
738 Ga0373955_0267760
739 Ga0373961_0020308
740 Ga0373924_0013436
741 Ga0373931_0142342
742 Ga0373931_0277318
743 Ga0373935_0122289
744 Ga0373935_0127813
745 Ga0373935_0188565
746 Ga0373935_0196438
747 Ga0373927_0010191
748 Ga0373927_0111523
749 Ga0373927_0152575
750 Ga0373927_0790936
751 Ga0373933_0002243
752 Ga0373933_0002303
753 Ga0373933_0130022
754 Ga0373947_0543608
755 Ga0373937_0000762
756 Ga0373937_0000924
757 Ga0373937_0005768
758 Ga0373937_0050535
759 Ga0373937_0139057
760 Ga0373937_0173578
761 Ga0373925_0022212
762 Ga0373925_0035803
763 Ga0373925_0100335
764 Ga0373925_0156707
765 Ga0373925_0180035
766 Ga0373925_0240122
767 Ga0395900_0218716
768 Ga0395905_0018303
769 Ga0436364_0353649
770 Ga0436364_0418834
771 Ga0436364_0633289
772 Ga0436364_0858825
773 Ga0436364_1107335
774 Ga0436364_1232718
775 Ga0436364_1253898
776 Ga0436364_1458773
777 Ga0395901_0454273
778 Ga0436365_0051328
779 Ga0436365_0382379
780 Ga0436365_0513493
781 Ga0436365_1316481
782 Ga0436365_1422212
783 Ga0436360_0097345
784 Ga0436360_0476827
785 Ga0436360_1182100
786 Ga0436361_0017284
787 Ga0436361_0040634
788 Ga0436361_0065337
789 Ga0436361_0168536
790 Ga0436361_0277843
791 Ga0436361_0676184
792 Ga0436361_0787629
793 Ga0436361_0970186
794 Ga0436361_1048292
795 Ga0436363_0790828
796 Ga0436363_0880485
797 Ga0436362_0038953
798 Ga0436362_0045182
799 Ga0436362_0046892
800 Ga0436362_0138512
801 Ga0436362_0570674
802 Ga0436362_1229665
803 Ga0466958_0268420
804 Ga0466967_0216760
805 Ga0495592_0011139
806 Ga0495592_0026343
807 Ga0495603_0046788
808 Ga0495629_0018339
809 Ga0495629_0099081
810 Ga0495629_0317887
811 Ga0495641_0057471
812 Ga0495651_0000214
813 Ga0495651_0001546
814 Ga0495653_0000751
815 Ga0495653_0002809
816 Ga0495653_0369431
817 Ga0495580_0024294
818 Ga0495580_0051242
819 Ga0495580_0178403
820 Ga0495582_0565988
821 Ga0495639_0023910
822 Ga0495639_0163079
823 Ga0495662_0039542
824 Ga0495664_0024005
825 Ga0495664_0054201
826 Ga0495664_0099157
827 Ga0495594_0022565
828 Ga0495608_0001175
829 Ga0495608_0002236
830 Ga0495608_0057338
831 Ga0495618_0000816
832 Ga0495618_0002115
833 Ga0495618_0402818
834 Ga0495628_0016233
835 Ga0495628_0091535
836 Ga0495630_0010181
837 Ga0495630_0026699
838 Ga0495637_0058249
839 Ga0495666_0069440
840 Ga0495652_0004436
841 Ga0495652_0008524
842 Ga0495640_0002372
843 Ga0495640_0002953
844 Ga0495640_0068708
845 Ga0495640_0504200
846 Ga0495586_0015678
847 Ga0495586_0312312
848 Ga0495587_0001742
849 Ga0495587_0005973
850 Ga0495645_0013273
851 Ga0495645_0015527
852 Ga0495645_0448196
853 Ga0495622_0326832
854 Ga0495667_0001318
855 Ga0495667_0001891
856 Ga0495667_0019271
857 Ga0495667_0090065
858 Ga0495634_0033078
859 Ga0495634_0042867
860 Ga0495634_0118084
861 Ga0495635_0000562
862 Ga0495635_0004482
863 Ga0495635_0136163
864 Ga0495635_0215282
865 Ga0495657_0009153
866 Ga0495657_0014235
867 Ga0495599_0001324
868 Ga0495599_0001354
869 Ga0495623_0001408
870 Ga0495623_0029362
871 Ga0495646_0007185
872 Ga0495646_0007540
873 Ga0495647_0022390
874 Ga0495658_0059251
875 Ga0495669_0345753
876 Ga0495613_0593558
877 Ga0495624_0076971
878 Ga0495600_0001313
879 Ga0495600_0002979
880 Ga0495581_0047973
881 Ga0495581_0090953
882 Ga0495604_0000382
883 Ga0495604_0003532
884 Ga0495674_0011647
885 Ga0495674_0016741
886 Ga0495676_0076414
887 Ga0495676_0718878
888 Ga0495680_0001240
889 Ga0495680_0004385
890 Ga0495680_0091498
891 Ga0495680_0371273
892 Ga0495675_0001408
893 Ga0495675_0067668
894 Ga0495684_0013473
895 Ga0495684_0091977
896 Ga0495684_0391094
897 Ga0495593_0255403
898 Ga0495602_0005409
899 Ga0495602_0077170
900 Ga0496101_0314918
901 Ga0496103_0129934
902 Ga0496106_0083650
903 Ga0496107_0195428
904 Ga0496108_0771335
905 Ga0496109_0064616
906 Ga0496109_0224570
907 Ga0496111_0094575
908 Ga0496111_0335527
909 Ga0496112_0032195
910 Ga0496113_0302308
911 Ga0496114_0065703
912 Ga0496115_0039419
913 Ga0496120_0090434
914 Ga0496126_0449955
915 Ga0501034_0032792
916 Ga0501038_0234270
917 Ga0501039_0414917
918 Ga0501040_0250848
919 Ga0501040_0360583
920 Ga0501047_0490270
921 Ga0501067_0022102
922 Ga0501070_0015296
923 Ga0501070_0063981
924 Ga0501070_0098691
925 Ga0501070_0875175
926 Ga0501071_0248261
927 Ga0501073_0336977
928 Ga0501076_0259338
929 Ga0501076_0683534
930 Ga0501080_0050364
931 Ga0501080_0449686
932 Ga0501080_0660852
933 Ga0501081_0537820
934 Ga0501083_0006679
935 Ga0501083_0007316
936 Ga0501035_0535041
937 Ga0501044_0370367
938 nmdc:mga05p37_28516_c1
939 nmdc:mga05p37_74_c1
940 nmdc:mga09592_3887_c1
941 nmdc:mga0qj67_8855_c1
942 nmdc:mga06r32_2556_c1
943 nmdc:mga06r32_334929_c1
944 nmdc:mga08y16_149383_c1
945 nmdc:mga08y16_373_c1
946 nmdc:mga0rr50_552095_c1
947 nmdc:mga0rr50_92973_c1
948 nmdc:mga08x19_245071_c1
949 nmdc:mga08x19_43421_c1
950 Ga0495601_0008097
951 Ga0495601_0014115
952 Ga0495601_0023451
953 Ga0495601_0086831
954 Ga0495601_0097332
955 Ga0495612_0003904
956 Ga0495612_0017824
957 Ga0495612_0037027
958 Ga0495595_0000739
959 Ga0495595_0001115
960 Ga0495595_0012424
961 Ga0495595_0016785
962 Ga0495619_0001660
963 Ga0495619_0002026
964 Ga0495619_0292921
965 Ga0495619_0301642
966 Ga0500595_017527
967 Ga0500573_0442364
968 Ga0501084_0033650
969 Ga0501084_0403564
970 Ga0501082_0060359
971 Ga0501082_0062930
972 Ga0501082_0075274
973 Ga0501082_0188355
974 2671692009
975 2715500952
976 2834578656
977 2842339501
978 2899261777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

29

189

0.87

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

25

169

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

44

168

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c37-assembly1.cif.gz_A mycobacterium smegmatis rimj in complex with coa-disulfide 0.927 14 193
3igr-assembly1.cif.gz_A the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a 0.9115 14 192
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.911 14 189
1z9u-assembly1.cif.gz_A structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium 0.9105 14 191
1nsl-assembly1.cif.gz_D crystal structure of probable acetyltransferase 0.9086 13 193
ID Description Score Start End Superfamily
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9591 122 192 3.40.630.30
af_P0A948_10_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9405 14 192 3.40.630.30
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9356 17 193 3.40.630.30
3r9eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9267 20 189 3.40.630.30
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9254 17 193 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A426U3D9-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9885 89 191 GO:0005737
GO:0008999
AF-A0A1H9W947-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9793 116 188 GO:0016747
AF-A0A840I177-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase (EC 2.3.1.267) 0.9784 15 192 GO:0005737
GO:0008999
GO:1990189
AF-A0A5C7NQT4-F1-model_v4 deleted 0.978 14 191
AF-A0A519QAZ6-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9776 14 178 GO:0005737
GO:0008999

Map